CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046902	Pseudomonas stutzeri strain PM101005 chromosome, complete genome	0 crisprs	DEDDh,csa3,cas3,DinG,WYL	0	0	3	0
NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	1 crisprs	csa3	0	13	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2771909 : 2781140

uncultured_Caudovirales_phage(87.5%)

protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158188398.1\|2771909_2773190_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.3e-97	54.6
WP_158188399.1\|2773328_2774726_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_158188400.1\|2774774_2775773_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_158188401.1\|2775861_2776845_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.6e-146	77.1
WP_158190102.1\|2776841_2777177_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.0e-39	70.3
WP_158188402.1\|2777173_2777476_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.7e-22	56.0
WP_158188403.1\|2777475_2777835_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.3e-32	60.8
WP_158188404.1\|2777834_2778227_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.8e-51	76.0
WP_158188405.1\|2778314_2778983_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	1.3e-86	78.5
WP_158188406.1\|2779514_2781140_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-56	40.8

DBSCAN-SWA_2

3463114 : 3471943

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158188919.1\|3463114_3464284_-	DUF3596 domain-containing protein	A0A2H4JGM5	uncultured_Caudovirales_phage	1.6e-220	95.4
WP_158188920.1\|3464374_3464566_-	hypothetical protein	A0A2H4J958	uncultured_Caudovirales_phage	3.3e-19	79.4
WP_158188921.1\|3464558_3464795_-	hypothetical protein	A0A2H4JE76	uncultured_Caudovirales_phage	8.2e-20	72.9
WP_158188922.1\|3464784_3465027_-	hypothetical protein	NA	NA	NA	NA
WP_158188923.1\|3465087_3465240_-	hypothetical protein	A0A2H4J964	uncultured_Caudovirales_phage	1.2e-08	66.0
WP_158188924.1\|3465263_3465488_-	hypothetical protein	NA	NA	NA	NA
WP_158188925.1\|3465523_3468274_-	bifunctional DNA primase/helicase	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	82.7
WP_158188926.1\|3468270_3468480_-	hypothetical protein	NA	NA	NA	NA
WP_158188927.1\|3468476_3468710_-	hypothetical protein	A0A2H4J938	uncultured_Caudovirales_phage	1.6e-12	50.0
WP_158188928.1\|3468706_3468946_-	hypothetical protein	A0A2H4JGL7	uncultured_Caudovirales_phage	3.4e-29	83.8
WP_158188929.1\|3469022_3469397_-	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	8.7e-40	68.5
WP_158188930.1\|3469393_3469711_-	transcriptional regulator	A0A2H4JAW0	uncultured_Caudovirales_phage	8.1e-39	82.9
WP_158190133.1\|3469782_3470229_-	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	2.1e-56	75.7
WP_158188931.1\|3470291_3470546_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	6.7e-36	90.5
WP_158188932.1\|3470627_3470978_+	transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	7.6e-46	81.8
WP_158188933.1\|3471019_3471670_+	hypothetical protein	A0A2H4J954	uncultured_Caudovirales_phage	4.3e-18	61.8
WP_158188934.1\|3471700_3471943_+	XRE family transcriptional regulator	A0A2H4J926	uncultured_Caudovirales_phage	8.1e-31	82.1

DBSCAN-SWA_3

3475636 : 3516196

uncultured_Caudovirales_phage(61.76%)

terminase,capsid,portal,plate,tail,holin,head,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158188939.1\|3475636_3476902_+	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	1.6e-106	47.0
WP_158188940.1\|3477020_3477173_+	hypothetical protein	NA	NA	NA	NA
WP_158188941.1\|3477426_3477609_-	hypothetical protein	NA	NA	NA	NA
WP_158188942.1\|3477581_3478820_-	phage late control D family protein	A0A2H4JAV0	uncultured_Caudovirales_phage	7.5e-197	84.6
WP_158188943.1\|3478816_3479257_-	oxidoreductase	A0A2H4JG54	uncultured_Caudovirales_phage	4.0e-68	87.7
WP_158188944.1\|3479275_3481849_-\|tail	phage tail tape measure protein	A0A2H4JE61	uncultured_Caudovirales_phage	5.6e-295	69.7
WP_158188945.1\|3481823_3481964_-\|tail	GpE family phage tail protein	A0A2H4JFK5	uncultured_Caudovirales_phage	1.4e-14	89.7
WP_158188946.1\|3481969_3482269_-\|tail	phage tail assembly protein	A0A2H4J944	uncultured_Caudovirales_phage	2.6e-31	78.7
WP_158188947.1\|3482323_3482839_-\|tail	phage major tail tube protein	A0A2H4J916	uncultured_Caudovirales_phage	5.5e-85	88.3
WP_158188948.1\|3482885_3484076_-\|tail	phage tail protein	A0A2H4JCP8	uncultured_Caudovirales_phage	5.9e-191	84.6
WP_158188949.1\|3484229_3485003_-	hypothetical protein	A0A2H4J924	uncultured_Caudovirales_phage	6.2e-40	72.3
WP_158188950.1\|3485027_3487478_-	hypothetical protein	E5E3Q7	Burkholderia_phage	7.7e-28	35.9
WP_158188951.1\|3487477_3488026_-\|tail	phage tail protein I	A4JWT0	Burkholderia_virus	1.0e-44	46.9
WP_158188952.1\|3488018_3488915_-\|plate	baseplate assembly protein	D5LGZ3	Escherichia_phage	1.1e-83	56.5
WP_158188953.1\|3488911_3489265_-\|plate	baseplate assembly protein	A0A2H4JE52	uncultured_Caudovirales_phage	4.0e-47	81.6
WP_158190134.1\|3489261_3489804_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	2.7e-82	86.4
WP_158188954.1\|3489869_3490325_-	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	5.6e-57	77.1
WP_158188955.1\|3490317_3490845_-\|tail	phage tail protein	A0A2H4J906	uncultured_Caudovirales_phage	2.2e-65	80.9
WP_158188956.1\|3490947_3491391_-	DUF2570 domain-containing protein	Q9ZXL5	Pseudomonas_virus	4.6e-16	45.2
WP_158188957.1\|3491387_3491594_-	hypothetical protein	NA	NA	NA	NA
WP_158188958.1\|3491590_3492406_-	DUF3380 domain-containing protein	A0A2H4JGJ9	uncultured_Caudovirales_phage	3.9e-109	76.3
WP_158188959.1\|3492402_3492717_-\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	1.3e-17	44.2
WP_158190135.1\|3492709_3493156_-	hypothetical protein	A0A2H4J973	uncultured_Caudovirales_phage	1.4e-60	71.8
WP_158188960.1\|3493155_3493365_-\|tail	phage tail protein	A0A2H4J946	uncultured_Caudovirales_phage	2.9e-29	87.0
WP_158188961.1\|3493364_3493553_-	hypothetical protein	Q9ZXM0	Pseudomonas_virus	2.9e-20	90.2
WP_158188962.1\|3493552_3494017_-\|head	head completion/stabilization protein	A0A2H4JCS4	uncultured_Caudovirales_phage	6.3e-56	73.1
WP_158188963.1\|3494113_3494941_-\|terminase	terminase	A0A2H4J948	uncultured_Caudovirales_phage	1.2e-68	61.2
WP_158188964.1\|3494946_3495963_-\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	9.9e-147	72.6
WP_158188965.1\|3496006_3496825_-\|capsid	phage capsid protein	A0A2H4J928	uncultured_Caudovirales_phage	1.9e-119	85.2
WP_158190136.1\|3496981_3498745_+\|terminase	terminase	A0A2H4JGK4	uncultured_Caudovirales_phage	4.4e-283	82.9
WP_158188966.1\|3498744_3499737_+\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	3.2e-174	89.8
WP_158188967.1\|3499714_3500626_-	hypothetical protein	NA	NA	NA	NA
WP_158188968.1\|3501922_3502777_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.9e-26	32.9
WP_158188969.1\|3502861_3504601_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_158188970.1\|3504644_3504917_-	hypothetical protein	NA	NA	NA	NA
WP_158188971.1\|3504927_3505728_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_158188972.1\|3505742_3506606_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_158188973.1\|3506602_3507700_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.4e-16	26.3
WP_158188974.1\|3507710_3508793_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.2e-14	27.6
WP_158188975.1\|3509012_3510881_+	GAF domain-containing protein	NA	NA	NA	NA
WP_158188976.1\|3510964_3512350_-\|tRNA	cysteine--tRNA ligase	A0A2L2DK39	Acanthamoeba_polyphaga_mimivirus	3.5e-46	35.4
WP_158188977.1\|3512349_3514020_-\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.6e-205	62.5
WP_158188978.1\|3514366_3514861_+	peptidylprolyl isomerase	A0A076FI46	Aureococcus_anophage	5.4e-13	31.7
WP_158188979.1\|3514866_3515589_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_158188980.1\|3515590_3516196_-\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046903

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046903_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046903_1

63565-63887

Orphan

Consensus_repeat	Method
CATGGAATCTGTAGTCATGAG	CRT
TGGAATCTGTAGTCATGA	PILER-CR

7 spacers

The CRISPR arrays of NZ_CP046903_1

>merge|NZ_CP046903|1|63565-63887|CRT,PILER-CR
AATGGAATCTGTAGCCATGACAGCTTGATGCGGGTGATCTTCTCGACCTGGAATCTGTAGTCATGAGGTTTTCCTGAGGTCATGTCAGCATGGAATCTGTAGTCATAAGGCCACGCCGCCCTGGTTGGGAACATGGAATTTGTAGTCATGAGGCGTTCCGATCCGCTCGTTTCGCATGGAATCTGTAGTCATGACGCCGAGAGAGGGAGGTTTTCCACCTGGAATCTGTAGTCATGAGGGCTCCAAAGCCTGGCTTACGACATGGAATCTGTAGTCATGAGCCCGTTCGGAGCGCTGCTTAACATGGAATTTGTAGTCATCAG

>NZ_CP046903|1|1|63565-63887|CRT
AATGGAATCTGTAGCCATGAC	AGCTTGATGCGGGTGATCTTCTCGA
CCTGGAATCTGTAGTCATGAG	GTTTTCCTGAGGTCATGTCAG
CATGGAATCTGTAGTCATAAG	GCCACGCCGCCCTGGTTGGGAA
CATGGAATTTGTAGTCATGAG	GCGTTCCGATCCGCTCGTTTCG
CATGGAATCTGTAGTCATGAC	GCCGAGAGAGGGAGGTTTTCCA
CCTGGAATCTGTAGTCATGAG	GGCTCCAAAGCCTGGCTTACGA
CATGGAATCTGTAGTCATGAG	CCCGTTCGGAGCGCTGCTTAA
CATGGAATTTGTAGTCATCAG

>NZ_CP046903|1|1|63567-63844|PILER-CR
TGGAATCTGTAGCCATGA	CAGCTTGATGCGGGTGATCTTCTCGACC
TGGAATCTGTAGTCATGA	GGTTTTCCTGAGGTCATGTCAGCA
TGGAATCTGTAGTCATAA	GGCCACGCCGCCCTGGTTGGGAACA
TGGAATTTGTAGTCATGA	GGCGTTCCGATCCGCTCGTTTCGCA
TGGAATCTGTAGTCATGA	CGCCGAGAGAGGGAGGTTTTCCACC
TGGAATCTGTAGTCATGA	GGGCTCCAAAGCCTGGCTTACGACA
TGGAATCTGTAGTCATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046903.1\|WP_044314875.1\|55336_55696_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|320084
NZ_CP046903.1\|WP_044315039.1\|65463_65955_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046903.1\|WP_047882739.1\|73504_74485_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|225581
NZ_CP046903.1\|WP_019406703.1\|71013_72498_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223989
NZ_CP046903.1\|WP_063542201.1\|60839_62564_-\|DUF4942-domain-containing-protein	unknown	unknown	gnl\|CDD\|372683
NZ_CP046903.1\|WP_052816814.1\|56196_56958_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369935
NZ_CP046903.1\|WP_080902098.1\|66821_67262_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP046903.1\|WP_063542197.1\|59725_60094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046903.1\|WP_040137971.1\|67338_68460_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379049
NZ_CP046903.1\|WP_063542203.1\|62630_63461_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP046903.1\|WP_047883032.1\|74591_75485_-\|integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP046903.1\|WP_040137966.1\|66103_66649_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046903.1\|WP_155736335.1\|58870_59617_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|277367
NZ_CP046903.1\|WP_019406702.1\|69749_70652_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP046903.1\|WP_063542205.1\|64853_65201_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046903.1\|WP_063542199.1\|60164_60566_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274124
NZ_CP046903.1\|WP_044314876.1\|57145_58336_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP046903.1\|WP_158190239.1\|68465_69743_+\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|179607
NZ_CP046903.1\|WP_044314877.1\|58332_58701_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046903.1\|WP_040138111.1\|55772_56087_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP046903.1\|WP_044314875.1\|55336_55696_+\|DNA-binding-protein	gnl\|CDD\|320084	cd16170, MvaT_DBD, DNA-binding domain of the bacterial xenogeneic silencer MvaT. MvaT is a xenogeneic silencer conserved in Pseudomonas which assists in distinguishing foreign from self DNA. It prefers binding to flexible DNA segments with multiple TpA steps, and forms nucleoprotein filaments through cooperative polymerization.	2.68889e-18
NZ_CP046903.1\|WP_080902098.1\|66821_67262_+\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	3.51709e-34
NZ_CP046903.1\|WP_019406703.1\|71013_72498_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	3.33893e-56
NZ_CP046903.1\|WP_063542201.1\|60839_62564_-\|DUF4942-domain-containing-protein	gnl\|CDD\|372683	pfam13708, DUF4942, Domain of unknown function (DUF4942). The function of this family is not known.	5.86417e-18
NZ_CP046903.1\|WP_052816814.1\|56196_56958_+\|hypothetical-protein	gnl\|CDD\|369935	pfam08536, Whirly, Whirly transcription factor. This family contains the plant whirly transcription factors.	1.24695e-08
NZ_CP046903.1\|WP_019406702.1\|69749_70652_-\|DNA-binding-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	2.27494e-09
NZ_CP046903.1\|WP_063542203.1\|62630_63461_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.93282e-56
NZ_CP046903.1\|WP_047883032.1\|74591_75485_-\|integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.36201e-05
NZ_CP046903.1\|WP_155736335.1\|58870_59617_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|277367	cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain. PrpA and PrpB are bacterial type I serine/threonine and tyrosine phosphatases thought to modulate the expression of proteins that protect the cell upon accumulation of misfolded proteins in the periplasm. The PPP (phosphoprotein phosphatase) family, to which PrpA and PrpB belong, is one of two known protein phosphatase families specific for serine and threonine. This family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	8.74321e-59
NZ_CP046903.1\|WP_047882739.1\|73504_74485_-\|IS5-family-transposase	gnl\|CDD\|225581	COG3039, COG3039, Transposase and inactivated derivatives, IS5 family [DNA replication, recombination, and repair].	5.52924e-31
NZ_CP046903.1\|WP_063542199.1\|60164_60566_-\|hypothetical-protein	gnl\|CDD\|274124	TIGR02420, RNA_polymerase-binding_transcription_factor_DksA, RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage. [Transcription, Transcription factors, Regulatory functions, Small molecule interactions].	6.55107e-21
NZ_CP046903.1\|WP_044314876.1\|57145_58336_-\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	5.91508e-52
NZ_CP046903.1\|WP_158190239.1\|68465_69743_+\|DUF4113-domain-containing-protein	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	1.23787e-147
NZ_CP046903.1\|WP_040137971.1\|67338_68460_+\|hypothetical-protein	gnl\|CDD\|379049	pfam13173, AAA_14, AAA domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	0.0030453

>NZ_CP046903.1|WP_063542203.1|62630_63461_-|replication-initiation-protein
MGDIITTDSVATEPDSDTSNETMISPHVVSKHNDLVGASYRLSVAEQRLILLAIAKIDSRKPMPNGIVVTAHDFMSRYTVNKSDAYTQLQDAAKQLFNAKITSITGTGKGRAIHEVRWVERCTYVKGEGRVELLFSTTVKPYLSRLIGHYTSYDLWRVSGIESTYSFRLFEMLMQYKSKGWLYITVEELRRRLQLGETYERFSNLRSRVIDASVKELRNKCSMELDYELIKEHRTVKAIKFNFRLLDQMTLQFQKGNFPPEDLEQDMNDIIAEPES
>NZ_CP046903.1|WP_063542201.1|60839_62564_-|DUF4942-domain-containing-protein
MLSNIPATEPEVIPADIIDTFYAPVAFDRFSSLVSAYEATKKKILEVHAIYTQENVSGVMHYFFNGNSKDKYGHSASLRHTNSFSEIFQLQGALFELEATYWDKALRETDLMDYMPQERRNQWNEILNAWRDHNYVKGQNPERDMPDFNIDNLRSTIISLQARRAEFLAERVDGIFKGISRQHVTNVPEGFSKRMIMSGVFNEWGSTSHDREGYIHDLRMVIAKFMGRDDPCRSSTGRLLQTARAASGEWIEADAGAFRVKAFKVGTAHLDVHPEMAYRLNSILAYLHPAAIPESFRKRPKRAPTGTFKNRPLFDRPFSNAVGALLAQIEPFKKMVKSESFRREYEYIPVRNAVSLPFSCREHSKHLRAEVGAVMQALGGVLTPCAEQPRITYWQFDFDALDLIHETAALGVLPDQRSHQFFPTPEAVARQLVDWLDIGLLDTVCEPQAGQGGIADLLPKDRTRCVEISPLHCEILRKKGHQVIEGDFLAWSAGDAFSVIAMNPPYSEGRWQAHLQHAGTLVAQGGRIGAVLPLSARGKAADLLPGFDLEFSQPIENAFAGTSISVLLLKATKR
>NZ_CP046903.1|WP_063542199.1|60164_60566_-|hypothetical-protein
MSSFTINRVPGGDYMNPAQKEFFEGVLRARLGEVADSARAAKEALAGLGIAADALDQGLIEEERNTLYRTLERLNAQSAEITRAIQAIKDDEYGWCEDTGEEIGLERLIAQPTAKLSAVAQARMESAAAHYNR
>NZ_CP046903.1|WP_063542197.1|59725_60094_-|hypothetical-protein
MLVSEEINFDTLLRFDGNDQVKMHAALRGWMDLAQEQRALLWRFYNLSEVLTAQDVPRVESALMIIRQIRARIANLVEQFALTPCVNVLKSALETLDSCANDAEKYAKWILSFYYEHNNVML
>NZ_CP046903.1|WP_155736335.1|58870_59617_-|serine/threonine-protein-phosphatase
MGKTMVGRTPVVSGNGLYHQFGANHAGRDFVVGDLHGEAEKLNELLCMARFDWDSDRIFSAGDLVDRGPLSLRMALMTRQQGFIAVRGNHDQWCIDAGLEGDAPGHINNGGDWFYELNVLERSMVARLLNKLPVALSFIGPCGKKYGLVHAECPHHDWTHFEEILRGEWGNNVRAHFASKAIWSRKRYQQLDASLVRGVEAVFVGHTRVDQVKTIGNVCYLDTGACFEGGRLTMIELMPNGARHVYQV
>NZ_CP046903.1|WP_044314877.1|58332_58701_-|hypothetical-protein
MESVVATVSAVIEDGICAAAISMALDQDFTQVRAEMEVRAIYLSASQRPLFIKDAVAHLVIEAIGAFAESEGFTGNRRAGFVRAWLGCPVGAHGSSDTLAGWQAGFSHPAKPQLETFLGIEP
>NZ_CP046903.1|WP_044314876.1|57145_58336_-|site-specific-integrase
MSKLTPKFVKDTTTPGAYQDGRGLILRIAETGRKSWVFRYSFHGDRHDISLGTYPALSLRDARLAADAERVTISQGKNPLDQRYAIRQKSAASKKAGKTFKSEAKQYVRTHSASWSPAYAQDWESSLENHVFNVIGMLHPRDVHTDNVLAVLEPIWLQIPATAKLVRNRIELILDAAKAKGLREGENPARWRGHLDKLLARQSKSKRPFPAYPWQKIHGLYSDLITLDGSAARAMEMVILTACRSGEVRNAQWHEFDFAERIWTIPAERMKSGVTHRVPLTEAMIEVLDSVKGLDPVWVFKKGRGSGPLAGNALGRVLKKIKAGDCVPHGFRSTFRTWAADATDFPREVCEMALAHGLSDRVEAAYNRAELIDKRRLLMQQWNDFLMGTREQQEAA
>NZ_CP046903.1|WP_052816814.1|56196_56958_+|hypothetical-protein
MNSSVALNQNPTLAQINHQLMRFSLPVIPREKIQVVLDHADRGKLIASLNQLDDPNALEYVRSSLTAAQILSANEEDDQGGMDGQTNDDDQGRSQRDENNLMSDRAKFHVYGGKAALCFEADVTRGGVPTIALDAASATGPRSYNWGQKTRIQMTRAELPVVAAVLLGARQSCEFSSHGADKTKGFSMERQGTKVFTKVFEKGGGVKAVPIEAADAFFVTSLFLLQIRKISPWLDASSAIALVRSTMHMQQAT
>NZ_CP046903.1|WP_040138111.1|55772_56087_-|hypothetical-protein
MENILKHICSVKEICNECPFLKSNRDAEALSIRRHHLSEMKGDLFYRPNCRKHADVADGGDNPMCRGAAVYMHKTKQLNAALKVALDSGEIKEEELVAEHNKVI
>NZ_CP046903.1|WP_044314875.1|55336_55696_+|DNA-binding-protein
MSLITEYRQTEEAIKELQARLESMNNDDRLKKEMEFEEKLRALMADYNKSLRDIIAILDPDSRQRPAAAAPKKRGERKVKTYVNPHTNESISTKGGNHKTLKAWKAEHGSDVVESWVTE
>NZ_CP046903.1|WP_063542205.1|64853_65201_-|hypothetical-protein
MTIERVSGQRPYVASWQAYGGHMMYVGVFTSNLCGQVLLATAESSEAAGFVSGKACAAALMAFGFKVCGMQIKFHPNGNDLLGWLGSSLPDLYLKSHPNASQRPSNGRKTPEPCE
>NZ_CP046903.1|WP_044315039.1|65463_65955_-|hypothetical-protein
MQPLNFSLIFSGTVNPNGGDEEATGIAMQRGELYANLEQIVCDITGKGLVTGDTPATLEDHSHRVRITEGRFDMMAMPVISTAHLDQATAQELSDKPDACSWAIVANYGAGMFIRFLEQEGLEAELPQCAADIRQWLKRQGLDGWVRLDRDWDAVDVLKTYEW
>NZ_CP046903.1|WP_040137966.1|66103_66649_-|hypothetical-protein
MDEAGKARGRKFAAQIESAGWVLDAGQEDVTSSGGFWLYSYSIPQGSRLVAQLTPEGYRAMCSGEMLKHAAGLSPVDVLAGALSHYDALRPEKRDRASSRDLALALALYASHTQTLKALPRLQGGLSLHFMVFDWHTAQGTRILKPGAAPHPSPITPAELEVFSARVLFEHLVKNPNEQPA
>NZ_CP046903.1|WP_080902098.1|66821_67262_+|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MIPLTAKLSPSASSQPLPLAGPVSCGFPSPAADYAVPDLSLDELVGIRPTSSIFLFRASGDSMLGTGIRDGDILVVDKAKEAKVGDVVLAIIGCEFTVKELAKDEQGNFSLVATNPAYPPIVLGEAETLEVWGVCIWVLRQMGAAR
>NZ_CP046903.1|WP_040137971.1|67338_68460_+|hypothetical-protein
MTTKDRLHFPRHALAESILLGFENNIQTATTIFAPRRKGKTTFVRNDLIPMARDKGFLVATADLWLDKDHPERVIARALQEAIHGTGFVRRTLLRFTRPGQVISGVNAGAGTDGVSIGLDLADDAGLVLPELFERFSQLGKGKALLIIDEVQHLATRKEFETFTATLRTLLQGAQGEVYAVFTGSSQHGLARMFRRSKAPFYQYGSEVSFPELGMEFAQHLAALYFEATGRTWEAAEAFSLYVRRGMMPKHLREIYNLSLTQNLPVVEADKIVWASMLDEGQFATLIESLAPLDQALLVGILTGESLFSAEYRKRLGDELPSGIAPTTTQVQSALKRLQRAELIGNLDHGSWSIEDGALQSYLRRVLLDDDQD
>NZ_CP046903.1|WP_158190239.1|68465_69743_+|DUF4113-domain-containing-protein
MAGCHDYRLDRRQLFYCSAQILFEPWLRDSAVVVASNGDGCVVSRNDPAKALGIKMGQPVFELRDLEARNQVKIFSSNYSLYQSLSNRMMAILEEHSPRISPYSIDECFSWLDGIADPEAWGRQAQAQVMRRIGLPVGVGIGPTKTLAKLANWAAKRWKAKTGCVVLLTDPSRQEKLLRYAPVGEVWGIGRRLSARLESELSIKTAWQLANADPKLLRRYFSVYVERTARELCGIPCFPFGDTGPERKQQIISSRTFGEKIYRLESLRSAVAHYTSVAAAKLRGQGSLANCIQVFAQSSAFAPGERFSGTRIMALPYPTDDTRDLVAAAQQGLGAMFREGVAYAKAGVILSQFVERGAITGDLFAPAPRSGSKAVMQVMDAINARQGRGAIRLGSDHEGGGWVMRQRLLSPSYTTSWQELPQARC
>NZ_CP046903.1|WP_019406702.1|69749_70652_-|DNA-binding-protein
MANITPDRVFAAADALEASGNRVSVRSVRDHLGGGSPNQITPLLASWRARKPSVAAPEIQLDPRIVQLIAEQVRAAAGEAAVRADERANEAEDTLTLCQQENSELAEQLATTLRALDEARAKVEQQAGTISEIREEIERVRSEAEEEVEAADTRANREREVAETAQHALARAELRLESMPRLEGEVERLRTALDEALSGKQSAEQQAAVAAAKLDAAIQRVSAAEEREREARQQQAAAQEAAARANGDAHQAQITLQAVQARLESTSRELETARGSLSELKEELKELRAEKKPAKNGEQG
>NZ_CP046903.1|WP_019406703.1|71013_72498_+|DEAD/DEAH-box-helicase
MQLRAYQNDQVSDLREGIRQQFLVQMLMSPTGSGKTEVAKYVIANAAAKQNKVWFIVDSVKLLDQTLARFHADGIYAGAIQSNHPCTDYSKVVQVATVQSLGPRLDWLLRTQPPKLVVIDEAHVLFKAHQDLIQWCRKNKVPVIGLSATPFKRGLGKIYDRLVNRISTKQLTDQGFLVPAECYAPHVPDLKGVGTSTGGDWAEDELARVMGGADILGDVVSHWKQLGENRQTLVFACNVHHAKQLAESFFNAGVMAAHIDGYMHSDESDEIIRLYKSGKIKVLVSVGMLAKGFDDPRTSCIVIARPTKSLMLHYQILGRVLRIFEGKTNGIIIDHAGNLLRNGLPTDPLPDRLDMGDGDPVDRAKPDNNPDKEAKTKPCPTCSYVMTGLICPRCGFEIKIDAGVEVAAGVLVKLADRKTKLAPNTKQHAYAELLGYAQMKGKSPMWAQGAYQAFMAEPIQREWVNTVASVPPGEPMQQWVKGYNVRRAKSKRRA
>NZ_CP046903.1|WP_047882739.1|73504_74485_-|IS5-family-transposase
MKQMTFADAEYAGKRKQTRKELFLIEMDQVVPWKGLVALIDPRYPKGEGGRPAYPLMAMLRIHLMQNWFGYSDPAMEEALYETTILRQFAGLSLERIPDETTILNFRRLLEKHELAAGILAVINGYLGDRGLSLRQGTIVDATLINAPSSTKNKDGKRDPEMHQTKKGNQYYFGMKAHIGVDDESGLVHSVVGTAANVADVTQVDKLLHGEENMVGADAGYTGVEKRPEHEGREVIWQIAARRSTYKKLSKRSALYKAKRKIEKAKAQVRAKVEHPFRVIKRQFGYVKTRFRGLAKNTAQLVTLFALSNLWMVRRHLLTNAGEVRL
>NZ_CP046903.1|WP_047883032.1|74591_75485_-|integrase
MNAETQSAYISLASNFYATRMQGVELDELNIIGALLRAAPDYRPDYYRRLRNALAFDQKRRGNFWAAQEINRTLNPVTVLNLPRKKKQRRPQKLSSADFETWLRCLAERDMPVEAGALMVISLTGARPCELNGISIDGRRIHISGAKLSHKGLRGASRTLEADGDVCNILRNALAAFKCQPRSMDSIRIALHQVATELFGRRKVPSMYTLRHQFGSNLKASGMSAIEMAYVMGHQATDSISRYGDKRFGHAEAVKVKPASDADFSKVRDTVPARMRADVVALNDQRDLDRRSEVADR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63586-63610	0	1.0
NZ_CP046903_1	1.2\|63632\|21\|NZ_CP046903\|CRT	63632-63652	21	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63632-63652	0	1.0
NZ_CP046903_1	1.3\|63674\|22\|NZ_CP046903\|CRT	63674-63695	22	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2286-2307	0	1.0
NZ_CP046903_1	1.3\|63674\|22\|NZ_CP046903\|CRT	63674-63695	22	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63674-63695	0	1.0
NZ_CP046903_1	1.4\|63717\|22\|NZ_CP046903\|CRT	63717-63738	22	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63717-63738	0	1.0
NZ_CP046903_1	1.5\|63760\|22\|NZ_CP046903\|CRT	63760-63781	22	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63760-63781	0	1.0
NZ_CP046903_1	1.6\|63803\|22\|NZ_CP046903\|CRT	63803-63824	22	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63803-63824	0	1.0
NZ_CP046903_1	1.7\|63846\|21\|NZ_CP046903\|CRT	63846-63866	21	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63846-63866	0	1.0
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63585-63612	0	1.0
NZ_CP046903_1	1.9\|63631\|24\|NZ_CP046903\|PILER-CR	63631-63654	24	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63631-63654	0	1.0
NZ_CP046903_1	1.10\|63673\|25\|NZ_CP046903\|PILER-CR	63673-63697	25	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2285-2309	0	1.0
NZ_CP046903_1	1.10\|63673\|25\|NZ_CP046903\|PILER-CR	63673-63697	25	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63673-63697	0	1.0
NZ_CP046903_1	1.11\|63716\|25\|NZ_CP046903\|PILER-CR	63716-63740	25	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63716-63740	0	1.0
NZ_CP046903_1	1.12\|63759\|25\|NZ_CP046903\|PILER-CR	63759-63783	25	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63759-63783	0	1.0
NZ_CP046903_1	1.13\|63802\|25\|NZ_CP046903\|PILER-CR	63802-63826	25	NZ_CP046903	Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence	63802-63826	0	1.0
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2198-2222	1	0.96
NZ_CP046903_1	1.2\|63632\|21\|NZ_CP046903\|CRT	63632-63652	21	NZ_MH547560	Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence	74099-74119	1	0.952
NZ_CP046903_1	1.5\|63760\|22\|NZ_CP046903\|CRT	63760-63781	22	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2372-2393	1	0.955
NZ_CP046903_1	1.7\|63846\|21\|NZ_CP046903\|CRT	63846-63866	21	NZ_MH547560	Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence	74336-74356	1	0.952
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2197-2224	1	0.964
NZ_CP046903_1	1.9\|63631\|24\|NZ_CP046903\|PILER-CR	63631-63654	24	NZ_MH547560	Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence	74098-74121	1	0.958
NZ_CP046903_1	1.12\|63759\|25\|NZ_CP046903\|PILER-CR	63759-63783	25	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2371-2395	1	0.96
NZ_CP046903_1	1.3\|63674\|22\|NZ_CP046903\|CRT	63674-63695	22	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	32347-32368	2	0.909
NZ_CP046903_1	1.3\|63674\|22\|NZ_CP046903\|CRT	63674-63695	22	NZ_MH547560	Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence	74141-74162	2	0.909
NZ_CP046903_1	1.9\|63631\|24\|NZ_CP046903\|PILER-CR	63631-63654	24	NZ_CP007510	Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid	2243-2266	2	0.917
NZ_CP046903_1	1.10\|63673\|25\|NZ_CP046903\|PILER-CR	63673-63697	25	NZ_MH547560	Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence	74140-74164	2	0.92
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	139553-139577	3	0.88
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	95758-95782	4	0.84
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	573378-573402	4	0.84
NZ_CP046903_1	1.10\|63673\|25\|NZ_CP046903\|PILER-CR	63673-63697	25	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	32346-32370	4	0.84
NZ_CP046903_1	1.11\|63716\|25\|NZ_CP046903\|PILER-CR	63716-63740	25	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	95384-95408	4	0.84
NZ_CP046903_1	1.12\|63759\|25\|NZ_CP046903\|PILER-CR	63759-63783	25	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	465391-465415	4	0.84
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1249829-1249853	5	0.8
NZ_CP046903_1	1.1\|63586\|25\|NZ_CP046903\|CRT	63586-63610	25	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1288130-1288154	5	0.8
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	573377-573404	5	0.821
NZ_CP046903_1	1.11\|63716\|25\|NZ_CP046903\|PILER-CR	63716-63740	25	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	108843-108867	5	0.8
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NC_008383	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence	89732-89759	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP049734	Rhizobium leguminosarum strain A1 plasmid unnamed1, complete sequence	126768-126795	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP020949	Rhizobium sp. CIAT894 plasmid pRheCIAT894b, complete sequence	190232-190259	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	528377-528404	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	CP049734	Rhizobium leguminosarum strain A1 plasmid pRLa11, complete sequence	244007-244034	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP048285	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248a, complete sequence	73907-73934	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP054024	Rhizobium sp. JKLM12A2 plasmid pPR12A203, complete sequence	82238-82265	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP054030	Rhizobium sp. JKLM19E plasmid pPR19E03	19580-19607	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	143455-143482	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP054035	Rhizobium sp. JKLM13E plasmid pPR13E04, complete sequence	94785-94812	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	95757-95784	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	MH746817	Achromobacter phage vB_Ade_ART, complete genome	4933-4960	6	0.786
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1249828-1249855	7	0.75
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1288129-1288156	7	0.75
NZ_CP046903_1	1.8\|63585\|28\|NZ_CP046903\|PILER-CR	63585-63612	28	KP202969	Achromobacter phage JWX, complete genome	29133-29160	7	0.75

1. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

agcttgatgcgggtgatcttctcga	CRISPR spacer
agcttgatgcgggtgatcttctcga	Protospacer
*************************

2. spacer 1.2|63632|21|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

gttttcctgaggtcatgtcag	CRISPR spacer
gttttcctgaggtcatgtcag	Protospacer
*********************

3. spacer 1.3|63674|22|NZ_CP046903|CRT matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 0, identity: 1.0

gccacgccgccctggttgggaa	CRISPR spacer
gccacgccgccctggttgggaa	Protospacer
**********************

4. spacer 1.3|63674|22|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

gccacgccgccctggttgggaa	CRISPR spacer
gccacgccgccctggttgggaa	Protospacer
**********************

5. spacer 1.4|63717|22|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

gcgttccgatccgctcgtttcg	CRISPR spacer
gcgttccgatccgctcgtttcg	Protospacer
**********************

6. spacer 1.5|63760|22|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

gccgagagagggaggttttcca	CRISPR spacer
gccgagagagggaggttttcca	Protospacer
**********************

7. spacer 1.6|63803|22|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

ggctccaaagcctggcttacga	CRISPR spacer
ggctccaaagcctggcttacga	Protospacer
**********************

8. spacer 1.7|63846|21|NZ_CP046903|CRT matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

cccgttcggagcgctgcttaa	CRISPR spacer
cccgttcggagcgctgcttaa	Protospacer
*********************

9. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
cagcttgatgcgggtgatcttctcgacc	Protospacer
****************************

10. spacer 1.9|63631|24|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

ggttttcctgaggtcatgtcagca	CRISPR spacer
ggttttcctgaggtcatgtcagca	Protospacer
************************

11. spacer 1.10|63673|25|NZ_CP046903|PILER-CR matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 0, identity: 1.0

ggccacgccgccctggttgggaaca	CRISPR spacer
ggccacgccgccctggttgggaaca	Protospacer
*************************

12. spacer 1.10|63673|25|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

ggccacgccgccctggttgggaaca	CRISPR spacer
ggccacgccgccctggttgggaaca	Protospacer
*************************

13. spacer 1.11|63716|25|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

ggcgttccgatccgctcgtttcgca	CRISPR spacer
ggcgttccgatccgctcgtttcgca	Protospacer
*************************

14. spacer 1.12|63759|25|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

cgccgagagagggaggttttccacc	CRISPR spacer
cgccgagagagggaggttttccacc	Protospacer
*************************

15. spacer 1.13|63802|25|NZ_CP046903|PILER-CR matches to NZ_CP046903 (Pseudomonas stutzeri strain PM101005 plasmid p1_PM101005, complete sequence) position: , mismatch: 0, identity: 1.0

gggctccaaagcctggcttacgaca	CRISPR spacer
gggctccaaagcctggcttacgaca	Protospacer
*************************

16. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 1, identity: 0.96

agcttgatgcgggtgatcttctcga	CRISPR spacer
agcttgatacgggtgatcttctcga	Protospacer
********.****************

17. spacer 1.2|63632|21|NZ_CP046903|CRT matches to NZ_MH547560 (Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence) position: , mismatch: 1, identity: 0.952

gttttcctgaggtcatgtcag	CRISPR spacer
gttttcctgaggtcatttcag	Protospacer
**************** ****

18. spacer 1.5|63760|22|NZ_CP046903|CRT matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 1, identity: 0.955

gccgagagagggaggttttcca	CRISPR spacer
gccgagagagggagtttttcca	Protospacer
************** *******

19. spacer 1.7|63846|21|NZ_CP046903|CRT matches to NZ_MH547560 (Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence) position: , mismatch: 1, identity: 0.952

cccgttcggagcgctgcttaa	CRISPR spacer
cccgttcggagcgctgtttaa	Protospacer
****************.****

20. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 1, identity: 0.964

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
cagcttgatacgggtgatcttctcgacc	Protospacer
*********.******************

21. spacer 1.9|63631|24|NZ_CP046903|PILER-CR matches to NZ_MH547560 (Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence) position: , mismatch: 1, identity: 0.958

ggttttcctgaggtcatgtcagca	CRISPR spacer
ggttttcctgaggtcatttcagca	Protospacer
***************** ******

22. spacer 1.12|63759|25|NZ_CP046903|PILER-CR matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 1, identity: 0.96

cgccgagagagggaggttttccacc	CRISPR spacer
cgccgagagagggagtttttccacc	Protospacer
*************** *********

23. spacer 1.3|63674|22|NZ_CP046903|CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.909

gccacgccgccctggttgggaa	CRISPR spacer
gccacgccgcccaggttgggac	Protospacer
************ ********

24. spacer 1.3|63674|22|NZ_CP046903|CRT matches to NZ_MH547560 (Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence) position: , mismatch: 2, identity: 0.909

gccacgccgccctggttgggaa	CRISPR spacer
gccacgccgccttggttgggag	Protospacer
***********.*********.

25. spacer 1.9|63631|24|NZ_CP046903|PILER-CR matches to NZ_CP007510 (Pseudomonas stutzeri strain 19SMN4 plasmid pLIB119, complete plasmid) position: , mismatch: 2, identity: 0.917

ggttttcctgaggtcatgtcagca	CRISPR spacer
ggatttcctgaggtcatttcagca	Protospacer
** ************** ******

26. spacer 1.10|63673|25|NZ_CP046903|PILER-CR matches to NZ_MH547560 (Pseudomonas aeruginosa strain PA34 plasmid pMKPA34-1, complete sequence) position: , mismatch: 2, identity: 0.92

ggccacgccgccctggttgggaaca	CRISPR spacer
ggccacgccgccttggttgggagca	Protospacer
************.*********.**

27. spacer 1.1|63586|25|NZ_CP046903|CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 3, identity: 0.88

agcttgatgcgggtgatcttctcga	CRISPR spacer
accttgatgccggtgatctcctcga	Protospacer
* ******** ********.*****

28. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.84

agcttgatgcgggtgatcttctcga	CRISPR spacer
gccttgatgcgggcgatcttctcgt	Protospacer
. ***********.**********

29. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 4, identity: 0.84

agcttgatgcgggtgatcttctcga	CRISPR spacer
tacttgatccgggtcatcttctcga	Protospacer
 .****** ***** **********

30. spacer 1.10|63673|25|NZ_CP046903|PILER-CR matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ggccacgccgccctggttgggaaca	CRISPR spacer
ggccacgccgcccaggttgggacgt	Protospacer
************* ********

31. spacer 1.11|63716|25|NZ_CP046903|PILER-CR matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 4, identity: 0.84

ggcgttccgatccgctcgtttcgca	CRISPR spacer
cgcgttccgatccgctcggtccgct	Protospacer
 ***************** *.***

32. spacer 1.12|63759|25|NZ_CP046903|PILER-CR matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 4, identity: 0.84

cgccgagagagggaggttttccacc	CRISPR spacer
ggttgagagaggaaggttttccacc	Protospacer
 *..********.************

33. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 5, identity: 0.8

agcttgatgcgggtgatcttctcga	CRISPR spacer
tcctcgatgcgggtgatcttctccc	Protospacer
  **.******************

34. spacer 1.1|63586|25|NZ_CP046903|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 5, identity: 0.8

agcttgatgcgggtgatcttctcga	CRISPR spacer
tcctcgatgcgggtgatcttctccc	Protospacer
  **.******************

35. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 5, identity: 0.821

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
gtacttgatccgggtcatcttctcgacc	Protospacer
  .****** ***** ************

36. spacer 1.11|63716|25|NZ_CP046903|PILER-CR matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 5, identity: 0.8

ggcgttccgatccgctcgtttcgca	CRISPR spacer
actctgccgatccgctcgtttcgca	Protospacer
. . * *******************

37. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NC_008383 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

38. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP049734 (Rhizobium leguminosarum strain A1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

39. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP020949 (Rhizobium sp. CIAT894 plasmid pRheCIAT894b, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

40. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

41. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to CP049734 (Rhizobium leguminosarum strain A1 plasmid pRLa11, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

42. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP048285 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248a, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

43. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP054024 (Rhizobium sp. JKLM12A2 plasmid pPR12A203, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

44. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP054030 (Rhizobium sp. JKLM19E plasmid pPR19E03) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

45. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP022670 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

46. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP054035 (Rhizobium sp. JKLM13E plasmid pPR13E04, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
tttgttgatgtgggtgatcttgtcgacc	Protospacer
.   ******.********** ******

47. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
ggccttgatgcgggcgatcttctcgtcg	Protospacer
 . ***********.********** *

48. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to MH746817 (Achromobacter phage vB_Ade_ART, complete genome) position: , mismatch: 6, identity: 0.786

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
ctcgatgatgcggccgatcttctcgacc	Protospacer
*    ******** .*************

49. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 7, identity: 0.75

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
ctcctcgatgcgggtgatcttctcccag	Protospacer
*  **.******************

50. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 7, identity: 0.75

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
ctcctcgatgcgggtgatcttctcccag	Protospacer
*  **.******************

51. spacer 1.8|63585|28|NZ_CP046903|PILER-CR matches to KP202969 (Achromobacter phage JWX, complete genome) position: , mismatch: 7, identity: 0.75

cagcttgatgcgggtgatcttctcgacc	CRISPR spacer
ttcgatgatgcggccgatcttctcgacc	Protospacer
.    ******** .*************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046902

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046903

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection