CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP041348	Komagataeibacter xylinus strain CGMCC 17276 chromosome, complete genome	1 crisprs	DinG,DEDDh,csa3	0	6
NZ_CP041351	Komagataeibacter xylinus strain CGMCC 17276 plasmid pC, complete sequence	0 crisprs	NA	0	0
NZ_CP041349	Komagataeibacter xylinus strain CGMCC 17276 plasmid pA, complete sequence	0 crisprs	csa3	0	1
NZ_CP041350	Komagataeibacter xylinus strain CGMCC 17276 plasmid pB, complete sequence	2 crisprs	cas3,csa3	1	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041348_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041348_1

25218-25344

Orphan

Consensus_repeat	Method
TAACCGGTCAAATTGACCACGTAACCGGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041348_1

>merge|NZ_CP041348|1|25218-25344|CRISPRCasFinder
TGACCGTTGAGACGGCCGATCTAACCGGTCAAATTGACCACGTAACCGGTCAAAATCGACATGTAACCGGTCATGATGACCGACTACAGCAAAACGTAACCGGTCAAATTGACCACGTAACCGGTCA

>NZ_CP041348|1|1|25218-25344|CRISPRCasFinder
TGACCGTTGAGACGGCCGATCTAACCGGTCA	AATTGACCACGTAACCGGTCAAAATCGACATGTAACCGGTCATGATGACCGACTACAGCAAAACG
TAACCGGTCAAATTGACCACGTAACCGGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041348.1\|WP_159260018.1\|30378_31605_+\|PBSX-family-phage-terminase-large-subunit	unknown	unknown	gnl\|CDD\|273684
NZ_CP041348.1\|WP_159259985.1\|17925_18219_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259995.1\|21701_22412_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_146220893.1\|22646_23087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259998.1\|23374_24325_+\|DNA-cytosine-methyltransferase	unknown	unknown	gnl\|CDD\|223348
NZ_CP041348.1\|WP_159260011.1\|28487_28703_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259997.1\|22416_22599_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159263450.1\|31810_33139_+\|DUF1073-domain-containing-protein	unknown	unknown	gnl\|CDD\|368870
NZ_CP041348.1\|WP_159259993.1\|21494_21701_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227114
NZ_CP041348.1\|WP_159260009.1\|28019_28316_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259987.1\|19711_20443_-\|phage-antirepressor-protein	unknown	unknown	gnl\|CDD\|214989
NZ_CP041348.1\|WP_159260016.1\|29947_30376_+\|ubiquitin-carboxyl-hydrolase	unknown	unknown	unknown
NZ_CP041348.1\|WP_159263448.1\|27553_27796_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159260005.1\|25827_26043_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259991.1\|21270_21498_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP041348.1\|WP_159260007.1\|26039_27545_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|273206
NZ_CP041348.1\|WP_159260014.1\|29273_29846_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159259989.1\|20572_21184_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|119397
NZ_CP041348.1\|WP_159260001.1\|24539_24956_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041348.1\|WP_159260013.1\|28890_29055_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP041348.1\|WP_159259987.1\|19711_20443_-\|phage-antirepressor-protein	gnl\|CDD\|214989	smart01040, Bro-N, BRO family, N-terminal domain. This family includes the N-terminus of baculovirus BRO and ALI motif proteins. The function of BRO proteins is unknown. It has been suggested that BRO-A and BRO-C are DNA binding proteins that influence host DNA replication and/or transcription. This Pfam domain does not include the characteristic invariant alanine, leucine, isoleucine motif of the ALI proteins.	3.19068e-31
NZ_CP041348.1\|WP_159259991.1\|21270_21498_+\|hypothetical-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.000545026
NZ_CP041348.1\|WP_159260018.1\|30378_31605_+\|PBSX-family-phage-terminase-large-subunit	gnl\|CDD\|273684	TIGR01547, Uncharacterized_protein_YqaT, phage terminase, large subunit, PBSX family. This model detects members of a highly divergent family of the large subunit of phage terminase. All members are encoded by phage genomes or within prophage regions of bacterial genomes. This is a distinct family from pfam03354. [Mobile and extrachromosomal element functions, Prophage functions].	8.31143e-39
NZ_CP041348.1\|WP_159259993.1\|21494_21701_+\|hypothetical-protein	gnl\|CDD\|227114	COG4773, FhuE, Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid [Inorganic ion transport and metabolism].	0.00029243
NZ_CP041348.1\|WP_159259998.1\|23374_24325_+\|DNA-cytosine-methyltransferase	gnl\|CDD\|223348	COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair].	5.50098e-21
NZ_CP041348.1\|WP_159260007.1\|26039_27545_+\|AAA-family-ATPase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	2.77837e-120
NZ_CP041348.1\|WP_159259989.1\|20572_21184_-\|hypothetical-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	4.94301e-07
NZ_CP041348.1\|WP_159263450.1\|31810_33139_+\|DUF1073-domain-containing-protein	gnl\|CDD\|368870	pfam06381, DUF1073, Protein of unknown function (DUF1073). This family consists of several hypothetical bacterial proteins. The function of this family is unknown.	1.66386e-91

>NZ_CP041348.1|WP_159260001.1|24539_24956_+|hypothetical-protein
MITFTIPKPFPLLNHSIGQSRFALTGMRRKMARAVADAALHLRPSEPFQRAHVLIERYSTGTPDTDGLYGGAKFLVDALTTPRLLNVRTPGARQRVKNKRGLGFVVDDGPAHMRIEVRSVKCRLCEQRTVVTITEVAP
>NZ_CP041348.1|WP_159259998.1|23374_24325_+|DNA-cytosine-methyltransferase
MDVYYNEWDEPTAEWLRALCARHHLPAGQVDTRSIRDVRAGDLREYDQAHFFAGIGGWPLALRLAGYERLPCWTGSPPCQPFSVAGQQRGNDDERHLAPVWLDLVRECKPPILFGEQVEAAIRHGWLDDLFDALEAEGYACGAAVLPACSVGAPHIRKRLFFGAVRLADANGWLSSDREEQCSGEHRLFAQSGSDVREKREGTRIDLGGLAHADDTRPQGRERVPERADEQPTGERSLESGSAHSDHGGWSGADWIGCRDGKFRPVEPGIFPLVDGFPSRVGLLRGAGNAIVPQVAAAFIQEFIGAFAEIQENTGG
>NZ_CP041348.1|WP_146220893.1|22646_23087_+|hypothetical-protein
MSKKLEINSASLEKREMLTAETVTQNAQTMARTLSETFGRGLGVKEIIHRIARLLRVTDRQAKGLYYGEWERIPAHIYLRLVDAYRKHLARAERQAEHQAAIYRALSQEWNDTWGDTSSCGALPSPDGGQAEHSGAQSPCGAGPNT
>NZ_CP041348.1|WP_159259997.1|22416_22599_-|hypothetical-protein
MLEKPPIELADGMKEGDRTLSIPQILVLMARVWAVTHPFATIEDRQHLAAMVATELAGRD
>NZ_CP041348.1|WP_159259995.1|21701_22412_+|hypothetical-protein
MRPFKDLSGQRFGPLVAVKFLGCASGASTWRCQCTECGTLRLVKTQALRSGKGIECEPCNRHNALARKKKTNIVRRPWSTVELSQLCSLWNKGHAVSDLAKQFNRTEHAIYRRISQQVKEGKAFPRAVRHAKAQMIGRTFGSRTVIARAHSSVNGCVMWSVRCKCGEESVVDGHLLHCGRQTACRKCAGNAPGKHNGPRPKPQVMPKANPILSFAHIRAHDRLIAARHAAEEAAFA
>NZ_CP041348.1|WP_159259993.1|21494_21701_+|hypothetical-protein
MTLFPLSSALCRLGLAGSPQEAQALIRLELVRIDGDRATASASVGYGVTISLRNGPSAVVSRQAMGVR
>NZ_CP041348.1|WP_159259991.1|21270_21498_+|hypothetical-protein
MTKFLSADDVEAAAKRRGLTIPMLCSEAGVSHPTFYRWKAGAHTPTLKTYQKIIAALRARRRRGAPIVRGQEASQ
>NZ_CP041348.1|WP_159259989.1|20572_21184_-|hypothetical-protein
MREEIRQAREIVQYAMDKTGKDPTNLARLAGVVPSTLTRLMGDNPTSAPTYKTIMAVMAAAGIMDVLRSNMQEASKRVPLYGDVGAGQRITRVDGDTPLEFVDAPLWAEAGTCALIVKGDSMFPAYWEGDIIYFDKGNMIPFEDALYRECVVALDTDELYLKQVTPGIAPGTATLVSYNASPIRDVVARWVSPVTFVDRRFRK
>NZ_CP041348.1|WP_159259987.1|19711_20443_-|phage-antirepressor-protein
MENIPTLFRFEGKPLNVQADENGDLWFHAGDVCRVLELSNVTMTLRVLDEDEKGLKSIETLGGKQEVNCVTEPGLYKLISRSRKPEAKRFDRWVRHEVLPTIRKTGSYSIERQFDIPKTLSEALRLAADQAEEIEELKHENAALAPKAQIHDKIADSDGLYNLNLSAKAANMPPRQFTSAAHQYGFIFRQGKKWNAYSDKVKAGHCHVKFASYRDRDGEEHFSPQVFFTPKGIQALINRMGMQ
>NZ_CP041348.1|WP_159259985.1|17925_18219_-|hypothetical-protein
MCNLPDGCSQADIDRRFQEQNTVLARKAQRAEKLKKSLEDCLYEARQVFGGQVSDTVAFLTDSIDEVKGEMARLDQGLCRLEDEWRGSRALHLEAAE
>NZ_CP041348.1|WP_159260005.1|25827_26043_+|hypothetical-protein
MSAEIIPFPPSLNLYLAPMYAERHFREARQQMLEAFHEVIKSGGYPTSLRDEAMATWNAMRGLIDIEEMEA
>NZ_CP041348.1|WP_159260007.1|26039_27545_+|AAA-family-ATPase
MNEIHFQPGAEITPDAPVNIQAEIGVIGGILMNNRGYELVCDFLEKRHFANSVNGWLYGEIEKVIQSGVEANPITMKARVENALELEAVGGFRYLMAAVQSQPGWMACRGSGHAVRDAWLRRQLLDIGIMTKSRALSGEGAAPEEIIDAIEQELLALGKDRGDQRLTSLTSAMDQAMEEASAAAARGDGIIGMRTGFQKLDEETSGLAPGCFYLLAGRPSMGKTGMGVGIAVRAAKLSQKPILYWSGEMDAKSISARIISAHAQLPLRWVLTGTKPGLRNPDGSEGKRVPLDRREWDRIFMARKAAEQVPVVVDDRPAISVAQLYGRARRMARSKAGLGMIVVDYVGLMRGTPTTRKQGKYAEVSEISSDLLALAKSLNVPVLGLQQLNRGVEGRDDKHPTMADLRDSGNLEQDASGIFLLYRDHYYAQRDPEPTKKAAESMDAFSQRVDAWHERIRASEGKAEIIIAKNRQGDCGTVPMLFNGPTTWFRDVVEGEDSAAW
>NZ_CP041348.1|WP_159263448.1|27553_27796_+|hypothetical-protein
MAENQHENSTNPRAGVVLSSMDNPDEIWPHRCGADYVANLAPPIDWNAAAARCRARCERDMAVSASRIGAGGDVASEMGD
>NZ_CP041348.1|WP_159260009.1|28019_28316_+|hypothetical-protein
MDISVIDGDVVQKVGPLISRLGRATLRGDLLGTGRSEVLRIGNEANEIGGFQAMKFLHDFAAMGFCDLVDEKGLDLASEIFTPAEISVIWDGIGEWRA
>NZ_CP041348.1|WP_159260011.1|28487_28703_+|hypothetical-protein
MADRIDHAIALNLTVARHIGAISTRLAPDESVSWDAVAEYIAHEEGCTLDEAFDMMEQARRDGLFSGGYQQ
>NZ_CP041348.1|WP_159260013.1|28890_29055_+|hypothetical-protein
MSTQALVMADPFEYWLWKSGWLIPLELFGGALFLCWFLFVAVSIMRVRRRIMRG
>NZ_CP041348.1|WP_159260014.1|29273_29846_+|hypothetical-protein
MTQTISKETQRTLNAVVTPERQRRSEWTLQQGAPRIRSAVKTLLNSEYIDQDAADAAERWLRSYNLGKNDYVEYPPNHTPNTTVRHDAVSWQMLRAVSWREVAFVRSHLGRQAHQLFELMLADEKSFGQIAEIVFPSLGLTTGITRSSAACAMVLSQLPGALKAYDRWVKNQSDAGEKGECWLSKEMAEK
>NZ_CP041348.1|WP_159260016.1|29947_30376_+|ubiquitin-carboxyl-hydrolase
MDEKMKAGRPSGFSTTVADEICGRIMDGESLRAICQDDHMPGRRTVFEWLDNDAHKDFRARYAHARARAAEAFEDEIVDVARAATAEDAAANRLRVDTLKWVMSKRAPKVYGDKVTQEHTGPDGGPMQVSEIRRVIVDAPKD
>NZ_CP041348.1|WP_159260018.1|30378_31605_+|PBSX-family-phage-terminase-large-subunit
MKSLDIPTARVFEPLLAPRRYKGAYGGRGSGKSHFFGECIVEEHLRIPGHRTVCIREVQKSIERSSKQLIVDKISKFNLNGLFDVQDQLIKTPGGGLIIFQGMQNHTADSIKSLEGFDRAWIEEAQSISAYSWRMLRPTMRKAGSEIWASWNPASPDDPIDDFFRGSGSDRPDLIAVRANWSDNPWFRSGTLPTERIEDQRARPDEYGHIWEGDYVSITDAIIFRNRVSVEDFKTPDGMRFYYGVDWGFAKDPTAAVRCFVSDGCLYVDHEAGGVGIELDDTPAVLSQIPGALDWPWKADGARPETISFLANRFGFRISAAKKWPGSVEDGVARLKSFKRIIVHPRCKRVAEEFRKYSYKVDKRTEEVLPVIADAWNHWIDALRYALDGVIQNRRTVPVFSSADNDQI
>NZ_CP041348.1|WP_159263450.1|31810_33139_+|DUF1073-domain-containing-protein
MDSAYGPGVAQSINNAIADGVVFLGYPRLAEMWSQRVEYRHIVGTLSEETTREWIEFHGPSDEAKKERIEQLEAEFVRLKVREHFKMLSDLDGAFGIGQLFLNTGLPRLSDDLATPLLLTPETFPKGSLKEIVPIEPIWTSPNEYNSENPLQLDFYRPTKWWVMGATVHHTRLLRFVSREPSQILAPTYNFGGVPLIQLAKPYVDNWVRTRQSVSDLINGCSIVSLRTDMVAVYENAGIGGLIDRVQNFIKFRDNRGVFLSDKESEELQILSAQLAGLDKLQNQALEQICVVAQMPLVKFSGISPSGLNASSEGEIRVWYDRVAAYQEAFFRPGLTHVMHAAMLNIWGEIDKDIDFRFIPLWQLDEAAKVAIAKALADTRAVYEEMGAVNNDEVRSSLRTDEDGLFDGADLGGPGYEPMDHEVPQSEGGALRSTSFIDKNGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

26039 : 54536

Aeromonas_phage(36.0%)

plate,terminase,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159260007.1\|26039_27545_+	AAA family ATPase	C7BGG1	Burkholderia_phage	3.5e-47	30.1
WP_159263448.1\|27553_27796_+	hypothetical protein	NA	NA	NA	NA
WP_159260009.1\|28019_28316_+	hypothetical protein	NA	NA	NA	NA
WP_159260011.1\|28487_28703_+	hypothetical protein	NA	NA	NA	NA
WP_159260013.1\|28890_29055_+	hypothetical protein	NA	NA	NA	NA
WP_159260014.1\|29273_29846_+	hypothetical protein	NA	NA	NA	NA
WP_159260016.1\|29947_30376_+	ubiquitin carboxyl-hydrolase	Q716H4	Shigella_phage	1.9e-22	45.0
WP_159260018.1\|30378_31605_+\|terminase	PBSX family phage terminase large subunit	A0A2H4J196	uncultured_Caudovirales_phage	6.0e-90	46.5
WP_159263450.1\|31810_33139_+	DUF1073 domain-containing protein	A0A2R3UAL5	Myoviridae_environmental_samples	8.3e-85	41.7
WP_159260020.1\|33138_33936_+\|head	phage head morphogenesis protein	A0A2R3UAK2	Myoviridae_environmental_samples	4.5e-54	41.9
WP_159260022.1\|33932_35456_+	DUF2213 domain-containing protein	A0A219YBB9	Aeromonas_phage	2.4e-51	41.3
WP_159260024.1\|35460_36462_+	hypothetical protein	NA	NA	NA	NA
WP_159260026.1\|36461_37499_+	DUF2184 domain-containing protein	A0A219YBB0	Aeromonas_phage	6.7e-82	45.7
WP_159260028.1\|37502_37823_+	hypothetical protein	H9C0V9	Aeromonas_phage	1.6e-10	36.0
WP_159260030.1\|37830_38253_+	DUF4054 domain-containing protein	A0A190XCA1	Acinetobacter_phage	5.1e-12	39.4
WP_159260031.1\|38243_38780_+	hypothetical protein	H9C0W2	Aeromonas_phage	5.6e-24	38.1
WP_159260033.1\|38769_39153_+	hypothetical protein	Q2NPC8	Xanthomonas_phage	1.4e-08	30.1
WP_159260035.1\|39110_39671_+	hypothetical protein	A0A077KC88	Edwardsiella_phage	6.5e-07	22.9
WP_159260037.1\|39675_41328_+	DUF3383 family protein	Q8HAQ4	Burkholderia_phage	3.1e-33	35.2
WP_159260039.1\|41330_41768_+	hypothetical protein	H9C0W6	Aeromonas_phage	4.6e-24	40.0
WP_159260041.1\|41769_42246_+	hypothetical protein	A0A077KC08	Edwardsiella_phage	4.0e-05	30.8
WP_159260042.1\|42370_44320_+	hypothetical protein	H9C0W9	Aeromonas_phage	1.0e-22	30.8
WP_159260044.1\|44335_45067_+	hypothetical protein	NA	NA	NA	NA
WP_159260046.1\|45063_45372_+	hypothetical protein	NA	NA	NA	NA
WP_159263452.1\|45439_46315_+	hypothetical protein	A0A190XCB4	Acinetobacter_phage	6.6e-14	27.0
WP_159260048.1\|46304_46964_+\|plate	baseplate assembly protein	H9C0X6	Aeromonas_phage	6.4e-30	46.3
WP_159260051.1\|47272_48415_-	hypothetical protein	A0A1S5SAB0	Streptococcus_phage	1.2e-34	30.5
WP_159260053.1\|48513_48759_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_148431301.1\|48841_49042_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_159260055.1\|49062_49965_+	hypothetical protein	A0A0M3LR56	Mannheimia_phage	2.6e-13	39.1
WP_159260057.1\|50376_50730_+	hypothetical protein	A0A077KCA1	Edwardsiella_phage	8.2e-16	42.0
WP_159260059.1\|50716_51937_+	hypothetical protein	H9C0X9	Aeromonas_phage	2.4e-46	34.2
WP_159260061.1\|51936_52506_+	DUF2612 domain-containing protein	H9C0Y0	Aeromonas_phage	1.0e-28	41.0
WP_159260063.1\|52696_53551_+	hypothetical protein	A0A060BN58	Escherichia_phage	1.8e-08	45.5
WP_159260065.1\|53547_54123_+	hypothetical protein	NA	NA	NA	NA
WP_159260067.1\|54119_54536_+	structural protein	J9Q7Y7	Salmonella_phage	2.0e-16	41.3

DBSCAN-SWA_2

130605 : 208095

Escherichia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010516652.1\|130605_131685_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_159260173.1\|133263_133989_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_159260174.1\|133985_134492_+	hypothetical protein	NA	NA	NA	NA
WP_159260176.1\|134523_135207_+	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	3.2e-16	28.6
WP_159260178.1\|135332_136994_+	STAS domain-containing protein	NA	NA	NA	NA
WP_159260180.1\|137064_137751_-	FCD domain-containing protein	NA	NA	NA	NA
WP_159260182.1\|137909_138683_+	hydantoin racemase	NA	NA	NA	NA
WP_159260184.1\|138827_141311_+	TonB-dependent receptor	NA	NA	NA	NA
WP_167518043.1\|141486_142884_+	NCS1 family nucleobase:cation symporter-1	NA	NA	NA	NA
WP_159260188.1\|142928_144182_-	hydantoinase/carbamoylase family amidase	NA	NA	NA	NA
WP_159260190.1\|144828_148464_+	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_159260192.1\|148811_149507_+	FCD domain-containing protein	NA	NA	NA	NA
WP_159260194.1\|152069_152882_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_159260196.1\|153666_155118_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_159260198.1\|155114_155396_-	hypothetical protein	NA	NA	NA	NA
WP_159260200.1\|155400_157602_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_159260202.1\|158104_159351_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.0e-92	59.8
WP_159260204.1\|159387_160537_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.1e-56	46.0
WP_159260206.1\|161265_163062_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_159260208.1\|163251_164529_-	type II restriction endonuclease	NA	NA	NA	NA
WP_159260210.1\|165024_165813_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-21	33.3
WP_159260212.1\|165888_166788_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159260215.1\|167877_168826_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-11	22.9
WP_159260217.1\|169457_170087_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_159260219.1\|170324_171122_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	6.8e-34	38.0
WP_159260221.1\|172039_173274_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	8.0e-90	58.8
WP_003618909.1\|174305_175289_-	aldo/keto reductase	NA	NA	NA	NA
WP_003618907.1\|175402_176296_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003618905.1\|176576_177467_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003618902.1\|178693_179656_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_003618900.1\|179718_180933_-	MFS transporter	NA	NA	NA	NA
WP_003618898.1\|181041_181698_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003618896.1\|181835_182597_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003618893.1\|182628_183063_+	SRPBCC family protein	NA	NA	NA	NA
WP_003618890.1\|183077_183791_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003618888.1\|183840_184731_+	oxidoreductase	NA	NA	NA	NA
WP_003618886.1\|184882_185809_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003618883.1\|185762_185981_-	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_040510602.1\|185977_187138_-	TrbI/VirB10 family protein	NA	NA	NA	NA
WP_003618875.1\|187134_188121_-	P-type conjugative transfer protein TrbG	NA	NA	NA	NA
WP_048858943.1\|188120_188801_-	conjugal transfer protein TrbF	NA	NA	NA	NA
WP_064478769.1\|188803_190048_-	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_003618871.1\|190052_190325_-	putative entry exclusion protein TrbK-alt	NA	NA	NA	NA
WP_040510596.1\|190324_191071_-	P-type conjugative transfer protein TrbJ	NA	NA	NA	NA
WP_003618869.1\|191067_193494_-	conjugal transfer protein TrbE	NA	NA	NA	NA
WP_003618868.1\|193501_193768_-	conjugal transfer protein	NA	NA	NA	NA
WP_040510593.1\|193767_194094_-	TrbC/VIRB2 family protein	NA	NA	NA	NA
WP_003618866.1\|194090_195059_-	P-type conjugative transfer ATPase TrbB	NA	NA	NA	NA
WP_159260223.1\|195272_195443_+	hypothetical protein	NA	NA	NA	NA
WP_003618862.1\|195477_196125_-	SOS response-associated peptidase	NA	NA	NA	NA
WP_003618860.1\|196138_198241_-	ATP-dependent helicase	A7KV33	Bacillus_phage	5.0e-68	28.5
WP_159260225.1\|198397_199177_+	damage-inducible protein	NA	NA	NA	NA
WP_167518044.1\|199190_200615_+	DNA polymerase Y family protein	NA	NA	NA	NA
WP_003618845.1\|200611_203788_+	error-prone DNA polymerase	A0A291AVA6	Streptomyces_phage	4.0e-93	26.8
WP_040510590.1\|203904_205329_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_003618841.1\|205377_205944_-	hydrolase	NA	NA	NA	NA
WP_040510588.1\|206052_206712_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_159260227.1\|207135_208095_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

1054608 : 1121694

Stx2-converting_phage(22.22%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159261292.1\|1054608_1055529_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_159261294.1\|1055782_1056754_+	MCE family protein	NA	NA	NA	NA
WP_082770804.1\|1056915_1057335_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_159261296.1\|1057358_1060049_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.9e-19	23.5
WP_061274423.1\|1060045_1060678_-	RNA-binding protein	NA	NA	NA	NA
WP_061274464.1\|1060712_1062251_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_159261298.1\|1062271_1062892_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_159261300.1\|1063068_1063707_+	hypothetical protein	NA	NA	NA	NA
WP_159261302.1\|1063703_1064975_+	AAA domain-containing protein	A0A2I7SAX5	Vibrio_phage	7.3e-30	32.9
WP_159261303.1\|1065041_1065980_+	hypothetical protein	NA	NA	NA	NA
WP_159261305.1\|1066104_1067001_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159261307.1\|1067226_1069920_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_159263632.1\|1070193_1070847_+	heme ABC exporter ATP-binding protein CcmA	W5SAS9	Pithovirus	9.6e-10	28.3
WP_159261309.1\|1070843_1071524_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_159261310.1\|1072050_1073181_-	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_159261311.1\|1073560_1074502_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_159261312.1\|1074553_1075096_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.4e-17	58.0
WP_061274471.1\|1075229_1075685_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_159261313.1\|1075681_1076146_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_061274442.1\|1076145_1077495_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_159261314.1\|1077689_1079924_-	FUSC family protein	NA	NA	NA	NA
WP_078525690.1\|1080060_1080591_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.3e-20	40.1
WP_159261315.1\|1080775_1082074_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_159261316.1\|1082160_1082853_-	hypothetical protein	NA	NA	NA	NA
WP_159261317.1\|1082970_1084041_+	heme A synthase	NA	NA	NA	NA
WP_159261318.1\|1084496_1085114_+	hypothetical protein	NA	NA	NA	NA
WP_159261319.1\|1085233_1086289_-	ferrochelatase	NA	NA	NA	NA
WP_159261320.1\|1086544_1087618_-	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_159261321.1\|1087628_1088126_+	DUF721 domain-containing protein	NA	NA	NA	NA
WP_159261322.1\|1088356_1088683_+	hypothetical protein	NA	NA	NA	NA
WP_159261323.1\|1088772_1089399_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_159261324.1\|1089508_1090228_-	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_159261325.1\|1090815_1091106_+	hypothetical protein	NA	NA	NA	NA
WP_159261326.1\|1091263_1092670_+	dipeptidase	NA	NA	NA	NA
WP_159261327.1\|1092662_1093652_+	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_159261329.1\|1093648_1094395_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_159261332.1\|1094658_1095399_+	glycosyltransferase	NA	NA	NA	NA
WP_159261335.1\|1095395_1096151_+	hypothetical protein	NA	NA	NA	NA
WP_159261337.1\|1096276_1096804_-	hypothetical protein	NA	NA	NA	NA
WP_010516652.1\|1097045_1098125_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_159261339.1\|1098174_1098891_-	hypothetical protein	NA	NA	NA	NA
WP_159261341.1\|1100463_1101924_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_159263634.1\|1102686_1104873_+	alpha,alpha-trehalase TreF	NA	NA	NA	NA
WP_159261343.1\|1105170_1105755_-	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_159261345.1\|1105801_1106995_-	MFS transporter	NA	NA	NA	NA
WP_159261346.1\|1107207_1107783_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_159261348.1\|1107897_1108650_-	methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_159263636.1\|1108646_1109564_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	3.4e-29	38.2
WP_159261350.1\|1109793_1111296_+	monooxygenase	NA	NA	NA	NA
WP_159261352.1\|1111493_1112330_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_159261353.1\|1112427_1112937_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_159263638.1\|1112933_1113515_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_159261355.1\|1113515_1115126_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.3e-103	45.1
WP_019092242.1\|1115191_1115539_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
WP_159263640.1\|1115535_1115907_-\|transposase	transposase	NA	NA	NA	NA
WP_159261357.1\|1116371_1117292_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_159261359.1\|1118176_1119058_+	hypothetical protein	NA	NA	NA	NA
WP_159261362.1\|1119576_1120599_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	5.9e-22	32.7
WP_048859179.1\|1120857_1121694_+\|transposase	IS5-like element IS1031A family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1548334 : 1574227

Pseudomonas_phage(17.65%)

integrase,head,portal,capsid,terminase,tail

attL 1553312:1553325|attR 1577257:1577270

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159261800.1\|1548334_1548808_-	structural protein	A0A0M4TU77	Ralstonia_phage	7.1e-15	37.7
WP_078526113.1\|1548804_1549113_-	hypothetical protein	NA	NA	NA	NA
WP_159261801.1\|1549179_1549572_-	hypothetical protein	NA	NA	NA	NA
WP_159261802.1\|1549574_1550966_-	hypothetical protein	NA	NA	NA	NA
WP_159261803.1\|1550908_1551496_-	DUF2313 domain-containing protein	A0A068CH63	Rhizobium_phage	9.8e-06	28.5
WP_159261804.1\|1551492_1552611_-	hypothetical protein	A0A0C4UQU9	Shigella_phage	3.9e-19	27.6
WP_159261805.1\|1552612_1553086_-	hypothetical protein	NA	NA	NA	NA
WP_159261806.1\|1553093_1553609_-	hypothetical protein	Q8W617	Enterobacteria_phage	3.5e-07	31.1
1553312:1553325	attL	NA	NA	NA	NA
WP_159261807.1\|1553608_1554745_-	hypothetical protein	Q8HAC0	Salmonella_phage	1.7e-38	32.6
WP_159261808.1\|1554741_1555311_-	hypothetical protein	NA	NA	NA	NA
WP_159261809.1\|1555307_1556072_-	hypothetical protein	J7FAD8	Agrobacterium_phage	8.0e-08	26.9
WP_159261810.1\|1556068_1558087_-	hypothetical protein	NA	NA	NA	NA
WP_159261811.1\|1558237_1558813_-	hypothetical protein	NA	NA	NA	NA
WP_159261812.1\|1558812_1559205_-\|tail	phage tail protein	NA	NA	NA	NA
WP_159261813.1\|1559208_1560708_-\|tail	phage tail protein	A0A0C4UQS0	Shigella_phage	3.8e-54	31.7
WP_159261814.1\|1560704_1560965_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_159261815.1\|1560976_1561522_-	hypothetical protein	NA	NA	NA	NA
WP_159261816.1\|1561615_1562200_+	hypothetical protein	A0A0R6PI79	Moraxella_phage	3.7e-05	30.5
WP_159261817.1\|1562196_1562778_-	hypothetical protein	NA	NA	NA	NA
WP_159261818.1\|1562777_1563161_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_159261819.1\|1563153_1563798_-	hypothetical protein	A0A141GEW4	Brucella_phage	3.5e-12	29.3
WP_159261820.1\|1563810_1564197_-	hypothetical protein	NA	NA	NA	NA
WP_159261821.1\|1564198_1564399_-	hypothetical protein	NA	NA	NA	NA
WP_159261822.1\|1564408_1566007_-\|capsid	phage major capsid protein	Q6UAX6	Klebsiella_phage	3.9e-57	34.1
WP_159261823.1\|1566094_1566808_-	peptidase	H9YSG6	environmental_Halophage	1.1e-11	30.9
WP_159261824.1\|1566836_1568078_-\|portal	phage portal protein	A0A2D1GNU4	Pseudomonas_phage	1.4e-54	34.3
WP_159261825.1\|1568143_1569841_-\|terminase	terminase large subunit	A0A0R6PIM0	Moraxella_phage	1.3e-138	46.3
WP_159261826.1\|1569864_1570398_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_141300225.1\|1570517_1570841_-	HNH endonuclease	B5WZZ4	Pseudomonas_phage	3.3e-11	43.4
WP_159261827.1\|1570840_1571458_-	hypothetical protein	NA	NA	NA	NA
WP_159261828.1\|1571483_1572281_-	DNA adenine methylase	A0A219VHB5	Ochrobactrum_phage	6.9e-79	58.0
WP_159261829.1\|1572522_1573131_-	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	4.4e-49	48.5
WP_159261830.1\|1573127_1573307_-	hypothetical protein	NA	NA	NA	NA
WP_159261831.1\|1573351_1574227_-\|integrase	tyrosine-type recombinase/integrase	Q9ZWV7	Corynephage	8.9e-11	28.3
1577257:1577270	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2289960 : 2332096

Agrobacterium_phage(12.5%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061272180.1\|2289960_2290596_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.0e-58	57.8
WP_078524412.1\|2290730_2291990_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.0e-129	58.6
WP_159262319.1\|2292152_2294645_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-199	48.2
WP_061272185.1\|2294826_2295114_+	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.3e-16	52.2
WP_061272187.1\|2295673_2296039_+	NADH-quinone oxidoreductase subunit A	NA	NA	NA	NA
WP_078524409.1\|2296062_2296644_+	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_159262320.1\|2296636_2297302_+	NADH-quinone oxidoreductase subunit C	NA	NA	NA	NA
WP_110568827.1\|2297306_2298563_+	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_159262321.1\|2298568_2299219_+	NADH-quinone oxidoreductase subunit NuoE	NA	NA	NA	NA
WP_159262322.1\|2299224_2300550_+	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_159262323.1\|2300555_2302622_+	NADH-quinone oxidoreductase subunit G	NA	NA	NA	NA
WP_159262324.1\|2302626_2303649_+	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_061272200.1\|2303648_2304137_+	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_159262325.1\|2304215_2304989_+	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_078524400.1\|2304981_2305305_+	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_159262326.1\|2305310_2307248_+	NADH-quinone oxidoreductase subunit L	NA	NA	NA	NA
WP_159262327.1\|2307273_2308698_+	NADH-quinone oxidoreductase subunit NuoN	NA	NA	NA	NA
WP_159262328.1\|2308701_2309493_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_159262329.1\|2309789_2311433_+	RNase J family beta-CASP ribonuclease	NA	NA	NA	NA
WP_159262330.1\|2311739_2313062_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_159262331.1\|2313064_2314309_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_159262332.1\|2314301_2315003_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-28	36.1
WP_159262333.1\|2315141_2318576_+	DNA polymerase III subunit alpha	A0A0K1Y8F0	Streptomyces_phage	2.1e-180	37.6
WP_159262334.1\|2318783_2319953_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_078524387.1\|2319955_2320570_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_159262335.1\|2320596_2321208_+	nitroreductase family protein	NA	NA	NA	NA
WP_159262336.1\|2321516_2322860_+	DEAD/DEAH box helicase	A0A1V0SBR7	Catovirus	1.7e-53	34.0
WP_159262337.1\|2323351_2327944_+	UDP-forming cellulose synthase catalytic subunit	NA	NA	NA	NA
WP_159263872.1\|2328781_2328928_-\|transposase	transposase	NA	NA	NA	NA
WP_159262338.1\|2328896_2329166_-\|transposase	transposase	NA	NA	NA	NA
WP_159262340.1\|2329379_2330594_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.9e-37	41.8
WP_010516652.1\|2331016_2332096_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2871233 : 2933045

Pseudomonas_phage(13.64%)

plate,integrase,head,portal,protease,capsid,terminase,tail

attL 2871885:2871900|attR 2907437:2907452

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159262891.1\|2871233_2871596_-\|tail	phage tail protein	NA	NA	NA	NA
WP_159262892.1\|2871592_2872273_-\|plate	baseplate assembly protein	NA	NA	NA	NA
2871885:2871900	attL	NA	NA	NA	NA
WP_159262893.1\|2872265_2873423_-	hypothetical protein	NA	NA	NA	NA
WP_159262894.1\|2873419_2873629_-	hypothetical protein	NA	NA	NA	NA
WP_159262895.1\|2873647_2874565_-	hypothetical protein	NA	NA	NA	NA
WP_159262896.1\|2874688_2874904_-	hypothetical protein	NA	NA	NA	NA
WP_159262897.1\|2874983_2875238_+	hypothetical protein	NA	NA	NA	NA
WP_159262898.1\|2875526_2875691_+	hypothetical protein	NA	NA	NA	NA
WP_159262899.1\|2876195_2876627_-	hypothetical protein	NA	NA	NA	NA
WP_159262900.1\|2876788_2878276_-\|tail	phage tail protein	B3GAJ6	uncultured_virus	8.4e-78	40.5
WP_159262901.1\|2878377_2879253_-	hypothetical protein	NA	NA	NA	NA
WP_159262902.1\|2879306_2879957_-	hypothetical protein	NA	NA	NA	NA
WP_167518062.1\|2879956_2880340_-	hypothetical protein	NA	NA	NA	NA
WP_159262904.1\|2880580_2881933_-	DUF4043 domain-containing protein	NA	NA	NA	NA
WP_159262905.1\|2882783_2883284_-	hypothetical protein	NA	NA	NA	NA
WP_159262906.1\|2883644_2884874_+\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	5.3e-110	50.6
WP_167518037.1\|2884862_2885072_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_159262907.1\|2885064_2885316_-	hypothetical protein	NA	NA	NA	NA
WP_159262908.1\|2885312_2885453_-	hypothetical protein	NA	NA	NA	NA
WP_159262909.1\|2885449_2885668_-	hypothetical protein	NA	NA	NA	NA
WP_159262910.1\|2885667_2887308_-	ParB/RepB/Spo0J family partition protein	A0A1C9EHY8	Gordonia_phage	5.4e-09	31.6
WP_159262911.1\|2887304_2887550_-	hypothetical protein	NA	NA	NA	NA
WP_159262912.1\|2887536_2887800_-	hypothetical protein	NA	NA	NA	NA
WP_159262913.1\|2887796_2888012_-	hypothetical protein	NA	NA	NA	NA
WP_159262914.1\|2888876_2889284_-	hypothetical protein	NA	NA	NA	NA
WP_159262915.1\|2889283_2889955_-	helix-turn-helix domain-containing protein	G8C7L8	Escherichia_phage	2.5e-05	23.2
WP_159263987.1\|2890036_2890264_+	chaperone	NA	NA	NA	NA
WP_159262916.1\|2890260_2890557_+	hypothetical protein	NA	NA	NA	NA
WP_159262917.1\|2890716_2891067_+	hypothetical protein	NA	NA	NA	NA
WP_159262918.1\|2891063_2891276_+	hypothetical protein	NA	NA	NA	NA
WP_159262919.1\|2891257_2892304_+	hypothetical protein	A0A0U4B0G9	Pseudomonas_phage	1.1e-15	47.1
WP_159263989.1\|2892290_2894144_+	ATP-binding protein	NA	NA	NA	NA
WP_159262921.1\|2894723_2895350_+	hypothetical protein	NA	NA	NA	NA
WP_159262922.1\|2895370_2895940_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_159262923.1\|2895939_2897577_+\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	5.2e-97	39.0
WP_159262924.1\|2897583_2898903_+\|portal	phage portal protein	Q8W629	Enterobacteria_phage	2.3e-55	34.4
WP_159262925.1\|2898905_2899604_+	peptidase	A0A218MM23	uncultured_virus	4.2e-11	33.6
WP_159262926.1\|2899644_2901180_+\|capsid	phage major capsid protein	A4JX01	Burkholderia_virus	1.2e-55	41.3
WP_159262927.1\|2901224_2901530_+	hypothetical protein	NA	NA	NA	NA
WP_159262928.1\|2901529_2902174_+	hypothetical protein	H9YSG3	environmental_Halophage	9.4e-10	31.4
WP_159262929.1\|2902166_2902568_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_159262930.1\|2902554_2903094_+	hypothetical protein	NA	NA	NA	NA
WP_159262931.1\|2903090_2903660_+	hypothetical protein	Q8W624	Enterobacteria_phage	3.4e-19	37.1
WP_159262932.1\|2903880_2905350_+\|tail	phage tail protein	B5TK67	Pseudomonas_phage	2.0e-63	34.9
WP_159262933.1\|2905362_2905731_+	hypothetical protein	NA	NA	NA	NA
WP_159262934.1\|2905727_2906048_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_159262935.1\|2906166_2908167_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
2907437:2907452	attR	NA	NA	NA	NA
WP_159262936.1\|2908166_2909471_+	multidrug DMT transporter	A0A192Y5U9	Salmonella_phage	3.3e-17	26.5
WP_159262937.1\|2909467_2910613_+\|tail	phage tail protein	A0A0C4UQS1	Shigella_phage	4.5e-31	28.9
WP_159262938.1\|2910612_2911089_+	hypothetical protein	NA	NA	NA	NA
WP_159262939.1\|2911085_2911565_+	hypothetical protein	NA	NA	NA	NA
WP_159262940.1\|2911536_2912649_+	hypothetical protein	A0A0C4UQU9	Shigella_phage	1.5e-26	31.5
WP_159262941.1\|2912648_2913245_+	DUF2313 domain-containing protein	A0A2P9JZK7	Alteromonadaceae_phage	2.2e-29	37.5
WP_159262942.1\|2913251_2914421_+	hypothetical protein	B5TK77	Pseudomonas_phage	4.7e-07	49.3
WP_159262943.1\|2914524_2914884_+	DUF3047 domain-containing protein	NA	NA	NA	NA
WP_159262944.1\|2914880_2915306_+	structural protein	A0A2R3UAN6	Myoviridae_environmental_samples	3.2e-22	47.8
WP_159262945.1\|2915302_2915773_+	hypothetical protein	NA	NA	NA	NA
WP_159262946.1\|2915875_2916178_+	hypothetical protein	NA	NA	NA	NA
WP_159262947.1\|2916174_2916663_+	hypothetical protein	A0A1B2ANT4	Pseudoalteromonas_phage	4.9e-11	32.7
WP_159263990.1\|2917019_2917436_+	hypothetical protein	NA	NA	NA	NA
WP_159262948.1\|2917437_2917638_+	hypothetical protein	NA	NA	NA	NA
WP_159262949.1\|2917891_2918893_+	hypothetical protein	NA	NA	NA	NA
WP_159262950.1\|2920876_2922193_-	DNA packaging protein	A0A1B1IQC4	uncultured_Mediterranean_phage	9.2e-28	41.2
WP_159262951.1\|2922176_2922575_-\|terminase	terminase small subunit	F8TUR4	EBPR_podovirus	1.9e-13	40.7
WP_159262952.1\|2923034_2924126_-	hypothetical protein	NA	NA	NA	NA
WP_159262953.1\|2924444_2925524_-	EamA family transporter	NA	NA	NA	NA
WP_159262954.1\|2925805_2926360_-	hypothetical protein	NA	NA	NA	NA
WP_159262955.1\|2926358_2926568_+	hypothetical protein	NA	NA	NA	NA
WP_159262956.1\|2926863_2927835_+	helix-turn-helix domain-containing protein	A0A1B0V350	Roseobacter_phage	2.4e-09	33.3
WP_159262957.1\|2927975_2928302_+	hypothetical protein	NA	NA	NA	NA
WP_159262958.1\|2928496_2929111_+	YceI family protein	NA	NA	NA	NA
WP_159262959.1\|2929138_2929567_+	aromatic ring-cleaving dioxygenase	NA	NA	NA	NA
WP_159262960.1\|2929851_2930547_+	sulfotransferase family 2 domain-containing protein	NA	NA	NA	NA
WP_159262961.1\|2930618_2931683_-	alkene reductase	NA	NA	NA	NA
WP_159262962.1\|2931836_2933045_-\|protease	M48 family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041349

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

47890 : 97028

Indivirus(16.67%)

transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159264320.1\|47890_49030_+\|transposase	transposase	NA	NA	NA	NA
WP_159264173.1\|49019_49796_+	segregation/condensation protein A	NA	NA	NA	NA
WP_159264175.1\|50527_50668_+	hypothetical protein	NA	NA	NA	NA
WP_159264177.1\|50777_51317_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_159264178.1\|51420_52482_+	aldo/keto reductase	A0A1V0SDE7	Indivirus	1.2e-06	24.2
WP_159264181.1\|52548_53436_-	NAD-dependent epimerase/dehydratase family protein	M1HZA6	Acanthocystis_turfacea_Chlorella_virus	8.4e-09	23.4
WP_159264183.1\|53530_54382_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_110560940.1\|55858_56785_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_110560939.1\|56906_58439_+\|holin	choline-sulfatase	A0A2K9L727	Tupanvirus	7.0e-19	25.7
WP_159264185.1\|60847_62098_+	hypothetical protein	NA	NA	NA	NA
WP_010511769.1\|62094_62709_-	hypothetical protein	NA	NA	NA	NA
WP_159264187.1\|63155_63581_-	hypothetical protein	NA	NA	NA	NA
WP_159264188.1\|63760_63985_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_159264190.1\|63985_64396_+\|tRNA	tRNA(fMet)-specific endonuclease VapC	NA	NA	NA	NA
WP_159264192.1\|64993_65896_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_159264194.1\|66096_66987_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_159264196.1\|67144_68071_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159264197.1\|68289_69195_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159264199.1\|69323_70037_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_159264202.1\|70076_71063_+	amidohydrolase family protein	NA	NA	NA	NA
WP_159264203.1\|71324_72551_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_159264205.1\|72640_73240_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_159264207.1\|73322_74077_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	7.9e-24	44.5
WP_159264208.1\|74227_75187_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_159264210.1\|75537_76020_-	hypothetical protein	NA	NA	NA	NA
WP_159264212.1\|76021_76402_-	hypothetical protein	NA	NA	NA	NA
WP_159264214.1\|76463_76952_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_159264216.1\|76998_77799_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159264218.1\|77915_78797_+	NAD-binding protein	NA	NA	NA	NA
WP_159264220.1\|78832_79402_+	NAD(FAD)-dependent dehydrogenase	NA	NA	NA	NA
WP_159264222.1\|80938_81355_-	hypothetical protein	NA	NA	NA	NA
WP_159264224.1\|81731_82262_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_159264226.1\|82378_82780_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_159264227.1\|82815_83265_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	5.6e-09	45.7
WP_159264229.1\|83678_84557_-	NmrA family NAD(P)-binding protein	NA	NA	NA	NA
WP_159264230.1\|84665_85562_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159264231.1\|85903_86374_+	hypothetical protein	NA	NA	NA	NA
WP_159264232.1\|86402_86735_-	hypothetical protein	NA	NA	NA	NA
WP_159264233.1\|87007_87232_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_159264234.1\|87232_87643_+\|tRNA	tRNA(fMet)-specific endonuclease VapC	NA	NA	NA	NA
WP_159264235.1\|88397_89234_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_159264236.1\|89286_90300_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_159264237.1\|91466_92390_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159264322.1\|94550_95420_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_167518068.1\|96062_97028_-\|transposase	IS110 family transposase	Q75QL1	Wolbachia_phage	9.1e-25	33.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP041350

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041350_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041350_1

102813-102893

Orphan

Consensus_repeat	Method
GAAGGGCGCACTTACACAAACTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041350_1

>merge|NZ_CP041350|1|102813-102893|CRISPRCasFinder
GAAGGGCGCACTTACACAAACTTTCGTTTGCCGTGCGCCGGTTTGGTGCCAAATCCAGAAGGGCGCACTTATACAAACTTT

>NZ_CP041350|1|1|102813-102893|CRISPRCasFinder
GAAGGGCGCACTTACACAAACTTT	CGTTTGCCGTGCGCCGGTTTGGTGCCAAATCCA
GAAGGGCGCACTTATACAAACTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041350.1\|WP_010516903.1\|118491_118959_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_010505173.1\|95228_95402_+\|DUF4160-domain-containing-protein	unknown	unknown	gnl\|CDD\|379344
NZ_CP041350.1\|WP_019092507.1\|96123_96519_+\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	unknown	unknown	gnl\|CDD\|226180
NZ_CP041350.1\|WP_130732828.1\|103292_103709_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379352
NZ_CP041350.1\|WP_026019823.1\|117596_118055_+\|nitrate-reductase-maturation-protein-NarM	unknown	unknown	gnl\|CDD\|378232
NZ_CP041350.1\|WP_019092504.1\|97499_97886_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	unknown	unknown	gnl\|CDD\|350220
NZ_CP041350.1\|WP_159264404.1\|99103_100191_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP041350.1\|WP_019092505.1\|97257_97503_+\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|226603
NZ_CP041350.1\|WP_026019903.1\|95391_95799_+\|DUF2442-domain-containing-protein	unknown	unknown	gnl\|CDD\|378424
NZ_CP041350.1\|WP_159264406.1\|107424_109065_+\|alginate-export-family-protein	unknown	unknown	gnl\|CDD\|372583
NZ_CP041350.1\|WP_019092710.1\|101466_102567_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP041350.1\|WP_130732827.1\|104101_105310_-\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
NZ_CP041350.1\|WP_053323963.1\|106181_107402_+\|NarK/NasA-family-nitrate-transporter	unknown	unknown	gnl\|CDD\|225133
NZ_CP041350.1\|WP_019092503.1\|97935_98358_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_019092496.1\|103730_104099_-\|DUF488-domain-containing-protein	unknown	unknown	gnl\|CDD\|225730
NZ_CP041350.1\|WP_010515344.1\|115971_116583_+\|ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|226230
NZ_CP041350.1\|WP_019092498.1\|102617_102794_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_019092084.1\|116579_117575_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270271
NZ_CP041350.1\|WP_026019902.1\|95899_96127_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274230
NZ_CP041350.1\|WP_019092494.1\|105531_105720_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP041350.1\|WP_019092710.1\|101466_102567_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.56573e-18
NZ_CP041350.1\|WP_010505173.1\|95228_95402_+\|DUF4160-domain-containing-protein	gnl\|CDD\|379344	pfam13711, DUF4160, Domain of unknown function (DUF4160).	3.40725e-06
NZ_CP041350.1\|WP_026019903.1\|95391_95799_+\|DUF2442-domain-containing-protein	gnl\|CDD\|378424	pfam10387, DUF2442, Protein of unknown function (DUF2442). This family of bacterial and fungal proteins has several members annotated as being putative molybdopterin-guanine dinucleotide biosynthesis protein A; however this could not be verified. Hence the function is not known. This family also includes the DUF3532 that was found to be related and was merged into this family. Members of this family also fall into the NE0471 N-terminal domain-like superfamily, a family of proteins with a unique fold in SCOP:143880.	1.52368e-15
NZ_CP041350.1\|WP_130732828.1\|103292_103709_+\|hypothetical-protein	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	0.00119871
NZ_CP041350.1\|WP_019092504.1\|97499_97886_+\|type-II-toxin-antitoxin-system-VapC-family-toxin	gnl\|CDD\|350220	cd09872, PIN_Sll0205-like, VapC-like PIN domain of Sll0205 protein and homologs. Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of the Synechocystis sp. (strain PCC 6803) Sll0205 protein and other uncharacterized homologs are included in this subfamily. They are similar to the PIN domains of the Mycobacterium tuberculosis VapC and Neisseria gonorrhoeae FitB toxins of the prokaryotic toxin/antitoxin operons, VapBC and FitAB, respectively, which are believed to be involved in growth inhibition by regulating translation. These toxins are nearly always co-expressed with an antitoxin, a cognate protein inhibitor, forming an inert protein complex. Disassociation of the protein complex activates the ribonuclease activity of the toxin by an, as yet undefined mechanism. The PIN domain belongs to a large nuclease superfamily. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.23671e-53
NZ_CP041350.1\|WP_159264404.1\|99103_100191_-\|IS3-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.15305e-31
NZ_CP041350.1\|WP_019092505.1\|97257_97503_+\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|226603	COG4118, Phd, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	1.8992e-10
NZ_CP041350.1\|WP_019092496.1\|103730_104099_-\|DUF488-domain-containing-protein	gnl\|CDD\|225730	COG3189, COG3189, Uncharacterized conserved protein [Function unknown].	6.49481e-54
NZ_CP041350.1\|WP_019092507.1\|96123_96519_+\|type-II-toxin-antitoxin-system-death-on-curing-family-toxin	gnl\|CDD\|226180	COG3654, Doc, Prophage maintenance system killer protein [General function prediction only].	2.71107e-31
NZ_CP041350.1\|WP_130732827.1\|104101_105310_-\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
NZ_CP041350.1\|WP_053323963.1\|106181_107402_+\|NarK/NasA-family-nitrate-transporter	gnl\|CDD\|225133	COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism].	2.87884e-94
NZ_CP041350.1\|WP_026019823.1\|117596_118055_+\|nitrate-reductase-maturation-protein-NarM	gnl\|CDD\|378232	pfam09655, Nitr_red_assoc, Conserved nitrate reductase-associated protein (Nitr_red_assoc). Proteins in this entry are found in the Cyanobacteria, and are mostly encoded near nitrate reductase and molybdopterin biosynthesis genes. Molybdopterin guanine dinucleotide is a cofactor for nitrate reductase. These proteins are sometimes annotated as nitrate reductase-associated proteins, though their function is unknown.	3.093e-69
NZ_CP041350.1\|WP_159264406.1\|107424_109065_+\|alginate-export-family-protein	gnl\|CDD\|372583	pfam13372, Alginate_exp, Alginate export. This domain forms an 18-stranded beta-barrel pore which is likely to act as an alginate export channel.	2.68127e-26
NZ_CP041350.1\|WP_010515344.1\|115971_116583_+\|ANTAR-domain-containing-protein	gnl\|CDD\|226230	COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms].	3.30388e-24
NZ_CP041350.1\|WP_019092084.1\|116579_117575_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270271	cd13553, PBP2_NrtA_CpmA_like, Substrate binding domain of ABC-type nitrate/bicarbonate transporters, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes nitrate (NrtA) and bicarbonate (CmpA) receptors. These domains are found in eubacterial perisplamic-binding proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding their ligand with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. These binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.02082e-41
NZ_CP041350.1\|WP_026019902.1\|95899_96127_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|274230	TIGR02609, hypothetical_protein_XAC1195, putative addiction module antidote. Members of this protein family are putative addiction module antidote proteins that appear recurringly in two-gene operons with members of the Doc (death-on-curing) family TIGR01550. Members of this family contain a SpoVT/AbrB-like domain (pfam04014). Note that the gene pairs with a member of this family tend to be found on bacterial chromosomes, not on plasmids. [Mobile and extrachromosomal element functions, Other].	5.68248e-14

>NZ_CP041350.1|WP_019092498.1|102617_102794_-|hypothetical-protein
MNKHRLIEFDSVEAAREPDMQSVLLEMAKEDGNAAGIEHALNIISAANQKNKSALKKL
>NZ_CP041350.1|WP_019092710.1|101466_102567_-|IS630-family-transposase
MGRVAVAIELTALERQELESLARARKTGQALARRARIVLAAADGHENKAIRDLTGADINTVGKWRRRFATDRLDGLYDEPRPGTPRSIGDGEIAETIRRTLEETPRGATHWSLRSMAQAVGYAPSTIHRIWKAFGLQPHRTETFKLSNDPLFVEKVRDIVGLYMAPPERALVLCVDEKSQIQALDRSQPMLPMRPGQVERRTHDYTRHGTTSLFAALDIATGTIIGKCYPKHRSTEFRKFLDQIETNVPTDLDIHLVMDNYATHKTKLIRDWLARRPRWHVHFTPTGASWINQVERFFALVTEKQIRRGIHRSTEALEADIRAFIAVHNEQPKPFKWTRSADDILQAVKRFCLRTTKISETSESGH
>NZ_CP041350.1|WP_159264404.1|99103_100191_-|IS3-family-transposase
MESDRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAKYGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKKLKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAAENDRIAALLVGLTQAHRRWGFGLCFLYLRTVQGQLWNHKRVYRIYRELEFNLRIKPRRRLVREKPEKLSVPALPNRVWSMDFMADRLMDGRAFRLLNILDDFNREGLAIEVDFSLPACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAYIERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA
>NZ_CP041350.1|WP_019092503.1|97935_98358_-|hypothetical-protein
MRERKYTVRFTEDEAEWLQEVALDGNVSGYIRDAVLRQSKSDRKLVNMNDQLVYLGQNMRVVTDLLNDLDRKVSGKPTMPETTSSEEDGGIPDELMGIVLEILLLTRANSDRQDIRMAQGSVEYAGLPVWEGKKRSLKTG
>NZ_CP041350.1|WP_019092504.1|97499_97886_+|type-II-toxin-antitoxin-system-VapC-family-toxin
MKLLLDTHLLLWAAGEPDKLSERARTLIDDQNNILVFSAASLWEVTIKVGLVRADFQVDPYLLRRGLIENGYEELPITSQHALAVGQLPDVHRDPFDRILVAQAMVEGLLLLTHDPLVQAYPGPIEAV
>NZ_CP041350.1|WP_019092505.1|97257_97503_+|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAPEEQQQRRLGFLTGKIRVPEDFDRMGQEDIISLFDGSA
>NZ_CP041350.1|WP_019092507.1|96123_96519_+|type-II-toxin-antitoxin-system-death-on-curing-family-toxin
MTDFVWIDERDALILHDRLLAAHGGASGVRDAGLLKSALARPQQHAAYADPLDPVFLAAVYTAGIVKNHPFIDGNKRTGFVLGVLFLELNGYRFTATQEDAANAVLALAAGQMDELGYAAFLAANVVSDRV
>NZ_CP041350.1|WP_026019902.1|95899_96127_+|AbrB-family-transcriptional-regulator
MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPDGGYRLVPYDPDFETKMAKAEDIMRRYRDTLHVLAQ
>NZ_CP041350.1|WP_026019903.1|95391_95799_+|DUF2442-domain-containing-protein
MANDMNYQAAREADALHRATIPHAVSARFIRARRALHVTLSNGVEMSVPVSLIQDLQDASLNDLADIEITPLGNGLHWPRLDADVLVEGLIHGIYGSRSWMAAQMGRVGGSSASQEKAAAARRNGAKGGRPRNVA
>NZ_CP041350.1|WP_010505173.1|95228_95402_+|DUF4160-domain-containing-protein
MHVHVISADGEAVIEIGRKARLIRAGGMKDKVIQEALVIVQDHAEMLAEAWEKIHGE
>NZ_CP041350.1|WP_130732828.1|103292_103709_+|hypothetical-protein
MPEFMGDDGAMFPSHEAMAEKSGACRRTVINALNRAYALGIVKHTPRYVYDQALGKRVRTSNAYEIVLSALHQVAQAARFLMRSVRNHLSARPAHERPLSSHQPRDMKTGNSSFWVDTKWGARQPATIRVEGICLLPC
>NZ_CP041350.1|WP_019092496.1|103730_104099_-|DUF488-domain-containing-protein
MAHPIHVRRVYDPPAPDDGSRVLVDRLWPRGVSKQRADLTLWLKDIAPSTGLRQWFGHDPARWDGFQERYSAELQANPNPVQQLLDMARAGPITLLYGARDTQHNEAVVLAAYLHRLLDHAC
>NZ_CP041350.1|WP_130732827.1|104101_105310_-|NO-inducible-flavohemoprotein
MASPLDDKTRSIIKACVPALEAHGLAITTEMYRRLLANPDIRDLFNISHQKDGEQPKALALAVLAYARNIDNLGAMAGAVERIAEKHVGLNILPEHYPYVADALLGAIAHVLGDAATPDIMDAWGKAYWFLAEILIGREEQIYVAHAAAPGGWVGWRPFRVSRRTVESETVTSFELAPVDGKPVMRHVPGQYLSFRLDVPGYGSERRNYSISSAPGSQSYRISVRRIDNGVVSDWLHDSVQEGTVLQVSAPAGDFTLGNPAPAPIVFLSAGSGLTPFISMLGALDAAAATGVRYIHTTRTPATEAFGPYIRDLAAKGMLRADLFYSRATPQAAQDATGVTTHAGRMTPAWLTHEIDRSASYYICGPDSFMRDAIATLKAGGVPESQIRFEFFGSAADAALVG
>NZ_CP041350.1|WP_019092494.1|105531_105720_-|hypothetical-protein
MVGPIPETKNAMHFRWLGFTSQDPFLHTVAVHEYSRLCPLAGRSFEITLLQGLCGRHQAINL
>NZ_CP041350.1|WP_053323963.1|106181_107402_+|NarK/NasA-family-nitrate-transporter
MDTGFLKAGNPRTLLAAFLYFDVSFMVWVLLGPLGISIAHDLHLNAGQKGLLVATPVLAGALLRVLAGALVDHFGPRRVAIGAQILVIAGLFLTWLIAPHSYGALFGVALVLGVAGASFAIALPLASAWYPPQYQGTALGIAGAGNSGTALASLFAPGLAVLYGWVNVLGLATLPLTAVLVAFIFLASEPPQRRSSGGLLTWLPVLRSGDCWLLMFFYGVTFGGFVGLASFLTIYFNDQYGLPPAIAGSCTALVVFVGSFVRPLGGAMADRIGGERALSILFALAVAIFAVIGFGLPTIWLAFPAFFLGMLVLGLGNGAVFQLVPTRFPSRVGILTGLVGMSGGVGGFYLASSLGAARQATGSYGPGFLGFASVTLVAFACVGVCRRRWAAERPRMSAEADATASS
>NZ_CP041350.1|WP_159264406.1|107424_109065_+|alginate-export-family-protein
MTCISDALRPASLTVGFTTVLASLCTGHAALADTAPAAGVTATGIRPTSSRPPEKAAIHHVTLPHSPDWGAFNAGKGAAAGFGTVGGFGQARWAEDWSDIVNTPPEQRRNDWFNRLKYIPLTDKGDIWLSISGEERLRYAFENQPQMGTAGKTNASRVLLRSQYGADLHLGEHVRAYAEFLWGDAGGSNYYGYQTGVQRERLDLQQGILEVKGRMLGARMGVIGGRQIFLDAPVTMQSARDLTNAQQSWDGFRGYAVWKSFRLDLFDFMQTNKLPRNVFADGTNYNARMYGIYTSTALPKFSVMGQKSQVFADVFFIGYLFNGASAALATTTGTQAGSTRRDNIGARMWGNVGPFDISLTGVFQGGEFRPASGGATRAVRAYAVNGTLGWTAKSLKAKPSIALQGDLFSGGSYHSQDGAVGTFATPYFPLPYYNDVTLALTSQNLVGIGPVITAAPLANLRLKLHVPVFWRESTQDAVYGTGKIYSWRNGLLGGFIGTTPQTQLAWNFAPHWTWTHDIAGFVASQGMHRAGAKDGAFYMQTMEFKF
>NZ_CP041350.1|WP_010515344.1|115971_116583_+|ANTAR-domain-containing-protein
MCEDMVPGTRLRVLVADENPRRGHALSETLHADASLDVLTVPPGTALVDAVRACRPDVVLVDMNRADRDALDSIRALSCSAQERPVALFVDEDDVELMETAFDTGICSYNVLEALPRDVKPLLRAAIALYARFRRTRDELTEAQRVLAERRIIEQAKRCFMKNEKTSEAQAYRWFQRRAMQTSRRIAAVAGEYLASQKKDEAS
>NZ_CP041350.1|WP_019092084.1|116579_117575_+|ABC-transporter-substrate-binding-protein
MNTPLRIGVLKLADSAPVIMGRHQGIFARHGLETEIVVSPSWANIADGLAWNRLDAAVIFAPLAMMTALGRRGHDTGLRPLGRISRSGNTIMLRGANPVEGTWNAGSPGRQAFDLWAMSIGRKPRIAVVHMYSTHLLILRRFLKMIDVSMEDEIDLSVMPPTDMIHALAENAIDGGCVGPPWGTEAEQRGLAFRVGGSATVLPDHVEKIIVASGKLLSCDATGRRMSHALRDAIAFCQQPGRRADIARALAAPVADGGLTLPLAATEAILPGGDARECVTFAGGSLLPSDLDWIISDMTALGWVDNAEHQMLMRWIGPVPADPAPACARSL
>NZ_CP041350.1|WP_026019823.1|117596_118055_+|nitrate-reductase-maturation-protein-NarM
MLFNFEMDFTLSLRCVPMIVRMKLDLCGVKLSLRQWSRFTQHDRQALVDRPATMPPERAAYRSFLLHLIRTRAGEEPKLLPPARMEVWQLAVGVPDAITLKAQSSGLRAPTPEQWGHLSVLQRFALLKLTRPGHENQNFEPALREFLGEMYN
>NZ_CP041350.1|WP_010516903.1|118491_118959_+|hypothetical-protein
MTDGIAPAARPRMGRWLVVAIVFLGFLGQLFIQSQTLPDETPRLTIQRLTGIDIAAPVEARSCRTADSPATPVAMAHMLHVHHAQACHTSSHHHDASCPLCPLLHIPVMLHGDLPFLPFVAMAWISMRRRPQQPRAPPVYAIRLLPPLRGPPDID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041350_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041350_2

151069-151142

Orphan

Consensus_repeat	Method
TGTGCGCGATGTTCCGATAAGGCGTGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041350_2

>merge|NZ_CP041350|2|151069-151142|CRISPRCasFinder
TGTGCGCGATGTTCCGATAAGGCGTGCGCGATATTCCGAAAGAAAGCGTGCGCGATATTCCGTTGGGATGTGCG

>NZ_CP041350|2|2|151069-151142|CRISPRCasFinder
TGTGCGCGATGTTCCGATAAGGCGTGCG	CGATATTCCGAAAGAAAG
CGTGCGCGATATTCCGTTGGGATGTGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041350.1\|WP_159264416.1\|141444_141672_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_039733983.1\|153456_154443_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379293
NZ_CP041350.1\|WP_159264420.1\|160066_160264_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_159264459.1\|137675_138383_+\|VIT-family-protein	unknown	unknown	gnl\|CDD\|153123
NZ_CP041350.1\|WP_010511482.1\|151666_152485_-\|replication-initiator-protein-A	unknown	unknown	gnl\|CDD\|370826
NZ_CP041350.1\|WP_129551082.1\|136322_136805_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_019087259.1\|151282_151600_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_110571345.1\|158893_159960_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|379282
NZ_CP041350.1\|WP_054206975.1\|142768_143107_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_159264460.1\|137104_137686_+\|cytochrome-b	unknown	unknown	gnl\|CDD\|225580
NZ_CP041350.1\|WP_152927812.1\|156787_156931_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_159264457.1\|132848_134144_+\|carbohydrate-porin	unknown	unknown	gnl\|CDD\|335962
NZ_CP041350.1\|WP_010517477.1\|152575_153457_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|275105
NZ_CP041350.1\|WP_053324182.1\|157065_158433_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271180
NZ_CP041350.1\|WP_010515656.1\|141794_142103_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_010516652.1\|138675_139755_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|377531
NZ_CP041350.1\|WP_159264419.1\|155595_156696_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP041350.1\|WP_053324087.1\|155266_155545_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041350.1\|WP_159264414.1\|140234_141292_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP041350.1\|WP_159264417.1\|143288_145214_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|184353

Protein	Function_ID	Function_description	E-value
NZ_CP041350.1\|WP_010517477.1\|152575_153457_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|275105	TIGR04285, parB-like_partition_protein, nucleoid occlusion protein. This model describes nucleoid occlusion protein, a close homolog to ParB chromosome partitioning proteins including Spo0J in Bacillus subtilis. Its gene often is located near the gene for the Spo0J ortholog. This protein bind a specific DNA sequence and blocks cytokinesis from happening until chromosome segregation is complete.	6.26277e-42
NZ_CP041350.1\|WP_039733983.1\|153456_154443_-\|AAA-family-ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	1.21377e-53
NZ_CP041350.1\|WP_053324182.1\|157065_158433_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271180	cd00799, INT_Cre_C, C-terminal catalytic domain of Cre recombinase (also called integrase). Cre-like recombinases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites. The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.	4.47978e-48
NZ_CP041350.1\|WP_010511482.1\|151666_152485_-\|replication-initiator-protein-A	gnl\|CDD\|370826	pfam10134, RPA, Replication initiator protein A. Members of this family of bacterial proteins are single-stranded DNA binding proteins that are involved in DNA replication, repair and recombination.	5.66081e-86
NZ_CP041350.1\|WP_110571345.1\|158893_159960_-\|IS630-family-transposase	gnl\|CDD\|379282	pfam13592, HTH_33, Winged helix-turn helix. This helix-turn-helix domain is often found in transferases and is likely to be DNA-binding.	6.61146e-18
NZ_CP041350.1\|WP_159264460.1\|137104_137686_+\|cytochrome-b	gnl\|CDD\|225580	COG3038, CybB, Cytochrome B561 [Energy production and conversion].	1.3838e-20
NZ_CP041350.1\|WP_159264457.1\|132848_134144_+\|carbohydrate-porin	gnl\|CDD\|335962	pfam04966, OprB, Carbohydrate-selective porin, OprB family.	9.89169e-61
NZ_CP041350.1\|WP_159264459.1\|137675_138383_+\|VIT-family-protein	gnl\|CDD\|153123	cd02432, Nodulin-21_like_1, Nodulin-21 and CCC1-related protein family. Nodulin-21_like_1: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter. .	6.41594e-100
NZ_CP041350.1\|WP_010516652.1\|138675_139755_-\|IS5-family-transposase	gnl\|CDD\|377531	pfam05598, DUF772, Transposase domain (DUF772). This presumed domain is found at the N-terminus of many proteins found in transposons.	1.98778e-25
NZ_CP041350.1\|WP_159264419.1\|155595_156696_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	8.01499e-18
NZ_CP041350.1\|WP_159264414.1\|140234_141292_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.90398e-21
NZ_CP041350.1\|WP_159264417.1\|143288_145214_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|184353	PRK13832, PRK13832, plasmid partitioning protein; Provisional.	1.17836e-150

>NZ_CP041350.1|WP_159264417.1|143288_145214_-|ParB/RepB/Spo0J-family-partition-protein
MELREVDPKTLLDNPENPRKSAPNEAEERQLALNVKAVGIIHPPLVRETPGGLMIVAGHRRRRAAVKAGLKTIQVTVAGDDVELDRMRAASENMIRQPMTQVEQWRVVARLREEKKWNDTAICKALMLTPVQLKQIGRLSAILPEILAWIEAGKGPGNRELASIALASTALQEQVWGHFGFLVGSSPPEDVEACEDEGEQLPDGNWEPGAAIPDWDRIASALRQDRFYANEASFDDAIAKSCRIAWQEDLFGEAGKDGRYTDDGFAYEKAQRQWLGQNTPEDALIVQSDENGEPVFEPGMVRIYWQREGATKFFWLDHRLKVREGWCVLPGSEAAGRVTPSAVIEALPEGPRERPDISGRGFDMIGSFRTQALHAALDGMRGSADPWVLVGLMIAALNAQNVRVDGDSNAHYPQRRPSRRLVAAAGLFQDGEMALDEALLRGAAVDVLKAVLSCEKNATNSGDWGVLVGHIVKADDHLPAMADEDFLKTLSKPGITKAIKAEGILPRNTGKEMRRALMDHVGQGIWVHPAARFQVDVAALNATFAEGLVPPSGADDDDGDLAHDDDTELEDDADAGALADSPGTDDPAASGIELDEVAGASPDLAADQEDDVPHGRAESLAPPSQTPEEFLRTHVEFVGFS
>NZ_CP041350.1|WP_054206975.1|142768_143107_-|hypothetical-protein
MTHEYVTEKRLIGRYVVELGFHPDGGVLIRTPEIYPPAARRWRGPYESVEAAVVEFSAFTAVPRVTSAELARLRESGSVAEICGKDVMVCHCPWREAKTLSEFVLVREDGNA
>NZ_CP041350.1|WP_010515656.1|141794_142103_-|hypothetical-protein
MLAPFQIRKFLDLSTGHLPLSDRGHLERYARSGGSFGLTCLSGPHGWFVHVPLDPYSHDWPGSRSLRAILALARNHDCDYVLFDADGPVDASLRFFDDDEDE
>NZ_CP041350.1|WP_159264416.1|141444_141672_-|hypothetical-protein
MKLHFDHALVARLLAHAQATSEHSPTYDQLVDPAFLKAGVSSRHPTGADVDRAKIPAGLMLVGDHGVYLSAPVRR
>NZ_CP041350.1|WP_159264414.1|140234_141292_-|IS630-family-transposase
MGSPLSLRDDHDSSELRRLARRSRHAGQSRRLLALAAIYDGASRGEAALLAGTDRQSIRDWVLRFNADGPDGLVDRHGGGQKARLTQEMLSALKTRLEERPIPAVHGVVRWRLCDLCGWLHETYGVSLSETRLGQIIRREGFRLLTARPRHYRQDTEAQDIFKKSSPVFMAAIRSRHPGKDIEIWWSDEARIGQKTKLTRRWAKRGTRPRAVADLRTRSAWIFGAICPEKGAAADLVLPVCNLHGMQLHLAEISRTVAQGAHAVLIVDQAAWHTSQKLDVPYNITILPLPPRAPELNPVENLWQFLRNTWLSNRIFRTYDDIVDIACHAWNQLVNQPWRIMSIGLRNWAHGL
>NZ_CP041350.1|WP_010516652.1|138675_139755_-|IS5-family-transposase
MKQPGFFDVDERLARLSGLGDQLEAFSRTVDFEAFRPDLEKALAYSDRSKGGRPPFDPVLMFKILVIQTLNNLSDERTEYLINDRLSFMRFLGLGLSDRVPDAKTVWLFRERLTEAGAIQKLFERFDATLRNAGYLPMSGQILDATLVAAPKQRNTKGEKADLRAGRIPEDWQDKPAKMSHKDRHARWTLKFTKAKRQDDGTIPSSDLAIPFFGYKSHISIDRKFRFIRKWKTTDAAASDGARLREGLLDKTNTASSVWADTAYRSKANEDFMDKEGFVSKVHRKKPHLKPMPRHIQKSNAGKSVIRSRVEHVFADQKSQTGLFIRTVGITRATMRIGLANIVYNMRRFLFLERLNASA
>NZ_CP041350.1|WP_159264459.1|137675_138383_+|VIT-family-protein
MESRTPPRPKEIHATSRLGWLRAAVLGANDGILSTSSLIIGVASAHATQGSILLAGISSLVAGAMSMAAGEYVSVSSQADSEKADLAREKKELGSSWDAEVSELAGIYRQRGLDDILARKVALQLMKHDALGAHARDELGISEATAARPVQAALASAGAFSSGAILPVLAALLSPVGVVSWSVSAVSLIGLAVLGVVGARAGGASPWRPAMRVIFWGIVAMAMTAAIGRIFGVQT
>NZ_CP041350.1|WP_159264460.1|137104_137686_+|cytochrome-b
MIVRMNNRSSLSPARYDVPTIIFHWGCAAIIVLQFATANLWGLFQNPLHHQLVVTHLTAGMVLSVLFPARLLWRLGWGRHIRAADRWLDAVLARSVEYSLYGLVFLEIFLGYMWRWGNGQAMSFLSIQFMPPFGKFSASTISLLHWLHQWNGWLIIVLATGHALAACFHYFILRDDVFQRMLGTGDISDEYGK
>NZ_CP041350.1|WP_129551082.1|136322_136805_+|hypothetical-protein
MRLIVHYGLAILMMISISGCVAHAETDTETDGICETVEQGIRLHVDGMYGGYPHSVLRDAVLGSIACPSGDAELHAFHAIATPPPHMRISVMRPTGQGQQGSLSVMLFSQGHFVIGERMSLSPFSRTQSPFSVKADINLATARLWSDLANRIAQGKPAIP
>NZ_CP041350.1|WP_159264457.1|132848_134144_+|carbohydrate-porin
MGTFPFAYAQPVPISVLSAGVTPQQNIPDHIDPHAHLSGNWGGVRDWLLAQGIDIRISDTNELWSNPVGSAQASNNYIGSTAVEMVTDLHALTGLPLGTFDISAMEIRGRPFSNAPLYVFNQTSNIEADDNARLYELWYSQKFIGERLAFRIGKLDLGHDFMVSSVGLNFLNASFSWPILADNDLYDQGPVSPVTTPAIRLRYTLSRQWNFLFAAADDNPIGAPFINMKDPWNQNRDPSGTRFNFNTGALFFGEVHYRRQIFGRQGSYKLGGYFDTGRFPDQSDFRKSHKTNWAIYGIVDQTLQHFGRKTELDAFVRGNWTGDTDRNQIVYAIDGGIALKGPFGRTDDVLGLGAGLGAASPYLAQADRRSGLPMQGTEYHLELTYQIQATPWFMLQPDIQGIVSPSGGVLDSKGQRVHDEAIFGLHGNVTF
>NZ_CP041350.1|WP_019087259.1|151282_151600_+|hypothetical-protein
MDIGKRKLRNIAHAGKGIRPDIRNIAHINDLHLANSVIKFTPIVAQGVYEAQSLPKRHEFGTSRTFKVGLWRSDVRACDSLGDDKLWHPISSRLDILGILRFTAA
>NZ_CP041350.1|WP_010511482.1|151666_152485_-|replication-initiator-protein-A
MASNEADLFVDSLIGAPLKDDRALMEYPFFSIQKQPRMEPLVYDDGKIQITIEPGPKGLATIWDKDILLYVVSLINERIERGMTVDHTVRFAAHDLLRVTGRGTGKRSYDLLLDALHRLRSTNIMTTIESADERDRRGFGWIETWRVVERKTSTGRKIMAAIEITLNDWMFRALVKERRVLTINPTYFSLDSGLGRRIYEIGRKHLGNQEIWKISLDKLAKKIGTTRELRFFKRDLLKIIGDDVIPDYQLSLEVGPRGGRPVVIFEHRESQS
>NZ_CP041350.1|WP_010517477.1|152575_153457_-|ParB/RepB/Spo0J-family-partition-protein
MATRRKTKAPSPILGVAAGLIDDASNSFVRQDGKFRHTFEVPLTEVAPDPDQPRKSFDDESIAALAETMVAEGQLQPILVRRVTNSQSDKRWVIVAGERRWRAAQHAGWSSMLAIEHDGDAEVAALIENLQRVDLNPLEEATGIQRLIEKRGWNQSQAGEVLGKSRGEISSILKILTLPTDILEELTSERGVARNTLVELARVPDPVRQQELIEQARTGQLTVKAIRLGRADLERPESAPTRKPSGFTFTSVDRMAQRLSEVRAQQLPLNSEDRERLRRLRAEIDQVLGDENT
>NZ_CP041350.1|WP_039733983.1|153456_154443_-|AAA-family-ATPase
MRLSQADIKDELNRRLGRSYDKPKISRWENDKEPIPDDVAEVIRNMAGAVQDSARILVLANQKGGVGKTTSSLNLAYALSSLGGRVLLIDMDPQATATAGILAGASVELYHQGKTTAHLILGGKPLSEIVVAAGTLPDGRELPFDFIASHIDLAETDGRREPGFDAALREAIDPVREDYDWIVIDAPPNLGMLTWMSLAAADDAIVPVRTEPYDTMGVGLIIGTIGKIQRRLNPGLRLLGILPTQYNARKSVDREVLQHLCSMMKDRAPVLEPVPSSAVYGHAARAGRIALESSSSAAATAPYLRLAQALQTKTDFPLADIEQPESNA
>NZ_CP041350.1|WP_053324087.1|155266_155545_+|hypothetical-protein
MERTRCSETFAGHGKTEHCRTLAALAYDSKTDRSIGIDQDAAMALILKCSGGRPVNHVEMTIRYKRIIDVLFQGMKEVRDRSRCYICRFALN
>NZ_CP041350.1|WP_159264419.1|155595_156696_+|IS630-family-transposase
MGRVAVAIELTALERQELESLARARKTGQALARRARIVLAAADGHENKAIRDLTGADINTVGKWRRRFATDRLDGLYDEPRPGTPRSIGDGEIAETIRRTLEETPRGATHWSLRSMAQAVGYAPSTIHRIWKAFGLQPHRTETFKLSNDPLFVEKVRDIVGLYMAPPERALVLCVDEKSQIQALDRSQPMLPMRPGQVERRTHDYTRHGTTSLFAALDIATGTIIGKCYPKHRSTEFRKFLDQIETNVPTDLDIHLVMDNYATHKTKLIRDWLARRPRWHVHFTPTGASWINQVERFFALVTEKQIRRGIHRSTEALEADIRAFIAVHNEQPKPFKWTRSADDILQAVKRFCLRTTKISETSRSGH
>NZ_CP041350.1|WP_152927812.1|156787_156931_+|hypothetical-protein
MWHGLQREKWQVARCTVERLRAPLGYRPPAEVERAFYADQSRLDITA
>NZ_CP041350.1|WP_053324182.1|157065_158433_-|tyrosine-type-recombinase/integrase
MLSDVRILGASRRAQAALHDRVDPLTRQRLAGIELPDGTYSPDTPLAQNVPYASAAQQMAQDHVADIPSGFELAVGLEIDDGTPCFLAWFRPLQPVGACPGTADAAPPAPVGQPPAAVAQWFSVVSAQPVPEHDGRLATARQAADAYMHRSKAENTLRTYRAAVRSWCRWAAGHALPALPARSEDVAAYLADMALQGRRTSTIDLHRAALRYLHHLAQIAVPTAHPMVTATLAGIRREAKETLPRQKTALTWDRLVRVVEAISPHDLVGARDRAILLLGFAGTFRRSELAALKADDLTVDEDGMQIRLGRSKGDLQRKGALIGIPRGLTRNCPVLAYETWLRQAGITEGPVFRRIWSARDRRAGTTPVGTPPRIGPHALSDRAVTDIIRKRCGDTHLEGDFGGHSLRRGAITTGAKDGYDLLELKRFSRHKSLQVVETYIDTASIKARHPGRSRF
>NZ_CP041350.1|WP_110571345.1|158893_159960_-|IS630-family-transposase
MAGAIALRTDYTASALRRLASRTRDANVARRLLSLAAVRDGASRGEAARIGGMDRQTLRDWVHRFNAAGPDGLHDQWRNGSVCRLTADQLAELSALVTTGPDRARDGVVRWRRVDLQRVIEERFGVSYHERHVSALLKRLGFSHVSARPRHPGQDPSVMDAFKKNFPTILSAHTGHLPRGRRIELWWQDEARIGQKNGLVRQWARRGTRPRQPADQRYENAWLFGAICPALGKAAGLVLPFTGTASMQLHIEEISRCVARGAHAVVLLDRAGWHTTPKLRLPRNVSLIFLPSRAPELNPVENIWQFLRANWLSNTVFSGIEHIIEAACTAWNNLTALPQTIRSIGLRKWAHIGQR
>NZ_CP041350.1|WP_159264420.1|160066_160264_+|hypothetical-protein
MLSVFGLDTMMFGAGGNPDFLDSVKIHEGNSEPNQKVESDRMVAERDTEAVFILGSIGISDIIFK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041350_1	1.1\|102837\|33\|NZ_CP041350\|CRISPRCasFinder	102837-102869	33	NZ_CP041350	Komagataeibacter xylinus strain CGMCC 17276 plasmid pB, complete sequence	102837-102869	0	1.0

1. spacer 1.1|102837|33|NZ_CP041350|CRISPRCasFinder matches to NZ_CP041350 (Komagataeibacter xylinus strain CGMCC 17276 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

cgtttgccgtgcgccggtttggtgccaaatcca	CRISPR spacer
cgtttgccgtgcgccggtttggtgccaaatcca	Protospacer
*********************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8736 : 75258

uncultured_virus(25.0%)

transposase,integrase

attL 6908:6923|attR 41482:41497

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6908:6923	attL	NA	NA	NA	NA
WP_159264356.1\|8736_9951_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.9e-37	41.8
WP_061276280.1\|10294_10966_+	hypothetical protein	NA	NA	NA	NA
WP_010516652.1\|11162_12242_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_061276282.1\|12673_12925_-	antitoxin	NA	NA	NA	NA
WP_159264359.1\|13795_15073_-	type II restriction endonuclease	NA	NA	NA	NA
WP_159264361.1\|15303_17886_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.9e-85	35.5
WP_019087019.1\|17974_19237_+	sodium:proton antiporter	A0A2H4J428	uncultured_Caudovirales_phage	5.0e-15	32.6
WP_061276665.1\|19273_20596_-	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
WP_019092385.1\|20663_21947_-	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.8e-07	30.6
WP_019087460.1\|22216_22411_-\|transposase	transposase	NA	NA	NA	NA
WP_159261362.1\|22750_23773_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	5.9e-22	32.7
WP_061276393.1\|26313_27750_+	Si-specific NAD(P)(+) transhydrogenase	A0A2K5B2C5	Erysipelothrix_phage	5.5e-42	28.1
WP_025440224.1\|28473_28698_+	hypothetical protein	NA	NA	NA	NA
WP_061276389.1\|28698_29109_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_130732834.1\|29467_30838_+	hypothetical protein	NA	NA	NA	NA
WP_025829448.1\|31122_31398_+	formaldehyde-responsive transcriptional repressor FrmR	NA	NA	NA	NA
WP_039733241.1\|31439_32549_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A2L2DIY2	Acanthamoeba_polyphaga_mimivirus	2.5e-10	24.7
WP_039733238.1\|32608_33010_+	VOC family protein	NA	NA	NA	NA
WP_039733239.1\|33034_33862_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_082084838.1\|34037_34934_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_039733242.1\|35035_35395_+	hypothetical protein	NA	NA	NA	NA
WP_039733240.1\|35391_36012_+	NIPSNAP family containing protein	NA	NA	NA	NA
WP_159264363.1\|36209_37136_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_159264364.1\|37222_38668_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_130732964.1\|39046_40147_-	Fic family protein	NA	NA	NA	NA
WP_159264445.1\|42137_43277_+\|transposase	transposase	NA	NA	NA	NA
41482:41497	attR	NA	NA	NA	NA
WP_159264366.1\|43266_44046_+	segregation/condensation protein A	NA	NA	NA	NA
WP_159264368.1\|44166_45012_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.0e-51	46.0
WP_007396168.1\|45008_46259_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	2.8e-42	32.3
WP_159264370.1\|46447_47791_+\|transposase	IS1182 family transposase	Q9MBP7	Staphylococcus_prophage	2.9e-13	21.8
WP_159264372.1\|47935_50227_-	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_159264374.1\|50223_51624_-	DUF2791 family P-loop domain-containing protein	NA	NA	NA	NA
WP_159264376.1\|51620_53903_-	hypothetical protein	NA	NA	NA	NA
WP_010516112.1\|54024_54408_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_081500394.1\|54404_54701_-	prevent-host-death protein	NA	NA	NA	NA
WP_010516113.1\|54979_55123_-	hypothetical protein	NA	NA	NA	NA
WP_110571345.1\|56616_57683_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_159264378.1\|58538_59558_-	NAD-binding protein	NA	NA	NA	NA
WP_159264380.1\|59770_60709_+	cupin domain-containing protein	NA	NA	NA	NA
WP_159264447.1\|60963_61293_+	hypothetical protein	NA	NA	NA	NA
WP_159264382.1\|62086_63520_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_159264384.1\|64528_64678_+	DUF2474 domain-containing protein	NA	NA	NA	NA
WP_159264387.1\|64733_65267_+	nitrate reductase maturation protein NarM	NA	NA	NA	NA
WP_159264389.1\|65290_67594_+	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_159264390.1\|67608_68694_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_159264392.1\|68706_69369_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_010516126.1\|69356_69599_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_010516127.1\|69595_70018_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_019086422.1\|70056_70875_+	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_034932222.1\|70992_71400_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_035366909.1\|71384_72215_-\|transposase	IS5-like element IS1032 family transposase	NA	NA	NA	NA
WP_167518071.1\|72309_73290_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.5e-14	30.3
WP_159262340.1\|74043_75258_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.9e-37	41.8

DBSCAN-SWA_2

86755 : 158433

uncultured_Caudovirales_phage(33.33%)

transposase,integrase

attL 141753:141767|attR 160463:160477

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029329762.1\|86755_87751_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_159264451.1\|89262_90258_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_110570495.1\|91251_92595_-\|transposase	IS1182 family transposase	Q9MBP7	Staphylococcus_prophage	1.3e-16	23.1
WP_159264453.1\|92644_93001_+	hypothetical protein	NA	NA	NA	NA
WP_061276891.1\|93219_94434_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.4e-37	41.8
WP_010505173.1\|95228_95402_+	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_026019903.1\|95391_95799_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_026019902.1\|95899_96127_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_019092507.1\|96123_96519_+	type II toxin-antitoxin system death-on-curing family toxin	D0R0D2	Streptococcus_phage	1.7e-09	36.6
WP_019092505.1\|97257_97503_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_019092504.1\|97499_97886_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_019092503.1\|97935_98358_-	hypothetical protein	NA	NA	NA	NA
WP_159264404.1\|99103_100191_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.8e-43	37.5
WP_019092710.1\|101466_102567_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_019092498.1\|102617_102794_-	hypothetical protein	NA	NA	NA	NA
WP_130732828.1\|103292_103709_+	hypothetical protein	NA	NA	NA	NA
WP_019092496.1\|103730_104099_-	DUF488 domain-containing protein	NA	NA	NA	NA
WP_130732827.1\|104101_105310_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_019092494.1\|105531_105720_-	hypothetical protein	NA	NA	NA	NA
WP_053323963.1\|106181_107402_+	NarK/NasA family nitrate transporter	NA	NA	NA	NA
WP_159264406.1\|107424_109065_+	alginate export family protein	NA	NA	NA	NA
WP_010515344.1\|115971_116583_+	ANTAR domain-containing protein	NA	NA	NA	NA
WP_019092084.1\|116579_117575_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_026019823.1\|117596_118055_+	nitrate reductase maturation protein NarM	NA	NA	NA	NA
WP_010516903.1\|118491_118959_+	hypothetical protein	NA	NA	NA	NA
WP_029329762.1\|124086_125082_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_083819146.1\|125161_125464_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_159264408.1\|125832_127284_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_010516672.1\|127573_127927_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010516670.1\|127923_128346_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.7e-45	66.2
WP_159264410.1\|128345_129641_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	1.2e-133	60.2
WP_159264412.1\|129666_130365_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	7.7e-82	67.7
WP_159264455.1\|130994_132593_+	DUF4070 domain-containing protein	NA	NA	NA	NA
WP_159264457.1\|132848_134144_+	carbohydrate porin	NA	NA	NA	NA
WP_129551082.1\|136322_136805_+	hypothetical protein	NA	NA	NA	NA
WP_159264460.1\|137104_137686_+	cytochrome b	NA	NA	NA	NA
WP_159264459.1\|137675_138383_+	VIT family protein	NA	NA	NA	NA
WP_010516652.1\|138675_139755_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_159264414.1\|140234_141292_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_159264416.1\|141444_141672_-	hypothetical protein	NA	NA	NA	NA
141753:141767	attL	NA	NA	NA	NA
WP_010515656.1\|141794_142103_-	hypothetical protein	NA	NA	NA	NA
WP_054206975.1\|142768_143107_-	hypothetical protein	NA	NA	NA	NA
WP_159264417.1\|143288_145214_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_019087259.1\|151282_151600_+	hypothetical protein	NA	NA	NA	NA
WP_010511482.1\|151666_152485_-	replication initiator protein A	NA	NA	NA	NA
WP_010517477.1\|152575_153457_-	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	2.0e-10	29.4
WP_039733983.1\|153456_154443_-	AAA family ATPase	A0A240F4U1	Ochrobactrum_phage	8.8e-15	29.0
WP_053324087.1\|155266_155545_+	hypothetical protein	NA	NA	NA	NA
WP_159264419.1\|155595_156696_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152927812.1\|156787_156931_+	hypothetical protein	NA	NA	NA	NA
WP_053324182.1\|157065_158433_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
160463:160477	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041348

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041349

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP041350

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection