CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP047030	Algibacter sp. L3A6 chromosome, complete genome	2 crisprs	cas3,DEDDh,WYL,cas3HD	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047030_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047030_1

3278447-3278695

Orphan

Consensus_repeat	Method
GTTACCTTACTAACATCCCAGTT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP047030_1

>merge|NZ_CP047030|1|3278447-3278695|CRISPRCasFinder
GTTACTTTACTAACGTTCCATATATCAATAGGTTGATTAAAGTCGTCAGTTTCTTGAAACATAGAACTCATATCTGTAACATTACTAACATCCCAACCGGTAATATCTTGATTGAATACTTTGGTGTTTTCAAACATCCCTTTCATATTAGCAACATTACTAACATCCCAATTATCTAAAGGCTGATTAAAAAAAGCATTATCCCTAAACATGTATGTCATTTCTGTTACGCTACTAACGTCCCAGTTA

>NZ_CP047030|1|1|3278447-3278695|CRISPRCasFinder
GTTACTTTACTAACGTTCCATAT	ATCAATAGGTTGATTAAAGTCGTCAGTTTCTTGAAACATAGAACTCATATCT
GTAACATTACTAACATCCCAACC	GGTAATATCTTGATTGAATACTTTGGTGTTTTCAAACATCCCTTTCATATTA
GCAACATTACTAACATCCCAATT	ATCTAAAGGCTGATTAAAAAAAGCATTATCCCTAAACATGTATGTCATTTCT
GTTACGCTACTAACGTCCCAGTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047030.1\|WP_159021169.1\|3271418_3272336_-\|type-IX-secretion-system-membrane-protein-PorP/SprF	unknown	unknown	gnl\|CDD\|371704
NZ_CP047030.1\|WP_074939351.1\|3263640_3264480_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|181386
NZ_CP047030.1\|WP_159019966.1\|3269578_3271342_+\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|273226
NZ_CP047030.1\|WP_159019970.1\|3285272_3285629_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|379266
NZ_CP047030.1\|WP_159019969.1\|3283495_3285124_-\|acyl-CoA-carboxylase-subunit-beta	unknown	unknown	gnl\|CDD\|178415
NZ_CP047030.1\|WP_159019974.1\|3287482_3288667_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|182234
NZ_CP047030.1\|WP_159019961.1\|3262470_3263586_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|367314
NZ_CP047030.1\|WP_159019964.1\|3267370_3268327_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP047030.1\|WP_159019962.1\|3264480_3265383_+\|1,4-dihydroxy-2-naphthoate-octaprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP047030.1\|WP_159021168.1\|3266333_3267380_+\|o-succinylbenzoate-synthase	unknown	unknown	gnl\|CDD\|239436
NZ_CP047030.1\|WP_159019960.1\|3262117_3262294_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047030.1\|WP_159019968.1\|3279957_3283410_+\|TonB-dependent-receptor-plug-domain-containing-protein	unknown	unknown	gnl\|CDD\|274948
NZ_CP047030.1\|WP_159019975.1\|3289185_3290877_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP047030.1\|WP_159019973.1\|3286674_3287397_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|380375
NZ_CP047030.1\|WP_159019972.1\|3286164_3286602_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP047030.1\|WP_159019963.1\|3265425_3266103_+\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|234811
NZ_CP047030.1\|WP_159019965.1\|3268329_3269400_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341285
NZ_CP047030.1\|WP_159019971.1\|3285631_3286162_+\|NADPH-dependent-FMN-reductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP047030.1\|WP_042494706.1\|3288941_3289124_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047030.1\|WP_159019976.1\|3291253_3291496_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP047030.1\|WP_159021169.1\|3271418_3272336_-\|type-IX-secretion-system-membrane-protein-PorP/SprF	gnl\|CDD\|371704	pfam11751, PorP_SprF, Type IX secretion system membrane protein PorP/SprF. This entry describes a protein family unique to, and greatly expanded in, the Bacteriodetes. Species in this lineage include several, such as Cytophaga hutchinsonii and Cytophaga johnsonae (Flavobacterium johnsoniae), that exhibit a poorly understood rapid gliding phenotype. Several members of this protein family are found in operons with other genes whose loss leads to a loss of the rapid gliding phenotype.	5.43004e-49
NZ_CP047030.1\|WP_074939351.1\|3263640_3264480_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|181386	PRK08321, PRK08321, 1,4-dihydroxy-2-naphthoyl-CoA synthase.	5.37863e-180
NZ_CP047030.1\|WP_159019966.1\|3269578_3271342_+\|signal-peptide-peptidase-SppA	gnl\|CDD\|273226	TIGR00705, Protease_4, signal peptide peptidase SppA, 67K type. This model represents the signal peptide peptidase A (SppA, protease IV) as found in E. coli, Treponema pallidum, Mycobacterium leprae, and several other species, in which it has a molecular mass around 67 kDa and a duplication such that the N-terminal half shares extensive homology with the C-terminal half. This enzyme was shown in E. coli to form homotetramers. E. coli SohB, which is most closely homologous to the C-terminal duplication of SppA, is predicted to perform a similar function of small peptide degradation, but in the periplasm. Many prokaryotes have a single SppA/SohB homolog that may perform the function of either or both. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	8.51797e-138
NZ_CP047030.1\|WP_159019970.1\|3285272_3285629_+\|DoxX-family-protein	gnl\|CDD\|379266	pfam13564, DoxX_2, DoxX-like family. This family of uncharacterized proteins are related to DoxX pfam07681.	2.35476e-12
NZ_CP047030.1\|WP_159019969.1\|3283495_3285124_-\|acyl-CoA-carboxylase-subunit-beta	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP047030.1\|WP_159019974.1\|3287482_3288667_-\|MFS-transporter	gnl\|CDD\|182234	PRK10091, PRK10091, MFS transport protein AraJ; Provisional.	6.14815e-111
NZ_CP047030.1\|WP_159019961.1\|3262470_3263586_-\|aminopeptidase	gnl\|CDD\|367314	pfam03051, Peptidase_C1_2, Peptidase C1-like family. This family is closely related to the Peptidase_C1 family pfam00112, containing several prokaryotic and eukaryotic aminopeptidases and bleomycin hydrolases.	2.63676e-20
NZ_CP047030.1\|WP_159019964.1\|3267370_3268327_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.02405e-08
NZ_CP047030.1\|WP_159019962.1\|3264480_3265383_+\|1,4-dihydroxy-2-naphthoate-octaprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	4.48465e-89
NZ_CP047030.1\|WP_159021168.1\|3266333_3267380_+\|o-succinylbenzoate-synthase	gnl\|CDD\|239436	cd03320, OSBS, o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway. Menaquinone is an essential cofactor for anaerobic growth in eubacteria and some archaea. OSBS belongs to the enolase superfamily of enzymes, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.	3.77911e-72
NZ_CP047030.1\|WP_159019968.1\|3279957_3283410_+\|TonB-dependent-receptor-plug-domain-containing-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	3.59805e-54
NZ_CP047030.1\|WP_159019973.1\|3286674_3287397_+\|pirin-family-protein	gnl\|CDD\|380375	cd02910, cupin_Yhhw_N, Escherichia coli YhhW and YhaK and related proteins, pirin-like bicupin, N-terminal cupin domain. This family includes the N-terminal cupin domains of YhhW and YhaK, Escherichia coli pirin-like proteins with unknown function. YhhW is structurally similar not only to human pirin but also to quercitin 2,3-dioxygenase (quercitinase). Although the function of YhhW is not completely understood, YhhW and its human ortholog have quercitinase activity and are likely to play an important role in transcription and apoptosis. This N-terminal cupin domain of YhhW has a metal coordination site and is thought to have catalytic activity while the C-terminal cupin-like domain has diverged considerably and has closer alignment with C-terminal pirin. YhaK is found in low abundance in the cytosol of E. coli and is strongly up-regulated by nitroso-glutathione (GSNO). There are major structural differences at the N-terminus of YhaK compared with YhhW; YhaK lacks the canonical cupin metal-binding residues of pirins and may be involved in chloride binding and/or sensing of oxidative stress in enterobacteria. YhaK showed no quercetinase and peroxidase activity; however, reduced YhaK was very sensitive to reactive oxygen species (ROS). Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	7.36395e-59
NZ_CP047030.1\|WP_159019972.1\|3286164_3286602_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.98023e-20
NZ_CP047030.1\|WP_159019963.1\|3265425_3266103_+\|metal-dependent-hydrolase	gnl\|CDD\|234811	PRK00685, PRK00685, metal-dependent hydrolase; Provisional.	7.36391e-81
NZ_CP047030.1\|WP_159019965.1\|3268329_3269400_+\|AMP-binding-protein	gnl\|CDD\|341285	cd17630, OSB_MenE-like, O-succinylbenzoic acid-CoA ligase. This family contains O-succinylbenzoyl-CoA (OSB-CoA) synthetase (also known as O-succinylbenzoic acid CoA ligase) that belongs to the ANL superfamily and catalyzes the ligation of CoA to o-succinylbenzoate (OSB). It includes MenE in the bacterial menaquinone biosynthesis pathway which is a promising target for the development of novel antibacterial agents. MenE catalyzes CoA ligation via an acyl-adenylate intermediate; tight-binding inhibitors of MenE based on stable acyl-sulfonyladenosine analogs of this intermediate provide a pathway toward the development of optimized MenE inhibitors.	3.8195e-50
NZ_CP047030.1\|WP_159019971.1\|3285631_3286162_+\|NADPH-dependent-FMN-reductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	4.69969e-35
NZ_CP047030.1\|WP_159019975.1\|3289185_3290877_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0

>NZ_CP047030.1|WP_159021169.1|3271418_3272336_-|type-IX-secretion-system-membrane-protein-PorP/SprF
MFTKKIIAIAIITIFACNLNAQQTPTFSEYNYNPFIINTAYAGLTENPEFSLSNTGFFNQFEGSPRNFSFSGHGSIDRNKMGIGAGIMRDEIGVTTSTSFFAAYSYKIFFDFKSNRPYWQLYDTGVLSFGITAGLQQYQSNLTQLGIIGDPKFAQDINSTIPTIGLSFLFNHASFYVGFSTPNVMGDSLASDSDLVLNSPYYGYFGYRIYNNRFEDFMIKPNMLIKYEDGAPFQADFNVALSFRNKLEIGTGYRTSNSINFLAGIYLFNNLRAIYNYNLANKNSALGNTHGLILSVQLGDGYSVN
>NZ_CP047030.1|WP_159019966.1|3269578_3271342_+|signal-peptide-peptidase-SppA
MEFIKRVFSTLTGIILFCVLFFLGIIFLGAIMGSGGDDVVTVKDNSVLELTLDFPIKDYAGKTEFAEYPFLNEDEKNGLFNIIDGIKLAATDDKIKGISIDNNFIQAGLSQTKALRGALLKFKESGKFIVAYADIYTQKDYYLSSVADTIFMNPVGAMEFKGLYSEQLYFKDLQEKSGVKMEVVRFGKYKSAVEPFLENEMSDNNREQISVYLNSLWTEMKRDISKSRMIDEAELNTIADSLLARNATLAKSSKMIDKIAYHDEYIDGLKYAVGIENDKKLKTISIADYAIHAADKLKLKSNKNRIAVIYAEGEIIYGEGDEDKVGQGTMGASLKKAREDDKVKAIVLRINSPGGSAVASELIWREIELTKKVKPVIVSMGNVAASGGYYIACNADKIIAEATTITGSIGVFGMIPNGKALADRIGINAEQVITNANAVSFSFYEPMSDVQRAFIKEGIIDVYELFTKRVADGRGMAQDDVKAIAQGRVWTGTDAVKNGLVDELGGLDLALKYAAEAAEIEEYKINEFPIFKKDLDKMLQDFGLVKAKETILKEELGDVQYNIYKEVKTRTQRKGIQLLFPYNLDVK
>NZ_CP047030.1|WP_159019965.1|3268329_3269400_+|AMP-binding-protein
MIPDYTKVHVRFKLNNHHYSHEDLMEVAYSFVKEGVAYERELGEFLLDWLDKHDFIKVRTSGSTGKPKEIIIKKEAMVKSAIATGNFFDLTPGKKVLHCLPSNFIAGKMMMVRAIVLGLELDMVEPAAFPRIDYEKDYEFCAFTPMQLKNFAKYFDKIKTVIVGGGRVSESIKALIQDKKPNVYETYGMTETVSHIAIKKINNFTDAESDKYFKTLPNITISTDDRSCLVINAPELLDETIVTNDIVKIHSDSSFEWLGRFDNVINSGGIKLYPEVIEEKLQCKIPQQFFITSVPDETLGEKAILIIEGKDNKVDEAIFEGLDKYEKPKAIYAVSKFIDTVSGKIHRKNTLDQVVF
>NZ_CP047030.1|WP_159019964.1|3267370_3268327_+|CPBP-family-intramembrane-metalloprotease
MYIAQAFKGLHDWWRYLLGVLIVFTAWQMVGMIPLGVVLGIKVFETGNIPVTIPDMIEALGSNLFLFLMLVSFAAGLAGVIFSAKVLHKQSFVQLTTTRKKIDWSRFWFIFILWGVISSGFVLIDYFFFAPEDYVLNFKLKPFLILAAIAITLIPLQTSFEEYFFRGYLMQGIGVVCKNKWLPLLITSVGFGLMHIANPEVEQLGPVIMVYYIGTGLFLGVLTLMDEGLELALGFHAANNLFTALLVTADWTAFQTDSILKDMSDPDTMALGEIFIPVFVVFPILLFILSKKYNWSNWKDKLIGNVIEPTKEDYKIIE
>NZ_CP047030.1|WP_159021168.1|3266333_3267380_+|o-succinylbenzoate-synthase
MTATYQPYTLNFKQASGTSRGILKTKDTWFIILNEGENKGVGECGMFRGLSIDDRPDFEDKLKWVCKNIQLGLDALLLQLEEFPSIQFGLEMAFKSIDSINGFDLFPSKFTETEDSIAINGLIWMGTESFMKQQIQDKIEAGFSCIKMKIGAIDFQTEINLLKSIRKEFNSNDIELRVDANGAFKPSEALEKLKVLSDFDLHSIEQPIKQGQIAEMAKLCETTPLPIALDEELIGVFSEEKKQALLETICPQYIILKPTLIGGFKGSESWINLAHKQNIGWWITSALESNVGLNAIAQYTYGLNSNLPQGLGTGGLFSNNFDSPLLVKNGTLQYNKVEPWKFNLEVCI
>NZ_CP047030.1|WP_159019963.1|3265425_3266103_+|metal-dependent-hydrolase
MKITFYGHACLGIQIEDINILVDPFITGNEKAANIDINSLKADYIMVTHAHQDHILDVEAIAKRTNAVIISNFEIVTHFGNLGFEGHPMNHGGQWDFEFGNVKYVNAIHTSSFPDGTYGGQPGGFIIEGEHKNIYIAGDTALTFDMKLIPLQTKLDLAILPIGDNFTMGINDAILASDFVECDKILGYHFDTFGYIEIDHEVAKRKFFEKDKDLMLLEIGESIEL
>NZ_CP047030.1|WP_159019962.1|3264480_3265383_+|1,4-dihydroxy-2-naphthoate-octaprenyltransferase
MNKTKVWISSMRLRTLPLSVSGIILASFLAAYQGVFNSVICVLAILSTLSFQILSNLANDYGDGVKGTDNDDRIGPERAIQSGVITPKEMKRAITINVAISVILALLTVYFAFGKAHFFLAVLFFALGVAAIIAAIKYTVGGNAYGYNAMGDVFVFLFFGLVSVVGGYVLYAKTIDFVVILPAMVIGLLSAAVLNLNNMRDIESDTKSNKITLALKLGSQKAKTYHSALVVSAILLSVLFGIIFYSSPFNFIFIIAFIPLFLHLKKVNNTKNPKHFDPELKKLALTTVLLSILMGLGQVL
>NZ_CP047030.1|WP_074939351.1|3263640_3264480_+|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MSQENWVTVKEYTDITYKKCNGVARIAFNRPDVRNAFRPKTTSELYDALYNANEDVNIGVVLLSAEGPSTKDGVYSFCSGGDQKARGHQGYVGEDGYHRLNILEVQRLIRFMPKAVIAVVPGWAVGGGHSLHVVCDLTLASKEHAIFKQTDADVTSFDGGYGSAYLAKMVGQKRAREIFFLGRNYSAQEAFDMGMVNAVVPHDELESTAYEWAQEILAKSPTSIKMLKFAMNLTDDGMVGQQVFAGEATRLAYMTEEATEGRNAFLEKRKPNFEKKWIP
>NZ_CP047030.1|WP_159019961.1|3262470_3263586_-|aminopeptidase
MKNNISLLVLLFICLSLNAQSYKFETVIDLETTDVISQGNTGTCWSFSTSSFLESEIMRITGKKIDLSEMYTVRNTYPKKAWNYIMRQGKTQFSDGGLAHDVLNSVKDHGLVPAFAFTGLEENATRHNHTEMLTVLKGLLNTYTKDVKKPLSPKWKQVIESVLDIYLGKNIETFNYEGVQYTPQSFLEFTKINLDDYVSLTSFSHQPFYTSFILNIPDNFSNGSFYNIPIEEMVKTANNALKKGYTIALDCDVSESTFTANPGMAIIPEDGNVDLKDLTEIVAEKEITQAYRQQEFENFNTTDDHLMHITGLVKDQNGNIYYKVKNSWGKNSERVANNGFIYMSEAYFKLKMISITLNKNVLDKKYHKILN
>NZ_CP047030.1|WP_159019960.1|3262117_3262294_-|hypothetical-protein
MILTITLTFTLLVFVNLLLLKFSCNKTAKTTKVNKQPVILAPYLELDAMQERLAPTGS
>NZ_CP047030.1|WP_159019968.1|3279957_3283410_+|TonB-dependent-receptor-plug-domain-containing-protein
MKQYYFQLLCLFLSVSLYAQNIPEVKLKDNSTLKLVNLNVEVNITGNVALTTYKMKFYNGSDIVLEGELAFPLGQGQSVTDFAMDVNGSMRHAAIVEKELGRVAYESTIRKTIDPGLLEMTKGNNYKARVYPIPAKGYKEIEITYEQTLVANNEKHSYQIPLNFENKLSHFSIEINAFGKKNIQIIDPSIYNDLKFRNALGVKKAHFKAENFTPRNTITLEMRLEDEANLTTYNDYFNFYKSFKPKSRLKAKPKAITVFWDASYSMERRKLDKEFELLDAYLQYLENVKLNVVVFNTKIRSNNTYNIKKGNWNAVKKALENVVYDGGTSYVGLENYIAETNLLFTDGMFNLGDFKPTNHGAIYAINSLTSANHNRLSQLAHTSQANYVNLSNVEVKQAIKTITRENYKFLGVAKNDNVYEVYPLKNTIVNEDFALSGRFKANTTIELLFGYNNDVTDRVEVNLENLENSPTVKRLWAKQKLDYLNENSEENKDKIIQLALKNHLITAYTSMIILDRVEDYARYKIEPPTELKARYKELVKQEEANEADRLKHIESRKGDLLSEYKDLMRWYGKDFSKNIKDIKKPRQERTETNTTLSQHNGSPGANSNTSNSGFTRVIDSTKRIISGYVTSINGEPLPGVNIYVKNDVFAAVTDFDGKYMINAEFGSILVYSYIGFLTEEVTLGSNFVVNVALKEDRASLDEVVVVGYGVQRRTHVTGAVTAVSSESIENENIVVEALQGRVVGLNMESKRASNNTEDASIRVHGLNFNDSENAPLYVVDGIVYSEEDFKDISAKNIDNIRVLKDGAGSSIYGSRASNGVILISTKSGILENKEKIEALNRKIDEEIVFKPWSPKAEYLVNLSKSETLEIAYNAYLKLRETYKNTPTFFMDIAEYFDSINQKELAVQIVTNLIEIDLDNHELSRALAYKLQYFKEDALAVYVYQEILKLRPEEPHSYRDLALAYEAVGEYQKAFDILFRIVNGELLEKDEDERFYGIEHIAYVEACRLVSQHGDQLYLTENQRKLLKTFDVDIRVVIDWNHNDTDLDLWVENPNDEKVLYSNKTSKDGGRLSEDMTEGYGPEEFMIKKASKGDYEILVDYYADQVQKISGPTTLKVTIFTNYGRKNEKKEIRILRLNKKEDEIEVGTVSM
>NZ_CP047030.1|WP_159019969.1|3283495_3285124_-|acyl-CoA-carboxylase-subunit-beta
MDINFNKNEDHNKLLLSELKKRLVKVKLGGGKSRIEKLHSKGKMTARERIDFLLDPKKKSIEIAAFAGEDMYAEHGGCPSGGVVVKMGYVKGKQCIVVANDATVKAGAWFPITGKKNLRAQEIAIENRLPIIYLVDSAGVYLPLQDEIFPDKEHFGRIFRNNAIMSSMGITQIAAVMGSCVAGGAYLPIMSDEALIVDKTGSIFLAGSYLVKAAIGETIDNETLGGATTHCEISGVTDYKAKDDADALNTIKNIIDKIGDFDKAGYNRSEAKKPKENPEDIYGILPKSRADQYDMYEIIKRVVDNSEFDEYKAGYGQTIITAYARIDGWAVGIVANQRKLVKTASGEMQFGGVIYNDSADKATRFIANCNQKKIPLVFLQDVTGFMVGSKSEHGGIIKDGAKMVNAVSNSVVPKFTIIIGNSYGAGNYAMCGKAYDPRLIVAWPSAELAVMSGNSAAKVLLQIEKASLLKKGEEITPEKEAELFNKIKDRYDSQVSPYYAAARIWTDAIINPLDTRTWISMGIEAANHAPIEKPFNLGILQV
>NZ_CP047030.1|WP_159019970.1|3285272_3285629_+|DoxX-family-protein
MKRDKIIFYIATGLLSVIVLFSVYMYVFKHEAIVGAFTSLGYPPYLIYPYAGLKLLGLFAVWNPNFKTLKEWAYSGFFFAFILAFSAHIMVNDGGHMTAALALVFLIISYIFNKRINK
>NZ_CP047030.1|WP_159019971.1|3285631_3286162_+|NADPH-dependent-FMN-reductase
MKKIIAFAGSNSKQSINKQLATYAVSLVENVETTVLDLNDFDLPLYGMDHENEHGIPKDAHRFLEILKNTDGIILSLAEHNGAYSVVFKNLFDWMSRIEGKLFFKKPMLLMATSPGGRGGLSVLEIAKGRFPFHDGNIVESFSLPFFGDNFKENKIVDNALDTQLKEAVNKLQNSL
>NZ_CP047030.1|WP_159019972.1|3286164_3286602_+|MarR-family-transcriptional-regulator
MGDISKDINSKFPSNRVKAMLNVLYTANWIASYQTEFFKPFGISAQQFNILRILNGSKGPLSVQVIKDRMVERAPNATRLMDKLHAKDYIKRLPSKEDRRVVNIEITKKGIDLLESIPNTLNSDLFKNLNEEEAGQLSDLLDKMR
>NZ_CP047030.1|WP_159019973.1|3286674_3287397_+|pirin-family-protein
MKTIIHTADSRGFANHGWLQANHSFSFANFHNPEKVNFGALRVLNDDVIAPKMGFGTHPHDNMEIITIPLKGVLKHRDSMHDAWQAVLPGEVQIMSAGTGLEHSEINGSVDEHLSLFQIWVIPNKENVTPRYDQKMFNIDERKNKLQTLVTSIDEVHDGSLKIHQDAVISRIDLDKDNSFNYNLKSENHGVYVMTISGEVIINNSLLNSRDAIGVSETNTFEIHSKENASLLFIEVPMLF
>NZ_CP047030.1|WP_159019974.1|3287482_3288667_-|MFS-transporter
MNKALLSLAIGGFGIGLTEFVIMGILPDIATSFDISIPMAGHFISAYALGVVVGAPTLTGLGSKWPAHKVLLLLMLWFTVFNTLSSFATGYNSFIVLRFLSGLPHGAFFGIGAVVAGKLSKKGKEAQGIAIMFSGLTFANLLGVPLGTYLGKHFNWNVSFLMVGIVGVLAVLAVKFWMPTLKQSSEISFIKEFKIFKRLELWLIILLTTIGTGGFFAWYSYIAPLITDVAGHDKQVVSYAMILAGLGMVIGNVIGAKLAEKLQPIMAVLITLVFMAVCLVLNTYLASDKVMVLVMTFVIGMVTFCLSTPISLAIINASKGGETLGSSLNQSAFNVGNAAGAYFAGLPIAMGYGYTSADWVGAGMAALGVFIAFGIIQYRNYRFKRKYKMKACYS
>NZ_CP047030.1|WP_042494706.1|3288941_3289124_+|hypothetical-protein
MAMNKNTVLAWATIIMIFVGLGLIALGAFRYDDVAGWGFAAVGFGFFAVAWVFNALKGRV
>NZ_CP047030.1|WP_159019975.1|3289185_3290877_+|energy-dependent-translational-throttle-protein-EttA
MSDDKKIIFSMSGLTKTFPGANTPVLKNIYLSFFYGAKIGILGLNGSGKSTLLKIIAGVDKNYQGDVTFLQDYSVGYLEQEPQLDDDKTVMEIVREGAAETVAILDEYNKINDQFGLEEVYSDADKMEKLMNRQAELQDQIDASNAWELDTKLEIAMDALRTPDGDKKIGVLSGGEKRRVALCRLLLQEPDVLLLDEPTNHLDAESVHWLEHHLAQYKGTVIAVTHDRYFLDNVAGWILELDRGEGIPWKGNYSSWLDQKSKRMAQESKTASKRQKTLERELEWVRQGAKGRQTKQKARLNNYDKLMSQDQKQLDEKLEIYIPNGPRLGTNVIEASGVAKGYDDKLLYDNLNFNLPQAGIVGVIGPNGAGKTTIFRMIMGEETPDKGEFKVGDTAKLAYVDQKHSNIDPEKTIWQNFSDEQELVMMGGKEVNSRAYLSRFNFSGGEQNKKVKLLSGGERNRLHLAMTLKEEGNVLLLDEPTNDLDVNTLRALEEGLENFAGCAVVISHDRWFLDRICTHILAFEGDSQVYFFEGSFSDYEENKKKRLGGDLMPKRIKYKKLVR
>NZ_CP047030.1|WP_159019976.1|3291253_3291496_-|hypothetical-protein
MLNFQLHIVSLTIVLVSQSAIATILTIVLIFFAALLCLGVRKSYLLKKENERLESMNPQIEDEKDKPYKDFTQSHMYDKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047030_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047030_2

3278756-3278925

Orphan

Consensus_repeat	Method
GTTACCTTACTAACATCCCAGTT	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP047030_2

>merge|NZ_CP047030|2|3278756-3278925|CRISPRCasFinder
GTTACCTTACTAACATCCCAGTTGTTTAAAGGCTGATTAAATGTTCTGTGTCTATAGAACATAGAGCTCATGTTTGTTACCTTACTAACATTCCAGTTTTCTATAGGTTGGTTAAATTCCGATTGTCCAAACATTCTAGACATGTCTGTTACATTACTAACATTCCAGCT

>NZ_CP047030|2|2|3278756-3278925|CRISPRCasFinder
GTTACCTTACTAACATCCCAGTT	GTTTAAAGGCTGATTAAATGTTCTGTGTCTATAGAACATAGAGCTCATGTTT
GTTACCTTACTAACATTCCAGTT	TTCTATAGGTTGGTTAAATTCCGATTGTCCAAACATTCTAGACATGTCT
GTTACATTACTAACATTCCAGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047030.1\|WP_159021169.1\|3271418_3272336_-\|type-IX-secretion-system-membrane-protein-PorP/SprF	unknown	unknown	gnl\|CDD\|371704
NZ_CP047030.1\|WP_074939351.1\|3263640_3264480_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|181386
NZ_CP047030.1\|WP_159019966.1\|3269578_3271342_+\|signal-peptide-peptidase-SppA	unknown	unknown	gnl\|CDD\|273226
NZ_CP047030.1\|WP_159019970.1\|3285272_3285629_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|379266
NZ_CP047030.1\|WP_159019969.1\|3283495_3285124_-\|acyl-CoA-carboxylase-subunit-beta	unknown	unknown	gnl\|CDD\|178415
NZ_CP047030.1\|WP_159019974.1\|3287482_3288667_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|182234
NZ_CP047030.1\|WP_159019961.1\|3262470_3263586_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|367314
NZ_CP047030.1\|WP_159019964.1\|3267370_3268327_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP047030.1\|WP_159019962.1\|3264480_3265383_+\|1,4-dihydroxy-2-naphthoate-octaprenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP047030.1\|WP_159021168.1\|3266333_3267380_+\|o-succinylbenzoate-synthase	unknown	unknown	gnl\|CDD\|239436
NZ_CP047030.1\|WP_159019960.1\|3262117_3262294_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047030.1\|WP_159019968.1\|3279957_3283410_+\|TonB-dependent-receptor-plug-domain-containing-protein	unknown	unknown	gnl\|CDD\|274948
NZ_CP047030.1\|WP_159019975.1\|3289185_3290877_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP047030.1\|WP_159019973.1\|3286674_3287397_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|380375
NZ_CP047030.1\|WP_159019972.1\|3286164_3286602_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP047030.1\|WP_159019963.1\|3265425_3266103_+\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|234811
NZ_CP047030.1\|WP_159019965.1\|3268329_3269400_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341285
NZ_CP047030.1\|WP_159019971.1\|3285631_3286162_+\|NADPH-dependent-FMN-reductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP047030.1\|WP_042494706.1\|3288941_3289124_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047030.1\|WP_159019976.1\|3291253_3291496_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP047030.1\|WP_159021169.1\|3271418_3272336_-\|type-IX-secretion-system-membrane-protein-PorP/SprF	gnl\|CDD\|371704	pfam11751, PorP_SprF, Type IX secretion system membrane protein PorP/SprF. This entry describes a protein family unique to, and greatly expanded in, the Bacteriodetes. Species in this lineage include several, such as Cytophaga hutchinsonii and Cytophaga johnsonae (Flavobacterium johnsoniae), that exhibit a poorly understood rapid gliding phenotype. Several members of this protein family are found in operons with other genes whose loss leads to a loss of the rapid gliding phenotype.	5.43004e-49
NZ_CP047030.1\|WP_074939351.1\|3263640_3264480_+\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|181386	PRK08321, PRK08321, 1,4-dihydroxy-2-naphthoyl-CoA synthase.	5.37863e-180
NZ_CP047030.1\|WP_159019966.1\|3269578_3271342_+\|signal-peptide-peptidase-SppA	gnl\|CDD\|273226	TIGR00705, Protease_4, signal peptide peptidase SppA, 67K type. This model represents the signal peptide peptidase A (SppA, protease IV) as found in E. coli, Treponema pallidum, Mycobacterium leprae, and several other species, in which it has a molecular mass around 67 kDa and a duplication such that the N-terminal half shares extensive homology with the C-terminal half. This enzyme was shown in E. coli to form homotetramers. E. coli SohB, which is most closely homologous to the C-terminal duplication of SppA, is predicted to perform a similar function of small peptide degradation, but in the periplasm. Many prokaryotes have a single SppA/SohB homolog that may perform the function of either or both. [Protein fate, Degradation of proteins, peptides, and glycopeptides].	8.51797e-138
NZ_CP047030.1\|WP_159019970.1\|3285272_3285629_+\|DoxX-family-protein	gnl\|CDD\|379266	pfam13564, DoxX_2, DoxX-like family. This family of uncharacterized proteins are related to DoxX pfam07681.	2.35476e-12
NZ_CP047030.1\|WP_159019969.1\|3283495_3285124_-\|acyl-CoA-carboxylase-subunit-beta	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP047030.1\|WP_159019974.1\|3287482_3288667_-\|MFS-transporter	gnl\|CDD\|182234	PRK10091, PRK10091, MFS transport protein AraJ; Provisional.	6.14815e-111
NZ_CP047030.1\|WP_159019961.1\|3262470_3263586_-\|aminopeptidase	gnl\|CDD\|367314	pfam03051, Peptidase_C1_2, Peptidase C1-like family. This family is closely related to the Peptidase_C1 family pfam00112, containing several prokaryotic and eukaryotic aminopeptidases and bleomycin hydrolases.	2.63676e-20
NZ_CP047030.1\|WP_159019964.1\|3267370_3268327_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.02405e-08
NZ_CP047030.1\|WP_159019962.1\|3264480_3265383_+\|1,4-dihydroxy-2-naphthoate-octaprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	4.48465e-89
NZ_CP047030.1\|WP_159021168.1\|3266333_3267380_+\|o-succinylbenzoate-synthase	gnl\|CDD\|239436	cd03320, OSBS, o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway. Menaquinone is an essential cofactor for anaerobic growth in eubacteria and some archaea. OSBS belongs to the enolase superfamily of enzymes, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.	3.77911e-72
NZ_CP047030.1\|WP_159019968.1\|3279957_3283410_+\|TonB-dependent-receptor-plug-domain-containing-protein	gnl\|CDD\|274948	TIGR04056, OMP_RagA_SusC, TonB-linked outer membrane protein, SusC/RagA family. This model describes a distinctive clade among the TonB-linked outer membrane proteins (OMP). Members of this family are restricted to the Bacteriodetes lineage (except for Gemmatimonas aurantiaca T-27 from the novel phylum Gemmatimonadetes) and occur in high copy numbers, with over 100 members from Bacteroides thetaiotaomicron VPI-5482 alone. Published descriptions of members of this family are available for RagA from Porphyromonas gingivalis, SusC from Bacteroides thetaiotaomicron, and OmpW from Bacteroides caccae. Members form pairs with members of the SusD/RagB family (pfam07980). Transporter complexes including these outer membrane proteins are likely to import large degradation products of proteins (e.g. RagA) or carbohydrates (e.g. SusC) as nutrients, rather than siderophores. [Transport and binding proteins, Unknown substrate].	3.59805e-54
NZ_CP047030.1\|WP_159019973.1\|3286674_3287397_+\|pirin-family-protein	gnl\|CDD\|380375	cd02910, cupin_Yhhw_N, Escherichia coli YhhW and YhaK and related proteins, pirin-like bicupin, N-terminal cupin domain. This family includes the N-terminal cupin domains of YhhW and YhaK, Escherichia coli pirin-like proteins with unknown function. YhhW is structurally similar not only to human pirin but also to quercitin 2,3-dioxygenase (quercitinase). Although the function of YhhW is not completely understood, YhhW and its human ortholog have quercitinase activity and are likely to play an important role in transcription and apoptosis. This N-terminal cupin domain of YhhW has a metal coordination site and is thought to have catalytic activity while the C-terminal cupin-like domain has diverged considerably and has closer alignment with C-terminal pirin. YhaK is found in low abundance in the cytosol of E. coli and is strongly up-regulated by nitroso-glutathione (GSNO). There are major structural differences at the N-terminus of YhaK compared with YhhW; YhaK lacks the canonical cupin metal-binding residues of pirins and may be involved in chloride binding and/or sensing of oxidative stress in enterobacteria. YhaK showed no quercetinase and peroxidase activity; however, reduced YhaK was very sensitive to reactive oxygen species (ROS). Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	7.36395e-59
NZ_CP047030.1\|WP_159019972.1\|3286164_3286602_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.98023e-20
NZ_CP047030.1\|WP_159019963.1\|3265425_3266103_+\|metal-dependent-hydrolase	gnl\|CDD\|234811	PRK00685, PRK00685, metal-dependent hydrolase; Provisional.	7.36391e-81
NZ_CP047030.1\|WP_159019965.1\|3268329_3269400_+\|AMP-binding-protein	gnl\|CDD\|341285	cd17630, OSB_MenE-like, O-succinylbenzoic acid-CoA ligase. This family contains O-succinylbenzoyl-CoA (OSB-CoA) synthetase (also known as O-succinylbenzoic acid CoA ligase) that belongs to the ANL superfamily and catalyzes the ligation of CoA to o-succinylbenzoate (OSB). It includes MenE in the bacterial menaquinone biosynthesis pathway which is a promising target for the development of novel antibacterial agents. MenE catalyzes CoA ligation via an acyl-adenylate intermediate; tight-binding inhibitors of MenE based on stable acyl-sulfonyladenosine analogs of this intermediate provide a pathway toward the development of optimized MenE inhibitors.	3.8195e-50
NZ_CP047030.1\|WP_159019971.1\|3285631_3286162_+\|NADPH-dependent-FMN-reductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	4.69969e-35
NZ_CP047030.1\|WP_159019975.1\|3289185_3290877_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0

>NZ_CP047030.1|WP_159021169.1|3271418_3272336_-|type-IX-secretion-system-membrane-protein-PorP/SprF
MFTKKIIAIAIITIFACNLNAQQTPTFSEYNYNPFIINTAYAGLTENPEFSLSNTGFFNQFEGSPRNFSFSGHGSIDRNKMGIGAGIMRDEIGVTTSTSFFAAYSYKIFFDFKSNRPYWQLYDTGVLSFGITAGLQQYQSNLTQLGIIGDPKFAQDINSTIPTIGLSFLFNHASFYVGFSTPNVMGDSLASDSDLVLNSPYYGYFGYRIYNNRFEDFMIKPNMLIKYEDGAPFQADFNVALSFRNKLEIGTGYRTSNSINFLAGIYLFNNLRAIYNYNLANKNSALGNTHGLILSVQLGDGYSVN
>NZ_CP047030.1|WP_159019966.1|3269578_3271342_+|signal-peptide-peptidase-SppA
MEFIKRVFSTLTGIILFCVLFFLGIIFLGAIMGSGGDDVVTVKDNSVLELTLDFPIKDYAGKTEFAEYPFLNEDEKNGLFNIIDGIKLAATDDKIKGISIDNNFIQAGLSQTKALRGALLKFKESGKFIVAYADIYTQKDYYLSSVADTIFMNPVGAMEFKGLYSEQLYFKDLQEKSGVKMEVVRFGKYKSAVEPFLENEMSDNNREQISVYLNSLWTEMKRDISKSRMIDEAELNTIADSLLARNATLAKSSKMIDKIAYHDEYIDGLKYAVGIENDKKLKTISIADYAIHAADKLKLKSNKNRIAVIYAEGEIIYGEGDEDKVGQGTMGASLKKAREDDKVKAIVLRINSPGGSAVASELIWREIELTKKVKPVIVSMGNVAASGGYYIACNADKIIAEATTITGSIGVFGMIPNGKALADRIGINAEQVITNANAVSFSFYEPMSDVQRAFIKEGIIDVYELFTKRVADGRGMAQDDVKAIAQGRVWTGTDAVKNGLVDELGGLDLALKYAAEAAEIEEYKINEFPIFKKDLDKMLQDFGLVKAKETILKEELGDVQYNIYKEVKTRTQRKGIQLLFPYNLDVK
>NZ_CP047030.1|WP_159019965.1|3268329_3269400_+|AMP-binding-protein
MIPDYTKVHVRFKLNNHHYSHEDLMEVAYSFVKEGVAYERELGEFLLDWLDKHDFIKVRTSGSTGKPKEIIIKKEAMVKSAIATGNFFDLTPGKKVLHCLPSNFIAGKMMMVRAIVLGLELDMVEPAAFPRIDYEKDYEFCAFTPMQLKNFAKYFDKIKTVIVGGGRVSESIKALIQDKKPNVYETYGMTETVSHIAIKKINNFTDAESDKYFKTLPNITISTDDRSCLVINAPELLDETIVTNDIVKIHSDSSFEWLGRFDNVINSGGIKLYPEVIEEKLQCKIPQQFFITSVPDETLGEKAILIIEGKDNKVDEAIFEGLDKYEKPKAIYAVSKFIDTVSGKIHRKNTLDQVVF
>NZ_CP047030.1|WP_159019964.1|3267370_3268327_+|CPBP-family-intramembrane-metalloprotease
MYIAQAFKGLHDWWRYLLGVLIVFTAWQMVGMIPLGVVLGIKVFETGNIPVTIPDMIEALGSNLFLFLMLVSFAAGLAGVIFSAKVLHKQSFVQLTTTRKKIDWSRFWFIFILWGVISSGFVLIDYFFFAPEDYVLNFKLKPFLILAAIAITLIPLQTSFEEYFFRGYLMQGIGVVCKNKWLPLLITSVGFGLMHIANPEVEQLGPVIMVYYIGTGLFLGVLTLMDEGLELALGFHAANNLFTALLVTADWTAFQTDSILKDMSDPDTMALGEIFIPVFVVFPILLFILSKKYNWSNWKDKLIGNVIEPTKEDYKIIE
>NZ_CP047030.1|WP_159021168.1|3266333_3267380_+|o-succinylbenzoate-synthase
MTATYQPYTLNFKQASGTSRGILKTKDTWFIILNEGENKGVGECGMFRGLSIDDRPDFEDKLKWVCKNIQLGLDALLLQLEEFPSIQFGLEMAFKSIDSINGFDLFPSKFTETEDSIAINGLIWMGTESFMKQQIQDKIEAGFSCIKMKIGAIDFQTEINLLKSIRKEFNSNDIELRVDANGAFKPSEALEKLKVLSDFDLHSIEQPIKQGQIAEMAKLCETTPLPIALDEELIGVFSEEKKQALLETICPQYIILKPTLIGGFKGSESWINLAHKQNIGWWITSALESNVGLNAIAQYTYGLNSNLPQGLGTGGLFSNNFDSPLLVKNGTLQYNKVEPWKFNLEVCI
>NZ_CP047030.1|WP_159019963.1|3265425_3266103_+|metal-dependent-hydrolase
MKITFYGHACLGIQIEDINILVDPFITGNEKAANIDINSLKADYIMVTHAHQDHILDVEAIAKRTNAVIISNFEIVTHFGNLGFEGHPMNHGGQWDFEFGNVKYVNAIHTSSFPDGTYGGQPGGFIIEGEHKNIYIAGDTALTFDMKLIPLQTKLDLAILPIGDNFTMGINDAILASDFVECDKILGYHFDTFGYIEIDHEVAKRKFFEKDKDLMLLEIGESIEL
>NZ_CP047030.1|WP_159019962.1|3264480_3265383_+|1,4-dihydroxy-2-naphthoate-octaprenyltransferase
MNKTKVWISSMRLRTLPLSVSGIILASFLAAYQGVFNSVICVLAILSTLSFQILSNLANDYGDGVKGTDNDDRIGPERAIQSGVITPKEMKRAITINVAISVILALLTVYFAFGKAHFFLAVLFFALGVAAIIAAIKYTVGGNAYGYNAMGDVFVFLFFGLVSVVGGYVLYAKTIDFVVILPAMVIGLLSAAVLNLNNMRDIESDTKSNKITLALKLGSQKAKTYHSALVVSAILLSVLFGIIFYSSPFNFIFIIAFIPLFLHLKKVNNTKNPKHFDPELKKLALTTVLLSILMGLGQVL
>NZ_CP047030.1|WP_074939351.1|3263640_3264480_+|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MSQENWVTVKEYTDITYKKCNGVARIAFNRPDVRNAFRPKTTSELYDALYNANEDVNIGVVLLSAEGPSTKDGVYSFCSGGDQKARGHQGYVGEDGYHRLNILEVQRLIRFMPKAVIAVVPGWAVGGGHSLHVVCDLTLASKEHAIFKQTDADVTSFDGGYGSAYLAKMVGQKRAREIFFLGRNYSAQEAFDMGMVNAVVPHDELESTAYEWAQEILAKSPTSIKMLKFAMNLTDDGMVGQQVFAGEATRLAYMTEEATEGRNAFLEKRKPNFEKKWIP
>NZ_CP047030.1|WP_159019961.1|3262470_3263586_-|aminopeptidase
MKNNISLLVLLFICLSLNAQSYKFETVIDLETTDVISQGNTGTCWSFSTSSFLESEIMRITGKKIDLSEMYTVRNTYPKKAWNYIMRQGKTQFSDGGLAHDVLNSVKDHGLVPAFAFTGLEENATRHNHTEMLTVLKGLLNTYTKDVKKPLSPKWKQVIESVLDIYLGKNIETFNYEGVQYTPQSFLEFTKINLDDYVSLTSFSHQPFYTSFILNIPDNFSNGSFYNIPIEEMVKTANNALKKGYTIALDCDVSESTFTANPGMAIIPEDGNVDLKDLTEIVAEKEITQAYRQQEFENFNTTDDHLMHITGLVKDQNGNIYYKVKNSWGKNSERVANNGFIYMSEAYFKLKMISITLNKNVLDKKYHKILN
>NZ_CP047030.1|WP_159019960.1|3262117_3262294_-|hypothetical-protein
MILTITLTFTLLVFVNLLLLKFSCNKTAKTTKVNKQPVILAPYLELDAMQERLAPTGS
>NZ_CP047030.1|WP_159019968.1|3279957_3283410_+|TonB-dependent-receptor-plug-domain-containing-protein
MKQYYFQLLCLFLSVSLYAQNIPEVKLKDNSTLKLVNLNVEVNITGNVALTTYKMKFYNGSDIVLEGELAFPLGQGQSVTDFAMDVNGSMRHAAIVEKELGRVAYESTIRKTIDPGLLEMTKGNNYKARVYPIPAKGYKEIEITYEQTLVANNEKHSYQIPLNFENKLSHFSIEINAFGKKNIQIIDPSIYNDLKFRNALGVKKAHFKAENFTPRNTITLEMRLEDEANLTTYNDYFNFYKSFKPKSRLKAKPKAITVFWDASYSMERRKLDKEFELLDAYLQYLENVKLNVVVFNTKIRSNNTYNIKKGNWNAVKKALENVVYDGGTSYVGLENYIAETNLLFTDGMFNLGDFKPTNHGAIYAINSLTSANHNRLSQLAHTSQANYVNLSNVEVKQAIKTITRENYKFLGVAKNDNVYEVYPLKNTIVNEDFALSGRFKANTTIELLFGYNNDVTDRVEVNLENLENSPTVKRLWAKQKLDYLNENSEENKDKIIQLALKNHLITAYTSMIILDRVEDYARYKIEPPTELKARYKELVKQEEANEADRLKHIESRKGDLLSEYKDLMRWYGKDFSKNIKDIKKPRQERTETNTTLSQHNGSPGANSNTSNSGFTRVIDSTKRIISGYVTSINGEPLPGVNIYVKNDVFAAVTDFDGKYMINAEFGSILVYSYIGFLTEEVTLGSNFVVNVALKEDRASLDEVVVVGYGVQRRTHVTGAVTAVSSESIENENIVVEALQGRVVGLNMESKRASNNTEDASIRVHGLNFNDSENAPLYVVDGIVYSEEDFKDISAKNIDNIRVLKDGAGSSIYGSRASNGVILISTKSGILENKEKIEALNRKIDEEIVFKPWSPKAEYLVNLSKSETLEIAYNAYLKLRETYKNTPTFFMDIAEYFDSINQKELAVQIVTNLIEIDLDNHELSRALAYKLQYFKEDALAVYVYQEILKLRPEEPHSYRDLALAYEAVGEYQKAFDILFRIVNGELLEKDEDERFYGIEHIAYVEACRLVSQHGDQLYLTENQRKLLKTFDVDIRVVIDWNHNDTDLDLWVENPNDEKVLYSNKTSKDGGRLSEDMTEGYGPEEFMIKKASKGDYEILVDYYADQVQKISGPTTLKVTIFTNYGRKNEKKEIRILRLNKKEDEIEVGTVSM
>NZ_CP047030.1|WP_159019969.1|3283495_3285124_-|acyl-CoA-carboxylase-subunit-beta
MDINFNKNEDHNKLLLSELKKRLVKVKLGGGKSRIEKLHSKGKMTARERIDFLLDPKKKSIEIAAFAGEDMYAEHGGCPSGGVVVKMGYVKGKQCIVVANDATVKAGAWFPITGKKNLRAQEIAIENRLPIIYLVDSAGVYLPLQDEIFPDKEHFGRIFRNNAIMSSMGITQIAAVMGSCVAGGAYLPIMSDEALIVDKTGSIFLAGSYLVKAAIGETIDNETLGGATTHCEISGVTDYKAKDDADALNTIKNIIDKIGDFDKAGYNRSEAKKPKENPEDIYGILPKSRADQYDMYEIIKRVVDNSEFDEYKAGYGQTIITAYARIDGWAVGIVANQRKLVKTASGEMQFGGVIYNDSADKATRFIANCNQKKIPLVFLQDVTGFMVGSKSEHGGIIKDGAKMVNAVSNSVVPKFTIIIGNSYGAGNYAMCGKAYDPRLIVAWPSAELAVMSGNSAAKVLLQIEKASLLKKGEEITPEKEAELFNKIKDRYDSQVSPYYAAARIWTDAIINPLDTRTWISMGIEAANHAPIEKPFNLGILQV
>NZ_CP047030.1|WP_159019970.1|3285272_3285629_+|DoxX-family-protein
MKRDKIIFYIATGLLSVIVLFSVYMYVFKHEAIVGAFTSLGYPPYLIYPYAGLKLLGLFAVWNPNFKTLKEWAYSGFFFAFILAFSAHIMVNDGGHMTAALALVFLIISYIFNKRINK
>NZ_CP047030.1|WP_159019971.1|3285631_3286162_+|NADPH-dependent-FMN-reductase
MKKIIAFAGSNSKQSINKQLATYAVSLVENVETTVLDLNDFDLPLYGMDHENEHGIPKDAHRFLEILKNTDGIILSLAEHNGAYSVVFKNLFDWMSRIEGKLFFKKPMLLMATSPGGRGGLSVLEIAKGRFPFHDGNIVESFSLPFFGDNFKENKIVDNALDTQLKEAVNKLQNSL
>NZ_CP047030.1|WP_159019972.1|3286164_3286602_+|MarR-family-transcriptional-regulator
MGDISKDINSKFPSNRVKAMLNVLYTANWIASYQTEFFKPFGISAQQFNILRILNGSKGPLSVQVIKDRMVERAPNATRLMDKLHAKDYIKRLPSKEDRRVVNIEITKKGIDLLESIPNTLNSDLFKNLNEEEAGQLSDLLDKMR
>NZ_CP047030.1|WP_159019973.1|3286674_3287397_+|pirin-family-protein
MKTIIHTADSRGFANHGWLQANHSFSFANFHNPEKVNFGALRVLNDDVIAPKMGFGTHPHDNMEIITIPLKGVLKHRDSMHDAWQAVLPGEVQIMSAGTGLEHSEINGSVDEHLSLFQIWVIPNKENVTPRYDQKMFNIDERKNKLQTLVTSIDEVHDGSLKIHQDAVISRIDLDKDNSFNYNLKSENHGVYVMTISGEVIINNSLLNSRDAIGVSETNTFEIHSKENASLLFIEVPMLF
>NZ_CP047030.1|WP_159019974.1|3287482_3288667_-|MFS-transporter
MNKALLSLAIGGFGIGLTEFVIMGILPDIATSFDISIPMAGHFISAYALGVVVGAPTLTGLGSKWPAHKVLLLLMLWFTVFNTLSSFATGYNSFIVLRFLSGLPHGAFFGIGAVVAGKLSKKGKEAQGIAIMFSGLTFANLLGVPLGTYLGKHFNWNVSFLMVGIVGVLAVLAVKFWMPTLKQSSEISFIKEFKIFKRLELWLIILLTTIGTGGFFAWYSYIAPLITDVAGHDKQVVSYAMILAGLGMVIGNVIGAKLAEKLQPIMAVLITLVFMAVCLVLNTYLASDKVMVLVMTFVIGMVTFCLSTPISLAIINASKGGETLGSSLNQSAFNVGNAAGAYFAGLPIAMGYGYTSADWVGAGMAALGVFIAFGIIQYRNYRFKRKYKMKACYS
>NZ_CP047030.1|WP_042494706.1|3288941_3289124_+|hypothetical-protein
MAMNKNTVLAWATIIMIFVGLGLIALGAFRYDDVAGWGFAAVGFGFFAVAWVFNALKGRV
>NZ_CP047030.1|WP_159019975.1|3289185_3290877_+|energy-dependent-translational-throttle-protein-EttA
MSDDKKIIFSMSGLTKTFPGANTPVLKNIYLSFFYGAKIGILGLNGSGKSTLLKIIAGVDKNYQGDVTFLQDYSVGYLEQEPQLDDDKTVMEIVREGAAETVAILDEYNKINDQFGLEEVYSDADKMEKLMNRQAELQDQIDASNAWELDTKLEIAMDALRTPDGDKKIGVLSGGEKRRVALCRLLLQEPDVLLLDEPTNHLDAESVHWLEHHLAQYKGTVIAVTHDRYFLDNVAGWILELDRGEGIPWKGNYSSWLDQKSKRMAQESKTASKRQKTLERELEWVRQGAKGRQTKQKARLNNYDKLMSQDQKQLDEKLEIYIPNGPRLGTNVIEASGVAKGYDDKLLYDNLNFNLPQAGIVGVIGPNGAGKTTIFRMIMGEETPDKGEFKVGDTAKLAYVDQKHSNIDPEKTIWQNFSDEQELVMMGGKEVNSRAYLSRFNFSGGEQNKKVKLLSGGERNRLHLAMTLKEEGNVLLLDEPTNDLDVNTLRALEEGLENFAGCAVVISHDRWFLDRICTHILAFEGDSQVYFFEGSFSDYEENKKKRLGGDLMPKRIKYKKLVR
>NZ_CP047030.1|WP_159019976.1|3291253_3291496_-|hypothetical-protein
MLNFQLHIVSLTIVLVSQSAIATILTIVLIFFAALLCLGVRKSYLLKKENERLESMNPQIEDEKDKPYKDFTQSHMYDKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

440168 : 480522

Leptospira_phage(25.0%)

integrase,transposase

attL 461575:461609|attR 487173:487207

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159021058.1\|440168_440963_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.5e-33	34.5
WP_159018037.1\|441132_441603_+	hypothetical protein	NA	NA	NA	NA
WP_159018038.1\|441844_442285_+	hypothetical protein	NA	NA	NA	NA
WP_159018039.1\|442405_442663_+	hypothetical protein	NA	NA	NA	NA
WP_159018040.1\|442997_443570_+	DUF4738 domain-containing protein	NA	NA	NA	NA
WP_159018041.1\|444369_444864_+	hypothetical protein	NA	NA	NA	NA
WP_159018042.1\|446253_447006_+	hypothetical protein	NA	NA	NA	NA
WP_159018043.1\|447050_448022_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_159018044.1\|448390_448840_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_159018045.1\|449275_449668_+	hypothetical protein	NA	NA	NA	NA
WP_159018046.1\|449780_450302_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159021044.1\|450220_451135_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.7e-76	53.7
WP_159018047.1\|452767_453079_+	hypothetical protein	NA	NA	NA	NA
WP_159018048.1\|453198_457533_+	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_159018049.1\|457537_458743_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_117881269.1\|458745_459162_+	transcriptional repressor	NA	NA	NA	NA
WP_159018050.1\|459217_461170_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.1e-105	33.3
461575:461609	attL	NA	NA	NA	NA
WP_159018051.1\|461672_462407_-	SOS response-associated peptidase	S5VY94	Leptospira_phage	7.2e-06	28.7
WP_159018052.1\|462441_463701_-	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	1.5e-91	42.9
WP_159018053.1\|463701_464151_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	3.5e-27	42.5
WP_159018054.1\|464249_465317_-	T9SS type A sorting domain-containing protein	A0A2P0VMP9	Tetraselmis_virus	1.6e-17	31.9
WP_159018055.1\|466274_467459_-	helicase	NA	NA	NA	NA
WP_159018056.1\|467462_467801_-	hypothetical protein	NA	NA	NA	NA
WP_159018057.1\|467820_468111_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159018058.1\|468234_470286_-	hypothetical protein	NA	NA	NA	NA
WP_159018059.1\|470292_471510_-\|integrase	tyrosine-type recombinase/integrase	H7BUI8	unidentified_phage	4.7e-10	23.1
WP_159018060.1\|471873_472524_+	hypothetical protein	NA	NA	NA	NA
WP_159018061.1\|472724_473960_+	hypothetical protein	NA	NA	NA	NA
WP_159018043.1\|474009_474981_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_159018062.1\|475335_475929_+	hypothetical protein	NA	NA	NA	NA
WP_159018063.1\|476179_476485_+	hypothetical protein	NA	NA	NA	NA
WP_159018064.1\|476530_477316_+	GLPGLI family protein	NA	NA	NA	NA
WP_159018065.1\|477429_479949_+	hypothetical protein	NA	NA	NA	NA
WP_159018066.1\|480150_480522_+\|transposase	transposase	NA	NA	NA	NA
487173:487207	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047030

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection