CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046564	Bacillus sp. N1-1 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL	0	0	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046564_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046564_1

1581380-1581482

Orphan

Consensus_repeat	Method
GTAGAAGAAAAGGCAGAAGCGCCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046564_1

>merge|NZ_CP046564|1|1581380-1581482|CRISPRCasFinder
GTAGAAGAAAAGGAAGAAGCGCCTGAAGCGAAAGCACCGGTAGAAGAAAAGGCAGAAGCGCCTGAAGCGGAAGCACCAGTAGAAGAAAAGACAGAAGCGCCTG

>NZ_CP046564|1|1|1581380-1581482|CRISPRCasFinder
GTAGAAGAAAAGGAAGAAGCGCCTG	AAGCGAAAGCACCGGTAGAAGAAAAGGCAGAAGCGCCTGAAGCGGAAGCACCA
GTAGAAGAAAAGACAGAAGCGCCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046564.1\|WP_159782051.1\|1591595_1592870_-\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP046564.1\|WP_159782037.1\|1573462_1574347_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP046564.1\|WP_159782039.1\|1577891_1578731_+\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP046564.1\|WP_159782035.1\|1571808_1571976_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046564.1\|WP_159782042.1\|1580227_1580782_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP046564.1\|WP_159782038.1\|1574569_1577704_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|223911
NZ_CP046564.1\|WP_159782045.1\|1583182_1584028_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132912
NZ_CP046564.1\|WP_159787322.1\|1587262_1588279_+\|LytR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224235
NZ_CP046564.1\|WP_159782047.1\|1585339_1586992_-\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|236901
NZ_CP046564.1\|WP_159782048.1\|1589246_1590038_-\|GHKL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236901
NZ_CP046564.1\|WP_159782044.1\|1582200_1582887_-\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|132881
NZ_CP046564.1\|WP_159782041.1\|1579350_1580022_-\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
NZ_CP046564.1\|WP_159782046.1\|1584178_1585207_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376935
NZ_CP046564.1\|WP_159782040.1\|1578769_1579105_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131941
NZ_CP046564.1\|WP_159782050.1\|1590652_1591495_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200579
NZ_CP046564.1\|WP_159782049.1\|1590195_1590402_-\|mercuric-reductase	unknown	unknown	gnl\|CDD\|238219
NZ_CP046564.1\|WP_159782036.1\|1572593_1573070_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|235857
NZ_CP046564.1\|WP_159787325.1\|1588401_1589250_+\|YihY-family-inner-membrane-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP046564.1\|WP_159782034.1\|1571532_1571856_+\|Spo0E-family-sporulation-regulatory-protein-aspartic-acid-phosphatase	unknown	unknown	gnl\|CDD\|378175
NZ_CP046564.1\|WP_048310190.1\|1572313_1572556_+\|type-B-50S-ribosomal-protein-L31	unknown	unknown	gnl\|CDD\|234969

Protein	Function_ID	Function_description	E-value
NZ_CP046564.1\|WP_159782051.1\|1591595_1592870_-\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	1.18185e-117
NZ_CP046564.1\|WP_159782037.1\|1573462_1574347_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.18302e-20
NZ_CP046564.1\|WP_159782045.1\|1583182_1584028_-\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	3.68069e-34
NZ_CP046564.1\|WP_159782049.1\|1590195_1590402_-\|mercuric-reductase	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	4.90451e-10
NZ_CP046564.1\|WP_159782042.1\|1580227_1580782_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	1.57623e-50
NZ_CP046564.1\|WP_159782038.1\|1574569_1577704_+\|MMPL-family-transporter	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP046564.1\|WP_159782046.1\|1584178_1585207_-\|hypothetical-protein	gnl\|CDD\|376935	pfam02810, SEC-C, SEC-C motif. The SEC-C motif found in the C-terminus of the SecA protein, in the middle of some SWI2 ATPases and also solo in several proteins. The motif is predicted to chelate zinc with the CXC and C[HC] pairs that constitute the most conserved feature of the motif. It is predicted to be a potential nucleic acid binding domain.	1.38941e-12
NZ_CP046564.1\|WP_159787322.1\|1587262_1588279_+\|LytR-family-transcriptional-regulator	gnl\|CDD\|224235	COG1316, LytR, Transcriptional regulator [Transcription].	5.12051e-79
NZ_CP046564.1\|WP_159782047.1\|1585339_1586992_-\|PAS-domain-S-box-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	3.59319e-79
NZ_CP046564.1\|WP_159782048.1\|1589246_1590038_-\|GHKL-domain-containing-protein	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	3.36638e-50
NZ_CP046564.1\|WP_159782044.1\|1582200_1582887_-\|DNA-alkylation-repair-protein	gnl\|CDD\|132881	cd07064, AlkD_like_1, A new structural DNA glycosylase containing HEAT-like repeats. This domain represents a new and uncharacterized structural superfamily of DNA glycosylases that form an alpha-alpha superhelix fold that are not belong to the identified five structural DNA glycosylase superfamilies (UDG, AAG/MNPG, MutM/Fpg and helix-hairpin-helix). DNA glycosylases removing alkylated base residues have been identified in all organisms investigated and may be universally present in nature. DNA glycosylases catalyze the first step in Base Excision Repair (BER) pathway by cleaving damaged DNA bases within double strand DNA to produce an abasic site. The resulting abasic site is further processed by AP endonuclease, phosphodiesterase, DNA polymerases, and DNA ligase functions to restore the DNA to an undamaged state. All glycosylase examined to date utilize a similar strategy for binding DNA and base flipping despite their structural diversity. The known structures for members of this family, AlkC and AlkD from Bacillus cereus, are distant homologues and are composed of six variant HEAT (Huntington/Elongation/ A subunit/Target of rapamycin) repeats. HEAT motifs are ~45-amino acid sequences that form antiparallel alpha-helices, which are packed by a conserved hyrophobic interface and are tandemly repeated to form superhelical alpha-structures. AlkD and AlkC are specific for removal of 3-methyladenine (3mA) and 7-methylguanine (7mG) from the DNA by base excision repair. Homologues of AlkC and AlkD were also identified in other organisms.	5.16393e-89
NZ_CP046564.1\|WP_159782041.1\|1579350_1580022_-\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.2311e-71
NZ_CP046564.1\|WP_048310190.1\|1572313_1572556_+\|type-B-50S-ribosomal-protein-L31	gnl\|CDD\|234969	PRK01678, rpmE2, type B 50S ribosomal protein L31.	4.91691e-52
NZ_CP046564.1\|WP_159782040.1\|1578769_1579105_-\|hypothetical-protein	gnl\|CDD\|131941	TIGR02895, RNA_polymerase_sigma_factor, RNA polymerase sigma-I factor. Members of this sigma factor protein family are strictly limited to endospore-forming species in the Firmicutes lineage of bacteria, but are not universally present among such species. Sigma-I was shown to be induced by heat shock () in Bacillus subtilis and is suggested by its phylogenetic profile to be connected to the program of sporulation (). [Transcription, Transcription factors, Cellular processes, Sporulation and germination].	6.55891e-11
NZ_CP046564.1\|WP_159782050.1\|1590652_1591495_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200579	cd10955, CE4_BH0857_like, Putative catalytic NodB homology domain of uncharacterized BH0857 protein from Bacillus halodurans and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase BH0857 from Bacillus halodurans. Although its biological function still remains unknown, BH0857 shows high sequence homology to the catalytic NodB homology domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both BH0857 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	2.7408e-88
NZ_CP046564.1\|WP_159782036.1\|1572593_1573070_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|235857	PRK06759, PRK06759, RNA polymerase factor sigma-70; Validated.	5.98628e-26
NZ_CP046564.1\|WP_159787325.1\|1588401_1589250_+\|YihY-family-inner-membrane-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	8.99491e-66
NZ_CP046564.1\|WP_159782034.1\|1571532_1571856_+\|Spo0E-family-sporulation-regulatory-protein-aspartic-acid-phosphatase	gnl\|CDD\|378175	pfam09388, SpoOE-like, Spo0E like sporulation regulatory protein. Spore formation is an extreme response to starvation and can also be a component of disease transmission. Sporulation is controlled by an expanded two-component system where starvation signals result in sensor kinase activation and phosphorylation of the master sporulation response regulator Spo0A. Phosphatases such as Spo0E dephosphorylate Spo0A thereby inhibiting sporulation. This is a family of Spo0E-like phosphatases. The structure of a Bacillus anthracis member of this family has revealed an anti-parallel alpha-helical structure.	1.36709e-06
NZ_CP046564.1\|WP_159782039.1\|1577891_1578731_+\|STAS-domain-containing-protein	gnl\|CDD\|132912	cd07041, STAS_RsbR_RsbS_like, Sulphate Transporter and Anti-Sigma factor antagonist domain of the "stressosome" complex proteins RsbS and RsbR, regulators of the bacterial stress activated alternative sigma factor sigma-B by phosphorylation. The STAS (Sulphate Transporter and Anti-Sigma factor antagonist) domain of proteins related to RsbS and RsbR which are part of the "stressosome" complex that plays an important role in the regulation of the bacterial stress activated alternative sigma factor sigma-B. During stress conditions RsbS and RsbR are phosphorylated which leads to the release of RsbT, an activator of of the RsbU phosphatase, which in turn activates RsbV which leads to the release and activation of sigma factor B. RsbS is a single domain protein (STAS domain), while RsbR-like proteins have a well-conserved C-terminal STATS domain and a variable N-terminal domain. The STAS domain is also found in the C- terminal region of sulphate transporters and anti-anti-sigma factors.	3.59499e-39

>NZ_CP046564.1|WP_159782042.1|1580227_1580782_+|signal-peptidase-I
MKSDGESNWLKDWGAPLLFAIILAFVVKMFVMAPYIVEGASMDPTLHDGDRLLVNKFISYVQESPERGDIIIIKDVDAKKHYVKRVIGLPGDIVEMKHDKLYVNETELKEPYLDANRDDAKTMGMRLTEDFGPVEVPEGQLFVMGDNRLRSMDSRNGLGKIELEEVVGKAEVVWYPFQDVRPTK
>NZ_CP046564.1|WP_159782041.1|1579350_1580022_-|haloacid-dehalogenase-type-II
MSQAKAFVFDAYGTLFDVFSVTKKCEELYPNKGDQISQTWRKKQLEYSYLRQMMGNYQPFSQVTRDALRYAVKEAGAELTQDNEEVLFEAYQQLSVYEEVPQVLKDLKAEGITLAIFSNGSHDMLDPLVKQSPLAKYLDYVISADDIKQFKPTPASYNHALNFLELSRENILFMSSNGWDISGAKNFGFHTAWINRNDLPVEQLNLHPDSIYADLSNLTNWVK
>NZ_CP046564.1|WP_159782040.1|1578769_1579105_-|hypothetical-protein
MIKVDYLLQNEIIRYQEQLRLFRISLVKLPDKMPSEDNVRNLCKEAAWKLAASETLVVKIFKSKKLPYRELSKQFFFNIGILKQHSHYILALFLLKYGDYQCLHTHLTCLV
>NZ_CP046564.1|WP_159782039.1|1577891_1578731_+|STAS-domain-containing-protein
MDKVETMYVEYFHERLEEIGEKWTRRLQILVDEKEATDTAVLKVPELKKEIILFCSDFVKQMIFQKSNSRDVQEWAGRIVEIFSSHTFSLQQSVASLTYLRQILWDVMVEFSSEQKHIEASRLAGWGSYMNKSFDLLLHKVTVYTNQLNEEQIAAQQTKITELSVPIIPIAKDIGVLPLIGTIDTYRASLIQRKGIERSSELQLSYLVIDLSGVPIMDTMVANEIFQLIKMLELSGVESILTGIRPEIAQTAVQLGIDFTNVNTYAHLHQALRAILPSS
>NZ_CP046564.1|WP_159782038.1|1574569_1577704_+|MMPL-family-transporter
MRKLIQFSLNNKFAVWLLTIIITVAGLYSGFNMKMETIPNINTPLVSVTTVYPGATPEEVSEKVSEPIENKVESLSGVNVVSSSSFENASNVQIEYNFSKNMDEAEDEVRETLQSLSLPDEVQDPNVSRLSFNAFPVMSLSVSEDESSLTELTQRVEEDVLPAIEGVEGVSSVSIAGQEVEEISFSFKEDKMKKLGLDEETVKNLIKGSSVNIPLGLYNFEDNQKAVVVDGNVSSLEDLKELEIPAMPQQSQSEDQAPSSAGAPQDPSASQAGGGQPKIPTVQLQEIADIELVGEAESISRTNGKESIGIQVTKSADANTVDVVNGVKDEIASLEDENNEMSIVTIFDQGEPIEESVSTMLNKAIIGAIFAVLIILLFLRNIRSTLISVISIPLSLLIALLVLNQLDITLNIMTLGAMTVAIGRVVDDSIVVIENIYRRMAIKGEQLKGKELITEATKEMFLPIMSSTIVTIAVFLPLGLVQGPVGELFLPFALTIVFALLASLLVAITIVPAMAHSLFKKGLVKKGKEPEHKEEGNGRLAHQYKKILNWTLNHKLITFGASILVLVGSLFLAPIVGVSFLPSDQEKMIVATYNPEPGETTENINNLALEAEDYFLDKEDVDTIQYSVGGENPMNPGASNQVLFFVSYDEETEGFEDERKLVLEDLKQLSEKGEWGYQDISASGGSNQITLVVNGENMGDLGPVVEDVTAVLEKEDDLSNISSSISESYDQFTIVANAEKLSEFGLTAGQIGMELRNTGEAPVLTTVEKDGEALNVVLQVNEKTFEDKSDLEETTIQSPLGIEVPLSDVTTIEEGQSSNTITRRDGKVYANVTAEVLDDNIGQVSADVQEAIDEMDLPDSSEVTLGGVTQDINESFTQLGLAMLAAIAIVYLVLVITFGGGLAPLAILFSLPFTVIGGLVGLLIAGETISISSLIGMLMLIGIVVTNAIVLIDRVIHKEKEGFTTREALIEAAGTRLRPILMTALATIGALAPLAFGLEGGALISKGLGVTVIGGLTSSTLLTLIIVPVVYEFFMKFRKKPKSE
>NZ_CP046564.1|WP_159782037.1|1573462_1574347_-|TetR-family-transcriptional-regulator
MNEKKKQILEAAMQLFARKGFHSTSIQEIANESGISKGAVYLHFQSKDDVLYSIFSYYYEILKKKLSDAKLDSFTPEERLEKLLYVQAQEIVQHKEFIIMQFREQAISMNKEIDELILKIRMESIQTLASSIQDLYGERVTPILPDCVLLLDGMFSSYIKLIVLQNADFDLEELPRFILKRLNDMVNGMFESNAEPFLTMKQASVIFEKSSQTEGCQKQSPSSILTNMASTIKTMRVKENKRKELLETVHFLMKEVNEPNPRRFIFKGMLHQFEGFTELNSYKTALVNSLNLDQ
>NZ_CP046564.1|WP_159782036.1|1572593_1573070_-|sigma-70-family-RNA-polymerase-sigma-factor
MQDISFEKIVKDYSPLVKSQIYKLNLTMNYPLYEQAAMIALWECVQNYQDSKGSFSAYAYLKVRGKLLDERRKELRASKESSHVDWNDYEETFFTPQNSVTLNIDLNSLTMNQRKWVEQVIIEGKSLKNVATAEGVSVEAVKSWRKSAITKLRKQFNT
>NZ_CP046564.1|WP_048310190.1|1572313_1572556_+|type-B-50S-ribosomal-protein-L31
MKEGIHPKYQQVVFLDVSTGFKFLTGSTMGSNETIEWEDGSEYPLIKVDISSESHPFYTGQQRFNDAGGRVEKFKKKYNR
>NZ_CP046564.1|WP_159782035.1|1571808_1571976_-|hypothetical-protein
MNDASHEEILLIQQIRDCISEFQNDYPPVVKEAIFHSIQTLTSQLVDGGQTLIRS
>NZ_CP046564.1|WP_159782034.1|1571532_1571856_+|Spo0E-family-sporulation-regulatory-protein-aspartic-acid-phosphatase
MFEYCKERFKKDNQCFCLVLPKAFTSHRIVWIIELVLISREGWRALLYVKQDAKEELLHWIKRKQEEMIEIGTAKGISHKETLQCSQELDDLLTSYQRLTSVNQLRS
>NZ_CP046564.1|WP_159782044.1|1582200_1582887_-|DNA-alkylation-repair-protein
MLTVEKLQEELESFQDKDQAVKMEKYMRNQFPFLGVKTPERRKAVITALGQTREPGFQVIQHLVEQLWLLPEREYQNAALDLLGRVKQFPKDAIALIEQLIVTKSWWDTVDSLAVHSAGNYFKQHPDEIYFISEKWMTSENMWLNRSAILFQNSYKEKTDWPLLKRSILVHSESKEFFIQKAIGWALREYSKTAPSTVKNFIEEYPLAPLSKREASKIIKKNERERQN
>NZ_CP046564.1|WP_159782045.1|1583182_1584028_-|STAS-domain-containing-protein
MTAETPTQKVGSYILEQASEIAQSTYERQRHDLDEADFTNETKLSLTNTTYLVKLIGKSLQQNTTNAMTAIEEFGEESSELVQDENEMIISLIVTVPLIREAIWEAIEPVVEELNMKPRDVIKLPGKIDPLLDQFVYSYGSTYITSNQQLKNKYDSTLEELSTPIIPIIKNLAILPLVGNIDTYRATLIMEKTLEHTRKLQLNHMIIDLSGVVTMDTMVAKHLFDITEALSLMGVQVTLTGISPSISISAVQLGIDLHKLTIKSSLHNALTDLAVLSNPAT
>NZ_CP046564.1|WP_159782046.1|1584178_1585207_-|hypothetical-protein
MQKTKRNDPCPCGSGKKYKKCCMTSESAQDHLEEQLYTQELYTVQAQLVEYAMSHHDQKMVSLANELFTRFDIPKNLEEAYMHGIFPWAIFHQAVNQWNKTIVKEYIQLYSHTFSTEKVKETVNDWRDAYMSIYTVEEVSGNTAVVTELSSNQPISILLHEEVILSKGESLAGILLPVKNGAMPFIELLKIAPDAMQLVEKKLATEDTANNVRSMMQSDFPEILSEIVKHGNGSEETDDSIDMIWSRKEDAEVASLFTEHVSDDFSKEQVQEILHFWKEYIQEEQPSVRKPAIFAASLEYLASKVFDLSISQSALAKKYGTSPSSISSKYKAFHERFTPVLN
>NZ_CP046564.1|WP_159782047.1|1585339_1586992_-|PAS-domain-S-box-protein
MHIKTESIPWIIISSYFLFGSIWILLSDTILYRFSTDFITNKEMGLYKGWFFILLTCIFLYFLLKHLLQKNKEMESQLLESEERYRRLVESSPYAICLLRDGEITYTNQTGLDMAGFHSLSDLYRNRESLVVNQQDQKKIKEILHSIHTNKNEVRETIEYQLLRSNNEIIDVESTLIPITFDNKVMTIIQTRDITERKQAVKELWEAKQLIQAIISASPIATLALDMNANIRLWNPAAEQIFGWHSDEVIGKKSPIVPKDEKDITIPEIIEHGHIVNKEVKRMTKDGSIVHTALSTAPIQDENGQINGIMAAFMDITDKKKTEEALLKTEKLSAVGQLAASVAHEIRNPLTSVKGFIQLLNDDKPFAEKTPFLSIMLSEIDRMDAIIKDLLVLAKPQASHFTYFKVNELLSYVLQLLSTQASLYNITFMKDFTDQDNTLYGEENQLKQVFINLIKNAIEAMPEGGSVTLKTDVKDADIEVTLTDEGVGIPAHKLKTLGEPFYTTKEEGTGLGLLSSFKIIENHHGTIDFISEVGIGTKVTILFPKNSNAS
>NZ_CP046564.1|WP_159787322.1|1587262_1588279_+|LytR-family-transcriptional-regulator
MEPRSRYKPKKKRRGLRITLLLLLFIIVGIGGYGGYLYYKVSSVSDQSLMEPNRGDQSDLRNSAVDIGKDHFSVLLLGVDDEENTSNGRSDSMMVATFNQDDKSMKLLSIPRDSYVEIPGRGMDKITHAHAYGGIDLTIDTVEGLLGIPIDEVVRVNFDAFKTVIDELGGIDVTIDSQLVADQLYKESKGKIDLEVGEQTLNGKEALAFARTRKADSDLKRGQRQMEVITAAMDKVSSLSSIPKYGDVVDRIGENLTMSFTFNEAIGLYPFISKIDTVEKLQLTGTDFQPAGTYYFKLDDQSLATAKTELKSHLNLEDQNNDPNGNMNALDGEQGETP
>NZ_CP046564.1|WP_159787325.1|1588401_1589250_+|YihY-family-inner-membrane-protein
MAGLSFIKKLGKEIGEDRVTSLAAELAYYFMLSIFPLLILILSILPYLSIDKQEAVDFLTKYAPGETGSILQDNVLSIISEPQGGLLTLGILGTIWSASNGMMALMRALNLAYDVEETRSFIKARLLSILLTIGLVLVFIVTLVLPVFGDVIIDAVTSALNLPSSTEFMFRILRWVVAVAIMACILAALYRFAPNKHFPFKEVIIGALVATLGWQVISLAFAFYISNFGNYSATYGSLGGVIILMLWFYLTGIILLVGGEVNALLHKNKKTSVSSEKEQVGF
>NZ_CP046564.1|WP_159782048.1|1589246_1590038_-|GHKL-domain-containing-protein
MEQPNLNAKEVPKQNILPSVEDYYHKLQQLEALAYENQALTNVHTLVAGVAHEIKNPLTIMKGFLQLIKPDLDKLQKSDIADLLLEEIQRTTDLVEEFLQLARPSELTSERTDLIPFLKNILLLFHSQAKLSKCDLTTNLQQFNLPIEVMINPGQLKQVFLNVMKNSIEAIRMTNRSNGIISLTVGQHLNGVTINIRDNGVGMNASTQSRIFKPFYTTKEKGTGLGLFLSKQIIQNHKGTIKVKSSPLFGTTFSIQLPLLHPV
>NZ_CP046564.1|WP_159782049.1|1590195_1590402_-|mercuric-reductase
MNEMTVSVAGMKGEECIQKIEAALLSLNGIERALADLKEETVTIMFDEEAVDQATIMQTIEEAGYQPA
>NZ_CP046564.1|WP_159782050.1|1590652_1591495_-|polysaccharide-deacetylase-family-protein
MTTVKQTGFILIFFVLLGCQVQQAGNLSLLNESNVKRPVPSFLVENDKEQLIAKYENKTPTEFGENVTGVYTHFSSSKKEISLTFDACGGSHGNGVDEALIAFLKETNLPSTLFINSRWIDQNTALFQELAHDPLFQIENHGTHHKPLSVNGESAWGITGTASVKEVIEEMKENQKKIEELTGETPTLFRSGTAYYDDVAVQIAQDLGVQIVNYTILGDAGATFTAQQVNDALMQAQPGDIALLHMNQPTSGTAEGVKKAIPALQKKGYTFVQLYSQNLQ
>NZ_CP046564.1|WP_159782051.1|1591595_1592870_-|NCS2-family-permease
MKTKINFDFQAHDTSLKKEILAGITSFFTIVYIAAVNASILADAGIPFEAGMIATVLTSVVGCLLIGFYANAPIILVPGMGVNAFFTYTMVESMGLSWEVALASVFVAGILFAITAFTPLSGVLSKAIPRSLKEAITVGIGLFLTFIGLQKGGIVVSSDSTFVALGSLGSAHVIATLATLGLAAILFIRNVKGHFLISMLAGTALAWSLGLIETGQQNNFSFSSYGSVYAAMSFDDILMLPFWIATFSMAMILVFENMGLLTGLLPDQRKFTKSYQANAISAISSGLFGTSPTVSTVESASGISAGGRTGLTAITTGLLFLTSLFFIPIFKIIPDSAIAPVLIIIGGLMITSIQNISLQDFSEGFPAFLIIVMIPLTYSIVDGIAFGFIAYPFLKIALGKGKEVPVPMYIIASLFFINFFLHTI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

312824 : 322565

Synechococcus_phage(37.5%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159780941.1\|312824_314117_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.3e-20	27.3
WP_098446124.1\|314139_314865_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3FUQ7	Synechococcus_phage	7.0e-46	44.7
WP_098446125.1\|314852_315104_+	phosphoribosylformylglycinamidine synthase subunit PurS	A0A1D7SRI3	Cyanophage	4.6e-05	32.5
WP_159780942.1\|315100_315784_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_159780943.1\|315767_317993_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.3e-163	43.0
WP_159780944.1\|317968_319381_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	2.6e-52	32.2
WP_159780945.1\|319396_320437_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	6.1e-67	42.4
WP_159780946.1\|320433_321012_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.7e-31	42.7
WP_159780947.1\|321026_322565_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.3e-73	49.3

DBSCAN-SWA_2

390564 : 396882

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159780993.1\|390564_391170_+	TerD family protein	K4JRX3	Caulobacter_phage	1.6e-22	32.0
WP_159780994.1\|391200_391782_+	chemical-damaging agent resistance protein C	K4JRX3	Caulobacter_phage	5.3e-28	37.9
WP_098446205.1\|391851_392430_+	TerD family protein	K4JRX3	Caulobacter_phage	2.6e-27	35.7
WP_098446206.1\|392464_393244_+	TerC family protein	A0A068EP98	Bacillus_phage	1.2e-80	66.0
WP_159787022.1\|393336_394488_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_159787025.1\|394477_395758_+	hypothetical protein	A0A172Q0Y1	Acinetobacter_phage	2.0e-11	27.0
WP_159787019.1\|395796_396882_+	hypothetical protein	A0A172Q0S8	Acinetobacter_phage	1.6e-38	32.8

DBSCAN-SWA_3

1686224 : 1695164

Enterobacteria_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159782132.1\|1686224_1687265_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	9.2e-23	29.4
WP_159782133.1\|1687270_1688170_-	hypothetical protein	NA	NA	NA	NA
WP_159782134.1\|1688136_1689039_-	hypothetical protein	A0A068CDF3	Rhizobium_phage	4.7e-15	24.1
WP_159782135.1\|1689035_1689857_-	Ku protein	A0A218M9C0	Mycobacterium_phage	3.7e-43	35.8
WP_159782136.1\|1689977_1690847_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	2.0e-55	42.9
WP_159782137.1\|1690990_1692154_+	GHKL domain-containing protein	A0A1V0SGX0	Hokovirus	1.7e-09	27.6
WP_159782138.1\|1692433_1693126_+	thiaminase II	NA	NA	NA	NA
WP_159782139.1\|1693122_1693701_+	thiamine ABC transporter permease	NA	NA	NA	NA
WP_159782140.1\|1693712_1695164_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	1.3e-14	30.5

DBSCAN-SWA_4

2601099 : 2607927

Staphylococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159782892.1\|2601099_2601678_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.8e-13	33.9
WP_159787507.1\|2601674_2602421_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	6.9e-12	44.7
WP_159782893.1\|2602583_2603111_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_159782894.1\|2603141_2603504_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_159782895.1\|2603727_2604198_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.0e-45	61.6
WP_159782896.1\|2604230_2605424_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.8e-108	50.0
WP_159782897.1\|2605447_2606104_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.1e-41	46.2
WP_159782898.1\|2606103_2607186_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.7e-59	36.9
WP_159782899.1\|2607489_2607927_-	peptidylprolyl isomerase	A0A1V0S9I2	Catovirus	3.2e-17	45.2

DBSCAN-SWA_5

3347022 : 3421829

Bacillus_virus(33.33%)

coat,protease,integrase,holin

attL 3366379:3366393|attR 3426764:3426778

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159784178.1\|3347022_3348438_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_159784181.1\|3348575_3349169_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_159787657.1\|3349905_3351474_+	sodium:solute symporter	NA	NA	NA	NA
WP_159784184.1\|3352127_3353807_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	2.3e-60	31.4
WP_159784187.1\|3353982_3355455_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_159784190.1\|3355741_3356293_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_159784193.1\|3356466_3357342_+	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_159784196.1\|3357735_3358467_+	low temperature-induced protein	NA	NA	NA	NA
WP_159784199.1\|3358627_3359653_-	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_159784202.1\|3359815_3361975_-	DUF2157 domain-containing protein	NA	NA	NA	NA
WP_159784205.1\|3362247_3362763_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_159784207.1\|3363012_3364491_-	argininosuccinate lyase	NA	NA	NA	NA
WP_159784210.1\|3364508_3366194_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_159784213.1\|3366200_3367280_-	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-27	33.8
3366379:3366393	attL	NA	NA	NA	NA
WP_159784216.1\|3367306_3368398_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_159784219.1\|3368416_3369580_-	ROK family protein	NA	NA	NA	NA
WP_159784222.1\|3369929_3372452_+	hypothetical protein	NA	NA	NA	NA
WP_159784225.1\|3372707_3373571_-	SIS domain-containing protein	NA	NA	NA	NA
WP_159784228.1\|3373763_3374804_-	ornithine cyclodeaminase	NA	NA	NA	NA
WP_159784230.1\|3374827_3376222_-	sodium:glutamate symporter	NA	NA	NA	NA
WP_159784232.1\|3377049_3377256_+	hypothetical protein	NA	NA	NA	NA
WP_159784234.1\|3377603_3378248_+	glycosyltransferase	NA	NA	NA	NA
WP_159784236.1\|3378408_3379260_-	DegV family EDD domain-containing protein	NA	NA	NA	NA
WP_159784238.1\|3379662_3380349_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_159784240.1\|3380967_3382242_-	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_159784242.1\|3382244_3382742_-	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_159784245.1\|3382773_3383814_-	TRAP transporter substrate-binding protein DctP	NA	NA	NA	NA
WP_159784248.1\|3383830_3384304_-	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_159784251.1\|3384368_3385373_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_159784254.1\|3388066_3389305_-	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_159784257.1\|3389394_3390183_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_159784260.1\|3390205_3391762_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	3.3e-40	26.3
WP_168212303.1\|3391758_3392259_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_159784266.1\|3392255_3393128_-	xanthine dehydrogenase family protein subunit M	A0A0P0IVM8	Acinetobacter_phage	2.1e-20	31.4
WP_159784269.1\|3393148_3393604_-	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_159784272.1\|3393603_3396036_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_159784275.1\|3396035_3396686_-	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_159784278.1\|3396637_3397756_-	XdhC/CoxI family protein	NA	NA	NA	NA
WP_159784281.1\|3397769_3398546_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159784284.1\|3399179_3401207_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_159784287.1\|3401337_3402309_-	TIM barrel protein	NA	NA	NA	NA
WP_159784290.1\|3402334_3403297_-	ABC transporter permease	NA	NA	NA	NA
WP_159784293.1\|3403265_3404768_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.4e-17	26.8
WP_159784296.1\|3404808_3405981_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_159784299.1\|3405994_3407158_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_159784302.1\|3407210_3408383_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_159784305.1\|3408402_3409230_-	TIM barrel protein	NA	NA	NA	NA
WP_159784308.1\|3411355_3412453_+	gluconolaconase	NA	NA	NA	NA
WP_159784311.1\|3412674_3412974_-\|coat	spore coat protein	NA	NA	NA	NA
WP_159784314.1\|3412992_3413187_-	hypothetical protein	NA	NA	NA	NA
WP_159784317.1\|3413204_3414341_-	alcohol dehydrogenase catalytic domain-containing protein	E3SJ82	Synechococcus_phage	5.4e-16	27.4
WP_159784320.1\|3414359_3414728_-\|coat	spore coat protein	NA	NA	NA	NA
WP_159784323.1\|3414744_3414990_-	spore gernimation protein GerQ	NA	NA	NA	NA
WP_159784326.1\|3415937_3416837_-	aldo/keto reductase	NA	NA	NA	NA
WP_159784329.1\|3417809_3418322_-\|protease	DJ-1/PfpI/YhbO family deglycase/protease	NA	NA	NA	NA
WP_159784332.1\|3418468_3418768_-	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_159784335.1\|3418911_3419934_-	MsnO8 family LLM class oxidoreductase	NA	NA	NA	NA
WP_078429588.1\|3420829_3421177_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_159784339.1\|3421289_3421829_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
3426764:3426778	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3564688 : 3571485

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159784684.1\|3564688_3565570_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.1e-16	29.3
WP_159784687.1\|3565665_3566421_+	two pore domain potassium channel family protein	A0A1B0Y2S3	Lactobacillus_phage	1.4e-17	39.0
WP_159784690.1\|3566522_3567230_-	cupin domain-containing protein	Q2I8C5	Bacillus_phage	1.7e-49	67.9
WP_159784693.1\|3567396_3568401_-	S8 family serine peptidase	A0A127AWU5	Bacillus_phage	3.4e-91	56.3
WP_159784696.1\|3568511_3569867_-	AAA family ATPase	A0A141HS37	Bacillus_phage	2.2e-64	33.9
WP_159784699.1\|3570011_3570782_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_159784702.1\|3570923_3571082_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_098444903.1\|3571212_3571485_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	7.0e-23	62.9

DBSCAN-SWA_7

3984885 : 4013823

Planktothrix_phage(25.0%)

bacteriocin,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159785668.1\|3984885_3985605_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_159785671.1\|3985708_3987343_-	DUF2207 domain-containing protein	NA	NA	NA	NA
WP_159785674.1\|3987757_3989116_+	MFS transporter	NA	NA	NA	NA
WP_159787801.1\|3989378_3989705_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_159785677.1\|3989704_3990211_+	DUF1129 family protein	NA	NA	NA	NA
WP_159785680.1\|3990338_3991463_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_159785683.1\|3991459_3992155_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.4e-37	38.3
WP_159785686.1\|3992138_3993329_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_159785689.1\|3994044_3994566_-	hypothetical protein	NA	NA	NA	NA
WP_159785692.1\|3994685_3994889_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_159785695.1\|3994965_3995169_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_159785695.1\|3995243_3995447_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_159785695.1\|3995523_3995727_-\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
WP_159785698.1\|3995770_3996463_-	hypothetical protein	NA	NA	NA	NA
WP_159785701.1\|3996662_3996839_-	hypothetical protein	NA	NA	NA	NA
WP_159785704.1\|3996839_3997553_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.4e-14	28.0
WP_159785707.1\|3997565_3999347_-	hypothetical protein	NA	NA	NA	NA
WP_159785710.1\|3999603_4000923_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_159785713.1\|4000942_4001692_+	response regulator	W8CYM9	Bacillus_phage	1.0e-07	36.1
WP_159785716.1\|4001860_4002475_+	hypothetical protein	NA	NA	NA	NA
WP_159785719.1\|4002479_4002605_+	cyclic lactone autoinducer peptide	NA	NA	NA	NA
WP_159785722.1\|4002821_4003553_-	3'-5' exonuclease	NA	NA	NA	NA
WP_159785725.1\|4003549_4004536_-	hypothetical protein	NA	NA	NA	NA
WP_159785728.1\|4004560_4005847_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.0e-55	35.1
WP_159785731.1\|4006154_4007765_-	amidohydrolase family protein	NA	NA	NA	NA
WP_159785732.1\|4008132_4008522_+	DUF2512 family protein	NA	NA	NA	NA
WP_159785733.1\|4009443_4009818_-	hypothetical protein	NA	NA	NA	NA
WP_159785734.1\|4010151_4010601_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_159785735.1\|4011237_4011705_-	DUF2004 domain-containing protein	NA	NA	NA	NA
WP_159782788.1\|4012293_4013823_+\|transposase	IS21 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

4113563 : 4124078

Escherichia_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159785963.1\|4113563_4114865_-	hypothetical protein	A6M964	Geobacillus_virus	5.2e-07	42.1
WP_159785966.1\|4114901_4115852_-	glycosyltransferase	NA	NA	NA	NA
WP_159785998.1\|4115838_4116684_-	dTDP-4-dehydrorhamnose reductase	A0A1D8EQE2	Escherichia_phage	2.9e-27	33.1
WP_159786001.1\|4116700_4117696_-	dTDP-glucose 4,6-dehydratase	A0A1D8EQC0	Escherichia_phage	2.8e-77	46.4
WP_159786004.1\|4117709_4118258_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	4.5e-37	43.8
WP_159786007.1\|4118280_4119033_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	7.1e-49	43.0
WP_159787818.1\|4119080_4119746_-	sugar transferase	NA	NA	NA	NA
WP_159786010.1\|4119847_4121224_-	cupin domain-containing protein	A0A1V0SH58	Hokovirus	2.4e-39	26.7
WP_159787821.1\|4121325_4121982_-	polysaccharide biosynthesis tyrosine autokinase	A0A1X9I5D6	Streptococcus_phage	1.2e-25	34.1
WP_159786013.1\|4122007_4122754_-	capsular biosynthesis protein	NA	NA	NA	NA
WP_159786016.1\|4123199_4124078_+	hypothetical protein	A0A0E3DF67	Bacillus_phage	1.7e-65	48.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage