CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
NZ_CP047087	Bacillus paranthracis strain BC307 plasmid pCE2, complete sequence	0 crisprs	RT,csa3	0	1
NZ_CP047088	Bacillus paranthracis strain BC307 plasmid pCE3, complete sequence	0 crisprs	NA	0	0
NZ_CP047086	Bacillus paranthracis strain BC307 plasmid pCE1, complete sequence	0 crisprs	csa3,RT,cas14j	0	2
NZ_CP047085	Bacillus paranthracis strain BC307 chromosome, complete genome	3 crisprs	RT,DinG,csa3,cas3,WYL,DEDDh,c2c9_V-U4	3	6

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1457 : 57043

Bacillus_phage(71.43%)

bacteriocin,integrase,transposase,protease

attL 87:101|attR 14921:14935

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
87:101	attL	NA	NA	NA	NA
WP_000196397.1\|1457_2384_+\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	1.5e-69	45.6
WP_000620148.1\|2766_3213_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001006392.1\|3512_4229_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000036964.1\|4243_5557_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000239235.1\|5549_7766_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.2e-48	29.8
WP_000764649.1\|7892_8129_-	hypothetical protein	NA	NA	NA	NA
WP_000391828.1\|8153_8348_-	hypothetical protein	NA	NA	NA	NA
WP_000437362.1\|8424_8616_-	hypothetical protein	NA	NA	NA	NA
WP_001191627.1\|8953_9484_+	hypothetical protein	NA	NA	NA	NA
WP_000265610.1\|9814_10036_+	hypothetical protein	NA	NA	NA	NA
WP_000421193.1\|10108_10669_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_159109414.1\|11222_12173_+	nucleoside hydrolase	NA	NA	NA	NA
WP_159109415.1\|12892_14539_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	6.4e-79	36.1
WP_000475241.1\|14732_15299_-	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	2.7e-16	52.0
14921:14935	attR	NA	NA	NA	NA
WP_000705234.1\|15869_17036_+	ParM/StbA family protein	NA	NA	NA	NA
WP_000533811.1\|17063_17483_+	hypothetical protein	NA	NA	NA	NA
WP_000248091.1\|17533_18118_-	hypothetical protein	NA	NA	NA	NA
WP_000147246.1\|18610_19081_-	DUF559 domain-containing protein	NA	NA	NA	NA
WP_000466110.1\|19461_19683_+	helix-turn-helix transcriptional regulator	A0A0S2GLH4	Bacillus_phage	8.5e-11	49.3
WP_002081758.1\|19711_20365_-	hypothetical protein	A0A1B1P7T2	Bacillus_phage	7.0e-77	64.4
WP_000832924.1\|20348_21512_-	DNA translocase FtsK	W8CYG2	Bacillus_phage	1.2e-156	70.8
WP_000934651.1\|21524_21848_-	hypothetical protein	A0A1B1P7T1	Bacillus_phage	1.0e-28	63.6
WP_001066182.1\|21858_22275_-	hypothetical protein	A0A1B1P7T3	Bacillus_phage	5.4e-51	73.0
WP_000055177.1\|22578_23436_+	hypothetical protein	NA	NA	NA	NA
WP_000990400.1\|23432_23621_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000922411.1\|25091_26012_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_001054408.1\|26222_27041_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-09	44.7
WP_000754399.1\|27187_28858_-	peptidase M4 family protein	NA	NA	NA	NA
WP_144531567.1\|29438_30251_+	hypothetical protein	NA	NA	NA	NA
WP_002081760.1\|30277_30538_+	hypothetical protein	NA	NA	NA	NA
WP_002028804.1\|30570_30912_+	hypothetical protein	NA	NA	NA	NA
WP_000511678.1\|31365_32322_+	hypothetical protein	NA	NA	NA	NA
WP_001009563.1\|32415_32850_-	sporulation protein	F8WPS9	Bacillus_phage	1.3e-31	48.6
WP_000389052.1\|32872_33124_-	hypothetical protein	NA	NA	NA	NA
WP_000658017.1\|33134_33365_-	hypothetical protein	NA	NA	NA	NA
WP_001161077.1\|34646_35177_+	hypothetical protein	NA	NA	NA	NA
WP_000709857.1\|35173_35914_+	hypothetical protein	NA	NA	NA	NA
WP_001123511.1\|38759_39065_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000648297.1\|39189_39471_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P791	Bacillus_phage	3.7e-11	32.1
WP_000448533.1\|39492_39726_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_000283265.1\|39977_40169_+	hypothetical protein	NA	NA	NA	NA
WP_000053706.1\|40299_40893_-	cell division protein FtsN	NA	NA	NA	NA
WP_002028794.1\|41797_42472_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	1.3e-14	30.2
WP_001037559.1\|43253_43409_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_000848948.1\|43517_43712_-	hypothetical protein	NA	NA	NA	NA
WP_000827733.1\|44099_46316_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	6.1e-48	29.3
WP_144531565.1\|46308_47616_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_002028789.1\|49442_50375_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_000581819.1\|50754_50961_-	hypothetical protein	NA	NA	NA	NA
WP_000600087.1\|50992_51313_-	hypothetical protein	NA	NA	NA	NA
WP_000636252.1\|51440_51737_-	hypothetical protein	NA	NA	NA	NA
WP_000247578.1\|51762_52083_-	hypothetical protein	NA	NA	NA	NA
WP_000808975.1\|52101_52686_-	hypothetical protein	NA	NA	NA	NA
WP_144531564.1\|54319_57043_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP047086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25686 : 32956

Enterobacteria_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000993737.1\|25686_26445_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.3e-61	46.6
WP_000588560.1\|26441_27695_-\|transposase	IS21-like element ISBce16 family transposase	U5N3F9	Enterobacteria_phage	2.5e-51	33.2
WP_014315595.1\|27809_27983_+	HIT family protein	D7NW73	Streptomyces_phage	7.6e-07	45.8
WP_000957215.1\|28008_28578_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000475617.1\|28950_29649_-	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	5.2e-46	47.4
WP_000701227.1\|30012_30465_+	hypothetical protein	NA	NA	NA	NA
WP_033656251.1\|30719_31295_-	recombinase family protein	M9Q1K0	Clostridium_phage	5.6e-14	30.6
WP_000383881.1\|31422_32268_-	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	4.4e-23	42.9
WP_001226074.1\|32380_32956_-	recombinase family protein	M9Q1K0	Clostridium_phage	4.6e-16	30.3

DBSCAN-SWA_2

147549 : 223814

Bacillus_phage(25.0%)

transposase,integrase,protease

attL 171637:171653|attR 226862:226878

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002029030.1\|147549_148515_-\|integrase	tyrosine-type recombinase/integrase	A0A1B1P793	Bacillus_phage	9.4e-38	32.3
WP_000520275.1\|149730_151440_-	hypothetical protein	NA	NA	NA	NA
WP_000369390.1\|152617_154315_+	hypothetical protein	NA	NA	NA	NA
WP_000237083.1\|154476_154944_-	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	5.1e-05	31.8
WP_000029763.1\|155960_156239_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000251104.1\|157868_158573_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_000721797.1\|159282_159807_+	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	1.1e-27	51.1
WP_000761925.1\|161013_161826_-	hypothetical protein	NA	NA	NA	NA
WP_000754407.1\|162406_164077_+	peptidase M4 family protein	NA	NA	NA	NA
WP_001027483.1\|164229_164778_+	PAS domain S-box protein	NA	NA	NA	NA
WP_000588567.1\|165219_165504_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-07	73.2
WP_001167047.1\|165706_165922_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.7e-19	68.7
WP_000755784.1\|165991_166411_-	hypothetical protein	NA	NA	NA	NA
WP_001035091.1\|167361_168732_+	chitin-binding protein	G1FGA4	Mycobacterium_phage	1.5e-09	39.4
WP_000847518.1\|168973_169441_-	hypothetical protein	NA	NA	NA	NA
WP_000404248.1\|170929_171232_-	hypothetical protein	NA	NA	NA	NA
171637:171653	attL	NA	NA	NA	NA
WP_000919812.1\|172073_172553_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002081533.1\|172794_173130_+	hypothetical protein	NA	NA	NA	NA
WP_002081534.1\|173177_174488_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000291846.1\|174764_175547_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000680399.1\|176537_177293_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_000764755.1\|177561_178275_+	thioesterase	NA	NA	NA	NA
WP_002081542.1\|178290_188415_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.9e-113	28.6
WP_159109404.1\|188428_196474_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.6e-106	27.4
WP_000590108.1\|196639_197515_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.4e-18	31.0
WP_001008264.1\|197530_198337_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_012552720.1\|199308_199722_+	hypothetical protein	NA	NA	NA	NA
WP_159109405.1\|199737_199899_+	hypothetical protein	NA	NA	NA	NA
WP_159109406.1\|200155_201265_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5S7K9	Streptococcus_phage	1.3e-11	28.4
WP_159109407.1\|201267_202668_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_159109408.1\|202687_204265_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_159109409.1\|204296_204737_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159109410.1\|205161_205920_-	hypothetical protein	NA	NA	NA	NA
WP_042598471.1\|206820_207024_+	hypothetical protein	NA	NA	NA	NA
WP_159109411.1\|207632_209306_+	DUF4297 domain-containing protein	NA	NA	NA	NA
WP_042596006.1\|209302_209839_+	hypothetical protein	NA	NA	NA	NA
WP_000999901.1\|213658_215587_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.3e-34	27.7
WP_000406896.1\|215731_216853_+	methyltransferase	NA	NA	NA	NA
WP_000114818.1\|216868_217096_+	hypothetical protein	NA	NA	NA	NA
WP_061129934.1\|217167_218847_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_001272777.1\|219547_221347_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.0e-29	25.9
WP_159109412.1\|221407_223084_+	helicase	NA	NA	NA	NA
WP_073536238.1\|223100_223814_+\|transposase	transposase	NA	NA	NA	NA
226862:226878	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP047085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047085_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047085_1

504733-504967

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP047085_1

>merge|NZ_CP047085|1|504733-504967|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTTGTTTTTGATCCTTCTGCATGAGAGAAAGAACCTTTTGCATGTGTCAGAAGTCCTTCTGCATGTGAA

>NZ_CP047085|1|1|504733-504967|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
TGTTTTTGATCCTTCTGCATGAGAG	AAAGAACCTTTTGCATG
TGTCAGAAGTCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047085.1\|WP_000043379.1\|499968_500367_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP047085.1\|WP_001004740.1\|508731_509490_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP047085.1\|WP_000932900.1\|511647_512748_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP047085.1\|WP_000360652.1\|499075_499969_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP047085.1\|WP_000799204.1\|493808_495353_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP047085.1\|WP_000654997.1\|514284_514965_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP047085.1\|WP_001081482.1\|501674_502313_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP047085.1\|WP_000191110.1\|500547_501126_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP047085.1\|WP_000655329.1\|506486_507647_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP047085.1\|WP_000003390.1\|496728_498555_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP047085.1\|WP_000427737.1\|507789_508725_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP047085.1\|WP_001272381.1\|513585_514272_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP047085.1\|WP_000428846.1\|509626_510472_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP047085.1\|WP_000872720.1\|505671_506412_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP047085.1\|WP_001180003.1\|501272_501644_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047085.1\|WP_000069694.1\|510594_511482_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP047085.1\|WP_001087862.1\|512899_513589_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
NZ_CP047085.1\|WP_000350710.1\|493052_493736_+\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|235030
NZ_CP047085.1\|WP_000612264.1\|495433_496678_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP047085.1\|WP_001079095.1\|503143_504037_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638

Protein	Function_ID	Function_description	E-value
NZ_CP047085.1\|WP_000043379.1\|499968_500367_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	2.09549e-70
NZ_CP047085.1\|WP_001004740.1\|508731_509490_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.45158e-20
NZ_CP047085.1\|WP_000932900.1\|511647_512748_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.83297e-53
NZ_CP047085.1\|WP_000360652.1\|499075_499969_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	2.84958e-93
NZ_CP047085.1\|WP_000799204.1\|493808_495353_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP047085.1\|WP_000654997.1\|514284_514965_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP047085.1\|WP_001081482.1\|501674_502313_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP047085.1\|WP_000191110.1\|500547_501126_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.78128e-83
NZ_CP047085.1\|WP_000655329.1\|506486_507647_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.11727e-100
NZ_CP047085.1\|WP_000003390.1\|496728_498555_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP047085.1\|WP_000427737.1\|507789_508725_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2148e-22
NZ_CP047085.1\|WP_001272381.1\|513585_514272_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.7405e-109
NZ_CP047085.1\|WP_000428846.1\|509626_510472_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	2.61854e-149
NZ_CP047085.1\|WP_000872720.1\|505671_506412_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP047085.1\|WP_000069694.1\|510594_511482_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.15219e-17
NZ_CP047085.1\|WP_001087862.1\|512899_513589_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.95233e-18
NZ_CP047085.1\|WP_000350710.1\|493052_493736_+\|adaptor-protein-MecA	gnl\|CDD\|235030	PRK02315, PRK02315, adaptor protein MecA.	1.59388e-85
NZ_CP047085.1\|WP_000612264.1\|495433_496678_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.19935e-58
NZ_CP047085.1\|WP_001079095.1\|503143_504037_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.99204e-99

>NZ_CP047085.1|WP_001079095.1|503143_504037_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGSIEVNGQHASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKRHLTSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSVNHKTHVSLELDTGRTHQIRVHMAYIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTPIPSDMQAVLRHT
>NZ_CP047085.1|WP_001081482.1|501674_502313_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP047085.1|WP_001180003.1|501272_501644_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP047085.1|WP_000191110.1|500547_501126_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFNTLCKSFSIEGFTKQVNHYFETPSFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVITADEARLMMETNTIIQGAVVDQLHTLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEEAGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP047085.1|WP_000043379.1|499968_500367_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVDGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP047085.1|WP_000360652.1|499075_499969_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSNIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP047085.1|WP_000003390.1|496728_498555_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDAEWEQEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQSVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP047085.1|WP_000612264.1|495433_496678_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQKVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWKAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKKRKDYFRQNALPILNYNDKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYVGVLQRVGTYKYRKIRGISMLKTEEEVMKYDERSLAYALSLFEAKYNMREGKADIIKTDREGIT
>NZ_CP047085.1|WP_000799204.1|493808_495353_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP047085.1|WP_000350710.1|493052_493736_+|adaptor-protein-MecA
MDIERINDHTMKFFITYIDIEDRGFNREEIWYDRERSEELFWEMMDEARDHDDFFIDGPLWIQVQAVDKGIEVLVTKAELSKDGQKLELPIGVDKIIDIPLDEGIESLFQQELVEEVEEQAGTNFNEDGTFGFLIKFNDFEDVISLSHRLIFEDIKDELYSFEDRYYVYVEFDEVLHDEEEIDRILSIVLEYGEESTLTIHRVSEYGKQIVKEHALETIRNNFPAKT
>NZ_CP047085.1|WP_000872720.1|505671_506412_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMEIVSVPSSLPFVPEKFRPIS
>NZ_CP047085.1|WP_000655329.1|506486_507647_-|rod-shape-determining-protein-RodA
MKDSNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPSFLQHVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAVTIKGATAWYRLPGIGNFQPSEIMKLFLIIVIGRIIANHNEKYFYRTIQDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFAAGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP047085.1|WP_000427737.1|507789_508725_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMNRLYDEDTLLNGKDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQETDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP047085.1|WP_001004740.1|508731_509490_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYFSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYLEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP047085.1|WP_000428846.1|509626_510472_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP047085.1|WP_000069694.1|510594_511482_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTVPTGPTGSTGPTGPTGSTGPTGPTGPTGDTGATGPTGPTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NZ_CP047085.1|WP_000932900.1|511647_512748_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGDQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKSL
>NZ_CP047085.1|WP_001087862.1|512899_513589_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP047085.1|WP_001272381.1|513585_514272_+|streptomycin-biosynthesis-protein-StrF
MSAGEKTILFVTCINDRKMYAQCVRHILRLAVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NZ_CP047085.1|WP_000654997.1|514284_514965_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047085_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047085_2

2397401-2397562

Orphan

Consensus_repeat	Method
TGTGGACCTTGGATTCCTTGTGGACC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP047085_2

>merge|NZ_CP047085|2|2397401-2397562|CRISPRCasFinder
TGTATCCCTTGGATTCCTGTCGGTCCTGTTGCTCCTATCACTCCAGTCGCTCCGGTTGCTCCGGTCACACCCTGTGGACCTTGGATTCCTTGTGGACCGGTTGGACCCGTCGCTCCCGTCGGGCCGGTTGCACCAGTTGAACCTGTTATCCCTTGTGGTCCT

>NZ_CP047085|2|2|2397401-2397562|CRISPRCasFinder
TGTATCCCTTGGATTCCTGTCGGTCC	TGTTGCTCCTATCACTCCAGTCGCTCCGGTTGCTCCGGTCACACCC
TGTGGACCTTGGATTCCTTGTGGACC	GGTTGGACCCGTCGCTCCCGTCGGGCCGGTTGCACCA
GTTGAACCTGTTATCCCTTGTGGTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047085.1\|WP_000615118.1\|2395922_2396384_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP047085.1\|WP_000938439.1\|2405615_2406164_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NZ_CP047085.1\|WP_000411471.1\|2394349_2395471_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP047085.1\|WP_000285637.1\|2408277_2408685_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NZ_CP047085.1\|WP_000679170.1\|2402021_2402777_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP047085.1\|WP_000687552.1\|2389991_2390372_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP047085.1\|WP_000043165.1\|2390433_2391462_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP047085.1\|WP_002028078.1\|2408960_2409755_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NZ_CP047085.1\|WP_000540488.1\|2389482_2389932_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP047085.1\|WP_000845609.1\|2391797_2392361_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP047085.1\|WP_001072953.1\|2402817_2403360_-\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP047085.1\|WP_000402268.1\|2406829_2408158_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP047085.1\|WP_000118346.1\|2393973_2394285_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047085.1\|WP_000355457.1\|2388625_2389465_+\|DUF2785-domain-containing-protein	unknown	unknown	gnl\|CDD\|371322
NZ_CP047085.1\|WP_000539725.1\|2395536_2395785_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP047085.1\|WP_000616837.1\|2406363_2406777_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP047085.1\|WP_000823782.1\|2404825_2405203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|172362
NZ_CP047085.1\|WP_123805643.1\|2392571_2393609_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NZ_CP047085.1\|WP_000747692.1\|2405278_2405518_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806
NZ_CP047085.1\|WP_000834854.1\|2403472_2404672_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP047085.1\|WP_000615118.1\|2395922_2396384_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.42238e-13
NZ_CP047085.1\|WP_000938439.1\|2405615_2406164_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	4.18873e-83
NZ_CP047085.1\|WP_000411471.1\|2394349_2395471_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.29028e-58
NZ_CP047085.1\|WP_000285637.1\|2408277_2408685_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.6098e-61
NZ_CP047085.1\|WP_000679170.1\|2402021_2402777_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.02533e-21
NZ_CP047085.1\|WP_000687552.1\|2389991_2390372_-\|hypothetical-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.06369e-65
NZ_CP047085.1\|WP_000043165.1\|2390433_2391462_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	4.43921e-22
NZ_CP047085.1\|WP_002028078.1\|2408960_2409755_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.62459e-09
NZ_CP047085.1\|WP_000540488.1\|2389482_2389932_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	6.03244e-59
NZ_CP047085.1\|WP_000845609.1\|2391797_2392361_-\|maltose-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.0069e-101
NZ_CP047085.1\|WP_001072953.1\|2402817_2403360_-\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	3.94307e-18
NZ_CP047085.1\|WP_000402268.1\|2406829_2408158_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	6.49119e-161
NZ_CP047085.1\|WP_000355457.1\|2388625_2389465_+\|DUF2785-domain-containing-protein	gnl\|CDD\|371322	pfam10978, DUF2785, Protein of unknown function (DUF2785). Some members in this family are annotated as hypothetical membrane spanning proteins however this cannot be confirmed. The family has no known function.	1.24118e-39
NZ_CP047085.1\|WP_000539725.1\|2395536_2395785_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.60708e-09
NZ_CP047085.1\|WP_000616837.1\|2406363_2406777_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	5.68943e-07
NZ_CP047085.1\|WP_000823782.1\|2404825_2405203_+\|hypothetical-protein	gnl\|CDD\|172362	PRK13835, PRK13835, conjugal transfer protein TrbH; Provisional.	0.00130673
NZ_CP047085.1\|WP_123805643.1\|2392571_2393609_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0
NZ_CP047085.1\|WP_000747692.1\|2405278_2405518_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	4.03879e-12
NZ_CP047085.1\|WP_000834854.1\|2403472_2404672_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.34374e-70

>NZ_CP047085.1|WP_000615118.1|2395922_2396384_+|GNAT-family-N-acetyltransferase
MIQKLITTSHNTATSILNIQISAYKIEAKYINSTAIPRLYDTVADIQSCDEIFYGYFFEDTLAGFISFKIDEEEVDIHRLVVSPDHFHKGIATKLLLYVFDMFSPSKTYIVQTGKENTPALSLYKKHGFIEVQNIVLPDGVILTSLKKTENNE
>NZ_CP047085.1|WP_000539725.1|2395536_2395785_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGKLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NZ_CP047085.1|WP_000411471.1|2394349_2395471_-|AI-2E-family-transporter
MEKINIRKRDKLKKFFREHNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVASMVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRRPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NZ_CP047085.1|WP_000118346.1|2393973_2394285_+|hypothetical-protein
MSWFTKKNDEKIDEFKNDDTTQGDTLGVIIHFTPVAIYLYTCDEYIETFEGALTFENENGNQVEIGGTFISLEVDANFRMDDLIFDYKLKESNLPIVELKAYA
>NZ_CP047085.1|WP_123805643.1|2392571_2393609_-|tryptophan--tRNA-ligase
MRGSFCFEKGGVRMSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKKNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQIEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQEKLRKLIFKIKTDSSLPNEPKELETLFTIYKEFATEDEMQSMREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARTIAKVNLTEIKKRIGFEREH
>NZ_CP047085.1|WP_000845609.1|2391797_2392361_-|maltose-O-acetyltransferase
MKTEKEKMLAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSADGASHIKPTFRCDYGYNIHIGKNFFSNFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NZ_CP047085.1|WP_000043165.1|2390433_2391462_-|ROK-family-protein
MSKQFVTQKSIKETILRGIRKVLLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSMLIDTGVNVLSKHIEGLIATFPKISSISIGVPGSVDNGRIFYIPGYEKFQNFNLKSHLEEQFSIPVVIENDMNAAVLGYYKNTGNYDNSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYNNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHAFIFCDDEVNQFVIEQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NZ_CP047085.1|WP_000687552.1|2389991_2390372_-|hypothetical-protein
MKIEHVAIWVNDLEGMRDFYKKYFNGEENSLYHNPKKQFESYFITFEGGARLELMKRVGIEDALQTETIGYAHIAFSVGSKEKVNELTNTLREAGYAVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NZ_CP047085.1|WP_000540488.1|2389482_2389932_+|NUDIX-hydrolase
MGYIEDMRNLVGNQPLILIGSHAIIVNENNEILLQLRTDFNRWGIIGGALEYNETLEDALKREVYEETGLIIKNPELFRTYSGPDFFQIYPNGDQVHGVLVVYICREFHGELVCDQTESKELRFFPLDELPSTLHPVIEGILRHFHHSN
>NZ_CP047085.1|WP_000355457.1|2388625_2389465_+|DUF2785-domain-containing-protein
MDITALQQQLELIQQNDYTQLRHIDINELTLHMLQYIGTTDSYVRYQLIYKCFVHFIHHEFLMDDQLKLLLHTCLSDEYLYCDIYTPHTDGVFTRSYTVSLIALILQFANSHYFFTEEDIEEIKNKLITYTNLETDFRGYIENKGWAHCLAHVSDAFTEIVHNTYTTFEWYEELIHCLLNKIFIPSDLFHNNEDERIVTPLLAMLYHDFPQDELISIIHKKIKRLPQIRKRLSLNEYCILCANIKTFLRTLFFRTKDDHNLAFTARKTERMLKELPNYY
>NZ_CP047085.1|WP_000679170.1|2402021_2402777_-|class-I-SAM-dependent-methyltransferase
MKGTQMIALNKKCWDTVAPYFFQVDCLPKYGPYTASEDEIHLFDSIKGKKVLDIGCGSGHSLQYMAEHGAEELWGLDLSSTQIETAHKTLQSWNPKLICGAMEEERDIPKGYFDIVYSIYALGWTSDLRKTLELIYSYVKPEGSFIFSWEHPVYSNLMYGTKEIAFSSSYHEETPITFETFKGEDVQATLYKRKMSTYINELNRAGFTIERIEEPETSSLFDEELAEPSTKYYSLYKARMVPTTFIIKARK
>NZ_CP047085.1|WP_001072953.1|2402817_2403360_-|CGNR-zinc-finger-domain-containing-protein
MNQNAPNKLEYIREFLNTWRIPNDTREAIDLLQTEEDIKKFMKESFHEELLFHTIEELKSFREDIRAAIEGEGSLQKWLEKYPFHVHIKEDMKGITYEPVYEENVYTKILSIVFISIQENLWGRLKACPDCRWVFYDHSRNGSKRWCGMYAGEEGGRACGTIAKVKNYRAKRKGRTGYNV
>NZ_CP047085.1|WP_000834854.1|2403472_2404672_+|MFS-transporter
MKSFSTPIRFMLISSFFMSFGYFAVYAFLAIYLLTFLHFSAFQVGTVLTVMIITSRVIPLFSGLIADKIGYIIMMVAGLFLRGIGFIALGICSDFYTISISSALIGFGTTFYEPAARAIFGSQPAHLRKNLFTYLNLSFNCGAIIGPIAGGFLLLLDPIYAFSLTGFLMLLFAFIFYLLKNHFQVTTENTSITLGIQAILQNKSFLLFSFIMIFFYIMFTQLTVALPLHMKNISNSNQLATLVITINAITGVIFMVLFRKLFHKYNTLSIIKYGVLLMSISFLLIPLFQHPYWLFICVILFTIGETLVLPNADIAIANYSNESYTATFFGFYQLSLAFGFIIGNYTGTSFTSNLSGVYTPWLIFGGIGLIGFISLHILNTKKDFLKKIYAYCKNTNLQQ
>NZ_CP047085.1|WP_000823782.1|2404825_2405203_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNASMELLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDNNDDGEIVTFKQVRYTVKN
>NZ_CP047085.1|WP_000747692.1|2405278_2405518_+|DUF3923-family-protein
MKKRWISWWIGNLFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSLSLIVILIAFIIPVFFQVIWLIINLRMSKKNNYTI
>NZ_CP047085.1|WP_000938439.1|2405615_2406164_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHAS
>NZ_CP047085.1|WP_000616837.1|2406363_2406777_-|ATP-synthase-subunit-I
MIQVALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANMQVVKEEEKKREHASKNIEL
>NZ_CP047085.1|WP_000402268.1|2406829_2408158_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKVRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAEKVTLLLAGPLMMFYKVMYPFIWVLNGSARVVTGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NZ_CP047085.1|WP_000285637.1|2408277_2408685_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHRLEAELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NZ_CP047085.1|WP_002028078.1|2408960_2409755_+|glycosyltransferase-family-2-protein
MLLEEIKITKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLFAPHWEVRDSRFLEFDPTNTDIEVMEIEREVSGWKMVLNTTEFLCCNNVEEFFSSLHTLGQNMYAIRMIVMIDKHDYNYSKLRYSIPLVEQRYHGLFPYNPAIGCAWRFIHNHLDGAYLPGRHFTRHQPIVYNFPSFIFKFYFSPWNEHTKARKLQITPTLSKKGVRLGLQKQYGRSSEELEARFLTLTNATQDLRNHPEYQQLFPKFKP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047085_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047085_3

2397635-2398029

Orphan

Consensus_repeat	Method
TGTGGACCTTGGATTCCTTGTGGACC	CRISPRCasFinder

6 spacers

The CRISPR arrays of NZ_CP047085_3

>merge|NZ_CP047085|3|2397635-2398029|CRISPRCasFinder
TGTGGTCCTTGAATTCCTTGTGGACCTTGAGGACCCGTTACTCCCGCCTGCCCTGTTGCTCCAGTTGCTCCGGTTGGTCCCGTCGAACCGGTTATCCCTTGAATTCCTTGCGGTCCAGTTGGGCCGGTTGGACCAATAGGCCCTTGGATTCCTTGGATTCCTTGAATGCCCTGTGGACCGGTTGGGCCTTGTATACCTTGTATACCTTGAATTCCTTGTGGCCCTGTTGCCCCTGTTGGACCAGTTGGACCCTCTGGACCTTGCACTCCTTGGATTCCAGTCGAACCGGTTGGACCTATATTTCCTTGAGGTCCCTGTATACCTTGAATTCCTTGTGGACCGGTTGGGCCTGTTATGCCGCTCAGCCCTTGTACTCCTTGGATTCCTTGGGGTCC

>NZ_CP047085|3|3|2397635-2398029|CRISPRCasFinder
TGTGGTCCTTGAATTCCTTGTGGACC	TTGAGGACCCGTTACTCCCGCCTGCCCTGTTGCTCCAGTTGCTCCGGTTGGTCCCGTCGAACCG
GTTATCCCTTGAATTCCTTGCGGTCC	AGTTGGGCCGGTTGGACCA
ATAGGCCCTTGGATTCCTTGGATTCC	TTGAATGCCCTGTGGACCG
GTTGGGCCTTGTATACCTTGTATACC	TTGAATTCCTTGTGGCCCTGTTGCCCCTGTTGGACCAGTTGGACCC
TCTGGACCTTGCACTCCTTGGATTCC	AGTCGAACCGGTTGGACCTATATTTCCTTGAGGTCCC
TGTATACCTTGAATTCCTTGTGGACC	GGTTGGGCCTGTTATGCCGCTCAGCCCT
TGTACTCCTTGGATTCCTTGGGGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047085.1\|WP_000615118.1\|2395922_2396384_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP047085.1\|WP_000938439.1\|2405615_2406164_-\|DUF2179-domain-containing-protein	unknown	unknown	gnl\|CDD\|235234
NZ_CP047085.1\|WP_000411471.1\|2394349_2395471_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP047085.1\|WP_000285637.1\|2408277_2408685_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133406
NZ_CP047085.1\|WP_000679170.1\|2402021_2402777_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP047085.1\|WP_000687552.1\|2389991_2390372_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP047085.1\|WP_000043165.1\|2390433_2391462_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP047085.1\|WP_002028078.1\|2408960_2409755_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|372681
NZ_CP047085.1\|WP_000540488.1\|2389482_2389932_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP047085.1\|WP_000845609.1\|2391797_2392361_-\|maltose-O-acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP047085.1\|WP_001072953.1\|2402817_2403360_-\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP047085.1\|WP_000402268.1\|2406829_2408158_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP047085.1\|WP_000118346.1\|2393973_2394285_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047085.1\|WP_000355457.1\|2388625_2389465_+\|DUF2785-domain-containing-protein	unknown	unknown	gnl\|CDD\|371322
NZ_CP047085.1\|WP_000539725.1\|2395536_2395785_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP047085.1\|WP_000616837.1\|2406363_2406777_-\|ATP-synthase-subunit-I	unknown	unknown	gnl\|CDD\|377159
NZ_CP047085.1\|WP_000823782.1\|2404825_2405203_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|172362
NZ_CP047085.1\|WP_123805643.1\|2392571_2393609_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183592
NZ_CP047085.1\|WP_000747692.1\|2405278_2405518_+\|DUF3923-family-protein	unknown	unknown	gnl\|CDD\|289806
NZ_CP047085.1\|WP_000834854.1\|2403472_2404672_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887

Protein	Function_ID	Function_description	E-value
NZ_CP047085.1\|WP_000615118.1\|2395922_2396384_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.42238e-13
NZ_CP047085.1\|WP_000938439.1\|2405615_2406164_-\|DUF2179-domain-containing-protein	gnl\|CDD\|235234	PRK04164, PRK04164, hypothetical protein; Provisional.	4.18873e-83
NZ_CP047085.1\|WP_000411471.1\|2394349_2395471_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.29028e-58
NZ_CP047085.1\|WP_000285637.1\|2408277_2408685_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133406	cd04779, HTH_MerR-like_sg4, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 4). Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.6098e-61
NZ_CP047085.1\|WP_000679170.1\|2402021_2402777_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	2.02533e-21
NZ_CP047085.1\|WP_000687552.1\|2389991_2390372_-\|hypothetical-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.06369e-65
NZ_CP047085.1\|WP_000043165.1\|2390433_2391462_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	4.43921e-22
NZ_CP047085.1\|WP_002028078.1\|2408960_2409755_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|372681	pfam13704, Glyco_tranf_2_4, Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,.	1.62459e-09
NZ_CP047085.1\|WP_000540488.1\|2389482_2389932_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	6.03244e-59
NZ_CP047085.1\|WP_000845609.1\|2391797_2392361_-\|maltose-O-acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	1.0069e-101
NZ_CP047085.1\|WP_001072953.1\|2402817_2403360_-\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	3.94307e-18
NZ_CP047085.1\|WP_000402268.1\|2406829_2408158_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	6.49119e-161
NZ_CP047085.1\|WP_000355457.1\|2388625_2389465_+\|DUF2785-domain-containing-protein	gnl\|CDD\|371322	pfam10978, DUF2785, Protein of unknown function (DUF2785). Some members in this family are annotated as hypothetical membrane spanning proteins however this cannot be confirmed. The family has no known function.	1.24118e-39
NZ_CP047085.1\|WP_000539725.1\|2395536_2395785_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.60708e-09
NZ_CP047085.1\|WP_000616837.1\|2406363_2406777_-\|ATP-synthase-subunit-I	gnl\|CDD\|377159	pfam03899, ATP-synt_I, ATP synthase I chain. The atp operon of alkaliphilic Bacillus pseudofirmus OF4, as in most prokaryotes, contains the eight structural genes for the F-ATPase (ATP synthase), which are preceded by an atpI gene that encodes a membrane protein with 2 TMSs. A tenth gene, atpZ, has been found in this operon, which is upstream of and overlapping with atpI. AtpI is a Ca2+/Mg2+ transporter.	5.68943e-07
NZ_CP047085.1\|WP_000823782.1\|2404825_2405203_+\|hypothetical-protein	gnl\|CDD\|172362	PRK13835, PRK13835, conjugal transfer protein TrbH; Provisional.	0.00130673
NZ_CP047085.1\|WP_123805643.1\|2392571_2393609_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183592	PRK12556, PRK12556, tryptophanyl-tRNA synthetase; Provisional.	0
NZ_CP047085.1\|WP_000747692.1\|2405278_2405518_+\|DUF3923-family-protein	gnl\|CDD\|289806	pfam13061, DUF3923, Protein of unknown function (DUF3923). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 80 amino acids in length.	4.03879e-12
NZ_CP047085.1\|WP_000834854.1\|2403472_2404672_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.34374e-70

>NZ_CP047085.1|WP_000615118.1|2395922_2396384_+|GNAT-family-N-acetyltransferase
MIQKLITTSHNTATSILNIQISAYKIEAKYINSTAIPRLYDTVADIQSCDEIFYGYFFEDTLAGFISFKIDEEEVDIHRLVVSPDHFHKGIATKLLLYVFDMFSPSKTYIVQTGKENTPALSLYKKHGFIEVQNIVLPDGVILTSLKKTENNE
>NZ_CP047085.1|WP_000539725.1|2395536_2395785_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGWIITLIVGAIIGAIASSITGKNFPGGMFGNIIAGLLGASLGGKLFGSFGPSFGGIHVVPALLGAIVLIFIVSFVVKAAKK
>NZ_CP047085.1|WP_000411471.1|2394349_2395471_-|AI-2E-family-transporter
MEKINIRKRDKLKKFFREHNYLAVLLGFALLFINILLLTKISFVFTPFIVFLKTIFFPVLLAGVLFYILHPFVSLLEKKGVSRIVSIASIYLIVIGLFVFLVLTVIPIIKDQIDALIDNLPYFGHEIERAARRFGESNLLGKIQENLNIDVASMVKDYTVDFTKSLSSVTGNVTGFLSTITEVVLTFVMVPFILFYLLKDGEQLPNHFLKFISEQRRPAAMRILDDMHYAISSYIRGQIIVSLFIGIMLLIGYLIIGIKYAVLLAILAMIVNIVPYVGPIIAITPALIIAFIDSPGMVLKVIIVMMVVQLAEGKFISPQVMGKKLDIHPITIIFIILTAGNLFGIMGIILAIPGYAILKVLVTHGYRFVKLNT
>NZ_CP047085.1|WP_000118346.1|2393973_2394285_+|hypothetical-protein
MSWFTKKNDEKIDEFKNDDTTQGDTLGVIIHFTPVAIYLYTCDEYIETFEGALTFENENGNQVEIGGTFISLEVDANFRMDDLIFDYKLKESNLPIVELKAYA
>NZ_CP047085.1|WP_123805643.1|2392571_2393609_-|tryptophan--tRNA-ligase
MRGSFCFEKGGVRMSEKIMLTGIKPTGYPHLGNYIGAIKPALQMSKKNEGKALYFIADYHALNAVHDPEKFSSYTKEVAATWLSLGLGEDVIFYRQIEVPEILELAWILACLTPKGLMNRAHAYKAKVEQNKEAGLEVDAGVNMGLYTYPILMAADILLFQATHVPVGKDQIQHIEIARDIATYFNHTFGTTFTLPEYVIQEEGAILPGLDGRKMSKSYGNVIPLFAEQEKLRKLIFKIKTDSSLPNEPKELETLFTIYKEFATEDEMQSMREKYETGIGWGDVKKELFRVVDRELAGPREKYAMYMNEPNLLYEALEKGAERARTIAKVNLTEIKKRIGFEREH
>NZ_CP047085.1|WP_000845609.1|2391797_2392361_-|maltose-O-acetyltransferase
MKTEKEKMLAGEMYIADDEELVADRVEAKRLTRLYNEAMETGDERRFTLLNQLLGSSADGASHIKPTFRCDYGYNIHIGKNFFSNFNCVILDVCEVRIGDNCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGISIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIDL
>NZ_CP047085.1|WP_000043165.1|2390433_2391462_-|ROK-family-protein
MSKQFVTQKSIKETILRGIRKVLLERGSATKVELSNTLEISFPTISKFIEKMKQDGEVTLAGLDDSSGGRRAKRYEYNPEYMLGLAIFLEKNETNYTIFNCLGEVKEQGSTSSMLIDTGVNVLSKHIEGLIATFPKISSISIGVPGSVDNGRIFYIPGYEKFQNFNLKSHLEEQFSIPVVIENDMNAAVLGYYKNTGNYDNSSLVYLYSGQNGPGAGIMVNGDVVRGSTFFSGEISFVPQYNNKNFLQALRSEDSNNPEEYNIDAITRLIATCIAIINPHAFIFCDDEVNQFVIEQIVKSCPQYIPAEHIPKITVSNWKEDYLYGLKSLGLDLMITRTNKEN
>NZ_CP047085.1|WP_000687552.1|2389991_2390372_-|hypothetical-protein
MKIEHVAIWVNDLEGMRDFYKKYFNGEENSLYHNPKKQFESYFITFEGGARLELMKRVGIEDALQTETIGYAHIAFSVGSKEKVNELTNTLREAGYAVLNGPRTTGDGYYESVVSDPEGNQIEITI
>NZ_CP047085.1|WP_000540488.1|2389482_2389932_+|NUDIX-hydrolase
MGYIEDMRNLVGNQPLILIGSHAIIVNENNEILLQLRTDFNRWGIIGGALEYNETLEDALKREVYEETGLIIKNPELFRTYSGPDFFQIYPNGDQVHGVLVVYICREFHGELVCDQTESKELRFFPLDELPSTLHPVIEGILRHFHHSN
>NZ_CP047085.1|WP_000355457.1|2388625_2389465_+|DUF2785-domain-containing-protein
MDITALQQQLELIQQNDYTQLRHIDINELTLHMLQYIGTTDSYVRYQLIYKCFVHFIHHEFLMDDQLKLLLHTCLSDEYLYCDIYTPHTDGVFTRSYTVSLIALILQFANSHYFFTEEDIEEIKNKLITYTNLETDFRGYIENKGWAHCLAHVSDAFTEIVHNTYTTFEWYEELIHCLLNKIFIPSDLFHNNEDERIVTPLLAMLYHDFPQDELISIIHKKIKRLPQIRKRLSLNEYCILCANIKTFLRTLFFRTKDDHNLAFTARKTERMLKELPNYY
>NZ_CP047085.1|WP_000679170.1|2402021_2402777_-|class-I-SAM-dependent-methyltransferase
MKGTQMIALNKKCWDTVAPYFFQVDCLPKYGPYTASEDEIHLFDSIKGKKVLDIGCGSGHSLQYMAEHGAEELWGLDLSSTQIETAHKTLQSWNPKLICGAMEEERDIPKGYFDIVYSIYALGWTSDLRKTLELIYSYVKPEGSFIFSWEHPVYSNLMYGTKEIAFSSSYHEETPITFETFKGEDVQATLYKRKMSTYINELNRAGFTIERIEEPETSSLFDEELAEPSTKYYSLYKARMVPTTFIIKARK
>NZ_CP047085.1|WP_001072953.1|2402817_2403360_-|CGNR-zinc-finger-domain-containing-protein
MNQNAPNKLEYIREFLNTWRIPNDTREAIDLLQTEEDIKKFMKESFHEELLFHTIEELKSFREDIRAAIEGEGSLQKWLEKYPFHVHIKEDMKGITYEPVYEENVYTKILSIVFISIQENLWGRLKACPDCRWVFYDHSRNGSKRWCGMYAGEEGGRACGTIAKVKNYRAKRKGRTGYNV
>NZ_CP047085.1|WP_000834854.1|2403472_2404672_+|MFS-transporter
MKSFSTPIRFMLISSFFMSFGYFAVYAFLAIYLLTFLHFSAFQVGTVLTVMIITSRVIPLFSGLIADKIGYIIMMVAGLFLRGIGFIALGICSDFYTISISSALIGFGTTFYEPAARAIFGSQPAHLRKNLFTYLNLSFNCGAIIGPIAGGFLLLLDPIYAFSLTGFLMLLFAFIFYLLKNHFQVTTENTSITLGIQAILQNKSFLLFSFIMIFFYIMFTQLTVALPLHMKNISNSNQLATLVITINAITGVIFMVLFRKLFHKYNTLSIIKYGVLLMSISFLLIPLFQHPYWLFICVILFTIGETLVLPNADIAIANYSNESYTATFFGFYQLSLAFGFIIGNYTGTSFTSNLSGVYTPWLIFGGIGLIGFISLHILNTKKDFLKKIYAYCKNTNLQQ
>NZ_CP047085.1|WP_000823782.1|2404825_2405203_+|hypothetical-protein
MKRKLLVLLFTGIILSGCSTIAENSLETGNASMELLTPTITTKDNELEIKTEGIDENKVTFIYVANKKVLEQKLKNGESYKLNIKDIEHAHRTDYKPKVQLLQTKDNNDDGEIVTFKQVRYTVKN
>NZ_CP047085.1|WP_000747692.1|2405278_2405518_+|DUF3923-family-protein
MKKRWISWWIGNLFWIIVFGIWAAIIWLRDVDGAGVIQTPEIKSLSLIVILIAFIIPVFFQVIWLIINLRMSKKNNYTI
>NZ_CP047085.1|WP_000938439.1|2405615_2406164_-|DUF2179-domain-containing-protein
MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMNIVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGINSIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHHAS
>NZ_CP047085.1|WP_000616837.1|2406363_2406777_-|ATP-synthase-subunit-I
MIQVALRVYRLQLYVIFSGLLLMWTITPFGKQVTGFGIGLAVSAYCLWLLARRVEKLGKSIVMKEKAPGLGVLNRFAAAILGAIIMYEIEHEMEMWAFGTGILGGHFLMIANLAYANMQVVKEEEKKREHASKNIEL
>NZ_CP047085.1|WP_000402268.1|2406829_2408158_-|HlyC/CorC-family-transporter
MEIFNLVMVAILIAFTGFFVAAEFAIVKVRSSRIDQLVAEGKRGALAAKKVTTNLDEYLSACQLGITVTAMGLGWLGEPTIEKLLHPLFEKWNLNPSISSVLTFGLAFMIMTYLHVVVGELAPKTMAIQKAEKVTLLLAGPLMMFYKVMYPFIWVLNGSARVVTGLFGLKPASEHEVAHTEEELRLILSDSYESGEINQAEYKYVNNIFEFDNRIAKEIMVPRTEIVGFYLEDSVEEHMKVIQNERYTRYPIFGEDKDDIIGMVNVKDFFIRYMTEDQKDLSSIRSYMRPIIEVMETTPIHDLLLQMQKKRIPMAVLYDEYGGTAGIVTLEDILEEIVGEIRDEYDEDEAPPIQHVNEQHIIVDGKVLISEVKDLFGLHIEEDDVDTIGGWIMMQNHEIEEGQHVEAEGYEFKVLEKDAYQIKRVEIRKMEQEQEEEKAATV
>NZ_CP047085.1|WP_000285637.1|2408277_2408685_-|MerR-family-transcriptional-regulator
MYRIGQLALMAHVSKRTIDYYTNLGILKAERSQSNYRYYDETAFETLQFIEKCKEMHMPLCEIKEKIEEKKKLLGINEHVSKQVNEVTDHIHRLEAELTELKPLLDGLTDSQREKISKSLSGQTTALIQTLALLL
>NZ_CP047085.1|WP_002028078.1|2408960_2409755_+|glycosyltransferase-family-2-protein
MLLEEIKITKTIISHFYNEEYLLPWWLMHHTKIFDHGILINRGSTDRSVEICKLFAPHWEVRDSRFLEFDPTNTDIEVMEIEREVSGWKMVLNTTEFLCCNNVEEFFSSLHTLGQNMYAIRMIVMIDKHDYNYSKLRYSIPLVEQRYHGLFPYNPAIGCAWRFIHNHLDGAYLPGRHFTRHQPIVYNFPSFIFKFYFSPWNEHTKARKLQITPTLSKKGVRLGLQKQYGRSSEELEARFLTLTNATQDLRNHPEYQQLFPKFKP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP047085_1	1.3\|504926\|17\|NZ_CP047085\|CRISPRCasFinder	504926-504942	17	NZ_CP047085.1	1382769-1382785	1	0.941
NZ_CP047085_3	3.2\|2397751\|19\|NZ_CP047085\|CRISPRCasFinder	2397751-2397769	19	NZ_CP047085.1	2399119-2399137	1	0.947
NZ_CP047085_3	3.3\|2397796\|19\|NZ_CP047085\|CRISPRCasFinder	2397796-2397814	19	NZ_CP047085.1	3749865-3749883	1	0.947
NZ_CP047085_3	3.2\|2397751\|19\|NZ_CP047085\|CRISPRCasFinder	2397751-2397769	19	NZ_CP047085.1	511111-511129	2	0.895

1. spacer 1.3|504926|17|NZ_CP047085|CRISPRCasFinder matches to position: 1382769-1382785, mismatch: 1, identity: 0.941

aaagaaccttttgcatg	CRISPR spacer
aaaggaccttttgcatg	Protospacer
****.************

2. spacer 3.2|2397751|19|NZ_CP047085|CRISPRCasFinder matches to position: 2399119-2399137, mismatch: 1, identity: 0.947

agttgggccggttggacca	CRISPR spacer
agttgggccagttggacca	Protospacer
*********.*********

3. spacer 3.3|2397796|19|NZ_CP047085|CRISPRCasFinder matches to position: 3749865-3749883, mismatch: 1, identity: 0.947

ttgaatgccctgtggaccg	CRISPR spacer
ttgaataccctgtggaccg	Protospacer
******.************

4. spacer 3.2|2397751|19|NZ_CP047085|CRISPRCasFinder matches to position: 511111-511129, mismatch: 2, identity: 0.895

agttgggccggttggacca	CRISPR spacer
agttggcccggttggtcca	Protospacer
****** ******** ***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1308454 : 1353552

Bacillus_phage(94.64%)

portal,head,capsid,tail,terminase,integrase,protease

attL 1343478:1343493|attR 1348557:1348572

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000588613.1\|1308454_1309624_+	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	2.2e-41	29.6
WP_000581460.1\|1309747_1309933_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_000803132.1\|1311413_1312607_+	helix-turn-helix transcriptional regulator	A0A0U3TNF6	Bacillus_phage	2.6e-215	100.0
WP_000481767.1\|1313015_1313369_-	helix-turn-helix transcriptional regulator	A0A0U3SD25	Bacillus_phage	3.9e-58	100.0
WP_000854265.1\|1313570_1313756_+	helix-turn-helix transcriptional regulator	A0A0U3SLC2	Bacillus_phage	3.7e-28	100.0
WP_033670234.1\|1313911_1314187_+	helix-turn-helix domain-containing protein	A0A0U3ULL9	Bacillus_phage	1.4e-42	100.0
WP_001151930.1\|1314617_1315502_+	hypothetical protein	A0A0U3TZZ4	Bacillus_phage	4.9e-150	100.0
WP_001171109.1\|1315516_1316431_+	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	2.0e-170	100.0
WP_000338031.1\|1316443_1316638_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	5.9e-24	82.8
WP_000799086.1\|1316654_1316933_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.9e-14	62.7
WP_001125952.1\|1316925_1317285_+	hypothetical protein	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
WP_000717826.1\|1317303_1317471_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
WP_000109486.1\|1317496_1317748_+	hypothetical protein	A0A1B1P7W1	Bacillus_phage	2.6e-16	51.3
WP_001102009.1\|1317767_1318250_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	8.9e-21	49.5
WP_000397935.1\|1318452_1318722_+	hypothetical protein	D2XR50	Bacillus_phage	2.4e-44	100.0
WP_001030638.1\|1318882_1319428_+	hypothetical protein	A0A2I6UHP6	Bacillus_phage	1.8e-41	53.6
WP_001002761.1\|1319455_1320130_+	hypothetical protein	D2XR52	Bacillus_phage	2.3e-131	100.0
WP_002163432.1\|1320241_1320445_+	hypothetical protein	B5LPP0	Bacillus_virus	3.7e-29	100.0
WP_015992803.1\|1320481_1320880_+	hypothetical protein	A0A1B1P7V7	Bacillus_phage	2.3e-75	100.0
WP_001216585.1\|1321196_1321418_+	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
WP_000243721.1\|1321943_1322663_+	hypothetical protein	D2XR55	Bacillus_phage	1.8e-134	100.0
WP_000678894.1\|1322701_1322965_+	hypothetical protein	A0A0U3K3K8	Bacillus_phage	1.8e-39	100.0
WP_000033083.1\|1323187_1323436_+	helix-turn-helix transcriptional regulator	A0A0U3J7D7	Bacillus_phage	8.8e-41	100.0
WP_001061241.1\|1323758_1323890_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	4.8e-14	97.7
WP_001209121.1\|1324188_1324662_+	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.0e-82	100.0
WP_001055139.1\|1324658_1325201_+\|integrase	tyrosine-type recombinase/integrase	A0A1B1P7Y2	Bacillus_phage	5.5e-96	100.0
WP_000443968.1\|1325801_1326176_+	hypothetical protein	A0A0A7AQ61	Bacillus_phage	1.2e-38	85.4
WP_000002729.1\|1326168_1326423_+	hypothetical protein	W8CZ42	Bacillus_phage	1.6e-05	64.6
WP_000761540.1\|1326446_1326659_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.1e-28	95.7
WP_001992786.1\|1327104_1327320_+	endonuclease	A0A1B1P8D2	Bacillus_phage	3.1e-34	98.6
WP_000357495.1\|1327479_1327860_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
WP_000633618.1\|1327840_1329613_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	99.5
WP_001992836.1\|1329672_1330842_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	2.9e-227	99.7
WP_001107318.1\|1330819_1331575_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	9.6e-139	99.6
WP_159109344.1\|1331571_1332816_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	2.2e-204	91.8
WP_033679183.1\|1332874_1333093_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
WP_000891191.1\|1333101_1333377_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	8.0e-43	98.9
WP_001069940.1\|1333363_1333711_+\|head	phage head closure protein	A0A1B1P7T4	Bacillus_phage	8.2e-61	99.1
WP_000852722.1\|1333698_1334136_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	1.2e-77	100.0
WP_001211423.1\|1334132_1334492_+	hypothetical protein	A0A1B1P7S7	Bacillus_phage	2.8e-64	99.2
WP_000952020.1\|1334505_1335090_+\|tail	tail protein	A0A1B1P7S4	Bacillus_phage	5.2e-108	100.0
WP_001157384.1\|1335149_1335545_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	3.9e-59	100.0
WP_000938712.1\|1335562_1335703_+	hypothetical protein	A0A1B1P7R9	Bacillus_phage	1.5e-18	100.0
WP_159109345.1\|1335718_1340101_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	99.2
WP_033670344.1\|1340121_1340733_+	hypothetical protein	A0A1B1P7S6	Bacillus_phage	8.1e-112	100.0
WP_000094085.1\|1340769_1342242_+\|tail	phage tail protein	H0USX4	Bacillus_phage	2.2e-232	78.7
1343478:1343493	attL	NA	NA	NA	NA
WP_000434602.1\|1346388_1347084_+	hypothetical protein	D2XR29	Bacillus_phage	1.8e-123	99.6
WP_000822837.1\|1347291_1348251_+\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	5.5e-171	93.1
WP_000151211.1\|1348265_1348547_+	hypothetical protein	D2XR31	Bacillus_phage	1.2e-41	100.0
WP_000159644.1\|1348549_1348756_+	hypothetical protein	D2XR32	Bacillus_phage	1.6e-32	98.5
1348557:1348572	attR	NA	NA	NA	NA
WP_000542512.1\|1348755_1349565_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	5.4e-164	100.0
WP_000340446.1\|1349620_1349827_-	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	8.4e-29	100.0
WP_000427397.1\|1350131_1350524_+	hypothetical protein	A0A1B1P7T3	Bacillus_phage	6.9e-72	100.0
WP_000488699.1\|1350536_1350863_+	hypothetical protein	A0A1B1P7T1	Bacillus_phage	2.7e-53	100.0
WP_002027563.1\|1350872_1352030_+	DNA translocase FtsK	A0A1B1P7T5	Bacillus_phage	6.3e-222	100.0
WP_012580673.1\|1352034_1352670_+	hypothetical protein	A0A0U3J2H0	Bacillus_phage	4.2e-119	99.5
WP_001287580.1\|1352690_1352906_+	hypothetical protein	A0A0U3TKC9	Bacillus_phage	4.1e-34	100.0
WP_000473087.1\|1352958_1353552_-	hypothetical protein	A0A0U3TZ58	Bacillus_phage	5.9e-99	100.0

DBSCAN-SWA_2

1889162 : 1897505

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000795732.1\|1889162_1890530_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.4e-20	38.1
WP_000124904.1\|1890887_1892081_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	4.8e-07	26.8
WP_001058134.1\|1892166_1892847_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	1.7e-30	38.2
WP_000720544.1\|1892993_1893497_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
WP_001093431.1\|1893518_1893905_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655489.1\|1893970_1894678_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.0e-16	26.5
WP_000648514.1\|1894699_1895053_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288952.1\|1895066_1895474_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714650.1\|1895904_1897290_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.9
WP_000820162.1\|1897292_1897505_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4

DBSCAN-SWA_3

2945246 : 3026258

Bacillus_phage(58.82%)

portal,head,transposase,capsid,plate,tRNA,tail,terminase,holin,integrase,protease

attL 2995909:2995925|attR 3024208:3024224

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000455936.1\|2945246_2948012_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	7.0e-86	27.1
WP_001131612.1\|2948359_2948866_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000029725.1\|2948955_2949723_-	RNA-binding protein	NA	NA	NA	NA
WP_000450919.1\|2949738_2950002_-	YggT family protein	NA	NA	NA	NA
WP_000119138.1\|2950008_2950479_-	cell division protein SepF	NA	NA	NA	NA
WP_000218169.1\|2950498_2951173_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209000.1\|2951169_2951988_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_001993471.1\|2952106_2952391_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000976948.1\|2953494_2954214_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000261978.1\|2954233_2955151_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888991.1\|2955466_2956621_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087555.1\|2956660_2957968_-	cell division protein FtsA	NA	NA	NA	NA
WP_000437043.1\|2959236_2960142_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265415.1\|2960203_2961298_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|2961402_2962494_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860123.1\|2962584_2963937_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893058.1\|2963937_2964912_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_063246744.1\|2964934_2966410_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266227.1\|2966618_2968535_-	stage V sporulation protein D	NA	NA	NA	NA
WP_000600097.1\|2968616_2970716_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067081.1\|2970788_2971151_-	cell division protein FtsL	NA	NA	NA	NA
WP_000403053.1\|2972466_2974083_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000782393.1\|2974162_2975053_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506707.1\|2975346_2975820_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246478.1\|2975854_2976361_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
WP_001984764.1\|2976490_2976664_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872145.1\|2976725_2977226_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_000571542.1\|2978057_2979242_-	cell division protein FtsK	H0USY1	Bacillus_phage	2.4e-144	62.8
WP_000156986.1\|2979359_2979542_-	hypothetical protein	A0A288WGN6	Bacillus_phage	2.4e-19	78.3
WP_001267642.1\|2979538_2979841_-	hypothetical protein	H0USY0	Bacillus_phage	3.1e-24	54.6
WP_001237237.1\|2980025_2980247_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.0e-27	89.0
WP_000277067.1\|2980239_2980731_+	hypothetical protein	Q3HL01	Bacillus_phage	1.0e-64	85.9
WP_000501729.1\|2980768_2981554_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	6.1e-35	83.1
WP_000787573.1\|2981570_2981801_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.4e-32	94.7
WP_001115042.1\|2981843_2982083_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_000822821.1\|2982098_2983058_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	2.7e-170	91.8
WP_000323294.1\|2983301_2983919_-	hypothetical protein	A0A1B1P882	Bacillus_phage	3.7e-72	76.5
WP_001103319.1\|2983931_2984369_-	hypothetical protein	A0A1B1P8A7	Bacillus_phage	1.3e-79	100.0
WP_000143306.1\|2984410_2985904_-\|plate	BppU family phage baseplate upper protein	A0A1B1P899	Bacillus_phage	6.5e-280	99.4
WP_000587965.1\|2985949_2987071_-	hypothetical protein	A0A0K2CZQ1	Paenibacillus_phage	1.2e-57	38.1
WP_001231933.1\|2987948_2988821_-\|tail	phage tail family protein	NA	NA	NA	NA
WP_001173496.1\|2988817_2993800_-\|tail	phage tail protein	A0A2H4JI37	uncultured_Caudovirales_phage	0.0e+00	78.2
WP_000705185.1\|2993963_2994338_-	hypothetical protein	A0A2H4JBU8	uncultured_Caudovirales_phage	2.3e-53	83.9
WP_001251817.1\|2994399_2994972_-\|tail	tail protein	A0A2H4JET9	uncultured_Caudovirales_phage	8.2e-98	95.1
WP_001243514.1\|2994987_2995350_-	DUF3168 domain-containing protein	A0A2H4JBW1	uncultured_Caudovirales_phage	3.0e-53	82.5
WP_000818811.1\|2995346_2995784_-	hypothetical protein	A0A2H4JBV5	uncultured_Caudovirales_phage	8.0e-61	75.9
WP_001068033.1\|2995771_2996116_-\|head	phage head closure protein	A0A2H4JHA9	uncultured_Caudovirales_phage	1.1e-44	73.7
2995909:2995925	attL	NA	NA	NA	NA
WP_000923266.1\|2996112_2996406_-\|head,tail	phage gp6-like head-tail connector protein	A0A0A7S0C9	Clostridium_phage	3.5e-12	38.5
WP_001123700.1\|2996445_2997603_-\|capsid	phage major capsid protein	A0A2H4JHG1	uncultured_Caudovirales_phage	2.3e-123	62.3
WP_000383975.1\|2997640_2998333_-\|protease	Clp protease ClpP	A0A0A7RTN2	Clostridium_phage	9.3e-72	59.7
WP_000266102.1\|2998313_2999555_-\|portal	phage portal protein	A6M949	Geobacillus_virus	1.8e-121	52.4
WP_001082758.1\|2999568_3001284_-\|terminase	terminase large subunit	A0A0A7RVS5	Clostridium_phage	4.5e-216	63.0
WP_000113653.1\|3001293_3001815_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.5e-53	64.9
WP_000924769.1\|3001914_3002328_-	HNH endonuclease	A0A0A7RUV1	Clostridium_phage	4.6e-26	47.1
WP_002028205.1\|3002318_3002573_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.6e-16	57.7
WP_001012120.1\|3003321_3003864_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.5e-88	91.1
WP_000166157.1\|3003863_3004346_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.4e-73	83.1
WP_000645586.1\|3004658_3004781_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_000937293.1\|3004798_3005128_-	hypothetical protein	NA	NA	NA	NA
WP_000273554.1\|3005604_3005982_-	hypothetical protein	A0A0S2MVH4	Bacillus_phage	1.6e-33	80.5
WP_014297965.1\|3006019_3006217_-	hypothetical protein	A0A1B1P864	Bacillus_phage	2.4e-25	86.2
WP_000181717.1\|3006924_3007431_-	hypothetical protein	A0A0M4RU27	Bacillus_phage	1.6e-81	83.3
WP_001208936.1\|3007654_3008053_-	hypothetical protein	Q5YA89	Bacillus_phage	3.5e-31	52.7
WP_000866997.1\|3008443_3008926_-	nucleoside triphosphate pyrophosphohydrolase family protein	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
WP_000885283.1\|3008941_3009361_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	7.0e-14	41.9
WP_000811864.1\|3009373_3009628_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	8.2e-42	98.8
WP_000805174.1\|3009642_3009816_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_000338030.1\|3009841_3010036_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.5e-24	84.4
WP_014297966.1\|3010050_3010854_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.5e-145	98.9
WP_001060046.1\|3010822_3011695_-	DnaD domain protein	W8CYG5	Bacillus_phage	1.6e-57	45.5
WP_000364154.1\|3011691_3011877_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	4.6e-18	69.0
WP_000284333.1\|3012127_3012328_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
WP_000516834.1\|3012379_3012607_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000153813.1\|3012825_3013194_+	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-09	38.7
WP_001045402.1\|3013618_3014716_-	hypothetical protein	NA	NA	NA	NA
WP_001091274.1\|3015151_3015496_+	helix-turn-helix transcriptional regulator	A8ASM2	Listeria_phage	1.7e-05	27.8
WP_000833167.1\|3015585_3015765_-	hypothetical protein	NA	NA	NA	NA
WP_001199342.1\|3016281_3017121_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_000323190.1\|3017403_3018534_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	3.3e-66	39.3
WP_080001948.1\|3018683_3019910_+	nucleotidyltransferase	NA	NA	NA	NA
WP_000476307.1\|3019939_3020962_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_000662598.1\|3020954_3021746_-	esterase	A0A1V0SCG0	Catovirus	3.1e-10	29.0
WP_000273097.1\|3021859_3023089_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
WP_000200598.1\|3023080_3023572_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.5e-27	42.9
WP_001266987.1\|3023568_3024135_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_153576963.1\|3024429_3024594_-	hypothetical protein	NA	NA	NA	NA
3024208:3024224	attR	NA	NA	NA	NA
WP_000616011.1\|3024638_3025028_+	hypothetical protein	NA	NA	NA	NA
WP_085962608.1\|3025101_3026258_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7

DBSCAN-SWA_4

3963053 : 4018911

Bacillus_virus(16.67%)

coat,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002028770.1\|3963053_3963869_+\|protease	YhfC family intramembrane metalloprotease	NA	NA	NA	NA
WP_000738184.1\|3963891_3964335_-	hypothetical protein	NA	NA	NA	NA
WP_000721019.1\|3964467_3965022_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_000272743.1\|3965096_3965576_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_000166370.1\|3965596_3966493_-	lipoyl synthase	NA	NA	NA	NA
WP_002163411.1\|3967701_3968433_-	sporulation protein YunB	NA	NA	NA	NA
WP_000248463.1\|3968487_3968790_-	DUF1805 domain-containing protein	NA	NA	NA	NA
WP_079994036.1\|3968855_3970247_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_001118823.1\|3970930_3972328_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_000009523.1\|3972376_3972808_-	iron-sulfur cluster assembly scaffold protein SufU	A0A0K1LS29	Mycobacterium_phage	1.5e-14	37.6
WP_001020770.1\|3972797_3974018_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	1.4e-118	47.6
WP_000152163.1\|3974017_3975310_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_000929157.1\|3975325_3976111_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	7.5e-09	25.8
WP_000722401.1\|3976349_3977156_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000735091.1\|3977228_3978041_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_000359556.1\|3978064_3978730_-	ABC transporter permease	NA	NA	NA	NA
WP_000601758.1\|3978722_3979748_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.6e-27	32.4
WP_000424933.1\|3980280_3980625_-	hypothetical protein	NA	NA	NA	NA
WP_000568169.1\|3980777_3981077_-	thioredoxin family protein	NA	NA	NA	NA
WP_000640869.1\|3981089_3981434_-	DNA primase	NA	NA	NA	NA
WP_000026900.1\|3981933_3982317_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_000218967.1\|3982358_3982724_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.7e-21	48.6
WP_001224771.1\|3983452_3983824_-	hypothetical protein	NA	NA	NA	NA
WP_012644684.1\|3983941_3984205_-	DUF3937 domain-containing protein	NA	NA	NA	NA
WP_000826889.1\|3984437_3984965_-	hypothetical protein	NA	NA	NA	NA
WP_000713747.1\|3985108_3985756_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_000666170.1\|3985812_3986826_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_123805757.1\|3986848_3988048_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_001002987.1\|3988044_3988293_-\|coat	spore coat protein	NA	NA	NA	NA
WP_001180555.1\|3988306_3988492_-	hypothetical protein	NA	NA	NA	NA
WP_000005487.1\|3988638_3989352_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_000029292.1\|3989771_3990059_-	DUF2178 domain-containing protein	NA	NA	NA	NA
WP_000813827.1\|3990055_3990283_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	3.4e-07	45.6
WP_000457312.1\|3990463_3991030_-	hypothetical protein	NA	NA	NA	NA
WP_000074903.1\|3991128_3991686_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_001242590.1\|3991689_3992412_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	2.5e-11	31.4
WP_000416296.1\|3992619_3994404_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_002028756.1\|3994477_3994660_-	hypothetical protein	NA	NA	NA	NA
WP_097648785.1\|3994791_3995964_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_000486345.1\|3995985_3998367_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_001096348.1\|3998602_3998737_+	YuzL family protein	NA	NA	NA	NA
WP_000436772.1\|3999848_4000766_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.0e-65	43.9
WP_001290594.1\|4001076_4001322_-	YusU family protein	NA	NA	NA	NA
WP_001018862.1\|4001369_4001672_-	MTH1187 family thiamine-binding protein	NA	NA	NA	NA
WP_000946343.1\|4001749_4003750_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-12	51.1
WP_000599349.1\|4003907_4005038_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D2XQ03	Bacillus_virus	4.7e-73	43.2
WP_000939490.1\|4005850_4006609_+	TrmB family transcriptional regulator	NA	NA	NA	NA
WP_000823839.1\|4006639_4008523_-	TQXA domain-containing protein	NA	NA	NA	NA
WP_002028752.1\|4009043_4010228_-	MFS transporter	NA	NA	NA	NA
WP_000736812.1\|4010626_4011334_+	hypothetical protein	NA	NA	NA	NA
WP_000788581.1\|4011401_4012616_+	hypothetical protein	NA	NA	NA	NA
WP_000546319.1\|4012740_4014054_-	amino acid permease	NA	NA	NA	NA
WP_000859063.1\|4014302_4015850_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	D5GVD8	Campylobacter_virus	3.2e-11	26.6
WP_000562242.1\|4016422_4016650_+	hypothetical protein	NA	NA	NA	NA
WP_000730859.1\|4016731_4017547_-	hypothetical protein	NA	NA	NA	NA
WP_085962608.1\|4017755_4018911_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7

DBSCAN-SWA_5

4784706 : 4792653

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|4784706_4784991_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|4785029_4786664_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000743925.1\|4787069_4788608_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.2
WP_000833093.1\|4788992_4790318_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_001262951.1\|4790462_4791164_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719191.1\|4791147_4792653_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.4e-32	31.3

DBSCAN-SWA_6

4838001 : 4846374

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625677.1\|4838001_4839309_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
WP_001170542.1\|4839397_4840117_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278826.1\|4840109_4840364_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|4840360_4841044_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055586.1\|4841027_4843247_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
WP_000879038.1\|4843231_4844647_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
WP_001262449.1\|4844749_4845790_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
WP_000088580.1\|4845786_4846374_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP047086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP047085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection