CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019426	Pseudomonas sp. R84 chromosome, complete genome	4 crisprs	DEDDh,DinG,csa3,cas3,WYL	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019426_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019426_1

1055730-1055892

Orphan

Consensus_repeat	Method
CCAAACACCACGGTCAGTCCCCTCTCCCTCTGGGAGAGGGCTAGGGTGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019426_1

>merge|NZ_CP019426|1|1055730-1055892|CRISPRCasFinder
CCAAACACCACGGTCAGTCCCCTCTCCCTCTGGGAGAGGGCTAGGGTGAGGGGCTTTTGATCTGTTTCAGAATCTGGATTCGACTCGGTATTTCAAGTCGGCGTATCTGTCCCAAACACCACGGTCAGTCCCCTCTCCCTCTGGGAGAGGGCTAGGGTGAGGG

>NZ_CP019426|1|1|1055730-1055892|CRISPRCasFinder
CCAAACACCACGGTCAGTCCCCTCTCCCTCTGGGAGAGGGCTAGGGTGAGGG	GCTTTTGATCTGTTTCAGAATCTGGATTCGACTCGGTATTTCAAGTCGGCGTATCTGTC
CCAAACACCACGGTCAGTCCCCTCTCCCTCTGGGAGAGGGCTAGGGTGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019426.1\|WP_160055845.1\|1059703_1061431_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226646
NZ_CP019426.1\|WP_007917611.1\|1051662_1053288_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP019426.1\|WP_160055847.1\|1061612_1062368_+\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|225097
NZ_CP019426.1\|WP_160055839.1\|1053548_1055150_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP019426.1\|WP_095119498.1\|1056759_1057476_-\|SIMPL-domain-containing-protein	unknown	unknown	gnl\|CDD\|226002
NZ_CP019426.1\|WP_160055849.1\|1062895_1063276_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_123375760.1\|1064559_1066005_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143415
NZ_CP019426.1\|WP_160055843.1\|1057791_1059054_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP019426.1\|WP_003221630.1\|1059046_1059607_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226933
NZ_CP019426.1\|WP_160055841.1\|1056185_1056587_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160055837.1\|1049764_1051363_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP019426.1\|WP_160055827.1\|1042520_1043501_-\|dipeptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236898
NZ_CP019426.1\|WP_160055835.1\|1048173_1049589_-\|outer-membrane-porin,-OprD-family	unknown	unknown	gnl\|CDD\|335381
NZ_CP019426.1\|WP_095049741.1\|1066115_1067477_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|273326
NZ_CP019426.1\|WP_095125385.1\|1042065_1042323_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_016984321.1\|1063572_1064484_+\|5-dehydro-4-deoxyglucarate-dehydratase	unknown	unknown	gnl\|CDD\|235141
NZ_CP019426.1\|WP_160055833.1\|1046500_1048096_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173858
NZ_CP019426.1\|WP_007917620.1\|1045416_1046427_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182834
NZ_CP019426.1\|WP_160055831.1\|1044479_1045406_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|182833
NZ_CP019426.1\|WP_160055829.1\|1043500_1044469_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182906

Protein	Function_ID	Function_description	E-value
NZ_CP019426.1\|WP_160055845.1\|1059703_1061431_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226646	COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only].	0
NZ_CP019426.1\|WP_007917611.1\|1051662_1053288_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP019426.1\|WP_160055847.1\|1061612_1062368_+\|FCD-domain-containing-protein	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	6.60413e-55
NZ_CP019426.1\|WP_160055839.1\|1053548_1055150_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP019426.1\|WP_095119498.1\|1056759_1057476_-\|SIMPL-domain-containing-protein	gnl\|CDD\|226002	COG3471, COG3471, Predicted periplasmic/secreted protein [Function unknown].	1.68647e-68
NZ_CP019426.1\|WP_016984321.1\|1063572_1064484_+\|5-dehydro-4-deoxyglucarate-dehydratase	gnl\|CDD\|235141	PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional.	0
NZ_CP019426.1\|WP_123375760.1\|1064559_1066005_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143415	cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like. Kinetic studies of the Bacillus subtilis ALDH-like ycbD protein, which is involved in d-glucarate/d-galactarate utilization, reveal that it is a NADP+-dependent, alpha-ketoglutaric semialdehyde dehydrogenase (KGSADH). KGSADHs (EC 1.2.1.26) catalyze the NAD(P)+-dependent conversion of KGSA to alpha-ketoglutarate. Interestingly, the NADP+-dependent, tetrameric, 2,5-dioxopentanoate dehydrogenase (EC=1.2.1.26), an enzyme involved in the catabolic pathway for D-arabinose in Sulfolobus solfataricus, also clusters in this group. This CD shows a distant phylogenetic relationship to the Azospirillum brasilense KGSADH-II (-III) group.	0
NZ_CP019426.1\|WP_160055843.1\|1057791_1059054_+\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	3.13402e-33
NZ_CP019426.1\|WP_003221630.1\|1059046_1059607_+\|response-regulator-transcription-factor	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	6.77072e-94
NZ_CP019426.1\|WP_160055837.1\|1049764_1051363_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP019426.1\|WP_160055827.1\|1042520_1043501_-\|dipeptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	0
NZ_CP019426.1\|WP_160055835.1\|1048173_1049589_-\|outer-membrane-porin,-OprD-family	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	1.89716e-142
NZ_CP019426.1\|WP_095049741.1\|1066115_1067477_+\|MFS-transporter	gnl\|CDD\|273326	TIGR00893, Probable_glucarate_transporter, D-galactonate transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.01085e-158
NZ_CP019426.1\|WP_160055833.1\|1046500_1048096_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173858	cd08493, PBP2_DppA_like, The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP019426.1\|WP_007917620.1\|1045416_1046427_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182834	PRK10914, PRK10914, dipeptide ABC transporter permease DppB.	4.81678e-165
NZ_CP019426.1\|WP_160055831.1\|1044479_1045406_-\|ABC-transporter-permease-subunit	gnl\|CDD\|182833	PRK10913, PRK10913, dipeptide ABC transporter permease DppC.	4.04809e-142
NZ_CP019426.1\|WP_160055829.1\|1043500_1044469_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182906	PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional.	1.09734e-163

>NZ_CP019426.1|WP_160055839.1|1053548_1055150_-|ABC-transporter-substrate-binding-protein
MPRFTLKPLLISLALATTAPLANAATTLVYCSEASPAGFDPSQYTSGTDFDASAETVFNRLTQFKRGGTDIEPGLATKWDISNDGLQYTFHLRQNVKFHTTDYFKPTRDFNADDVLFTFQRLLDPDNAFRKAYPAESPYFTDMGLNTTIKSVEKLDDQTVRFNLNNVDAAFVQNLAMSFASVQSAEYAAQLLKEGKAADLNQKPIGTGPFVFKRYQKDSQIRYAANTAYWKPEDVQIDNLIFSITPDAAVRLQKLKAGECQVSGYPRPADIEVMEKDPNLRVLKQAGFNLGFLAYNTTHAPLDQLKVRQALDMAIDKPAIIKAVYQSAGQLAQNALPPAQWSYDTNIKDAPYDPIKARVLLKEAGVAPGTTINLWAMTVQRASNPNARMSAQMIQQDWEKIGIKANIVSYEWGEYIKRAKNGEHDAMIYGWTGDNGDPDNWLGVLYSCAAVKGSNYAKWCDPAYDNLVQQAKLATDKDQRVKLYQQAQLILKQQVPITPIANSTVFQPLRKEVTDFRISPFGLTPFYGVGINK
>NZ_CP019426.1|WP_007917611.1|1051662_1053288_-|ABC-transporter-substrate-binding-protein
MLKHAVIPFLVGAGLLASAPFASAATNLVFCSEGSPAGFDPGQYTTGTDFDASAETMFNRLTQFERGGTAVIPGLATKWDISDDGLTYTFHLREGVKFHTTPYFKPTREFNADDVLFTFNRMINKDDPFRKAYPTEFPYFTDMGMDTNITKIDKVDDHTVKFTLKEVDAAFIQNMAMSFASVQSAEYAAQLLKEGKAADINQKPIGTGPFVFKSYQKDSNIRYTGNKDYWKPEDVKIDNLIFAITTDPSVRIQKLKKNECQVTLFPRPADLKALKEDKTLKMPDQAGFNLGYIAYNVMDKVKGSNEANPLADLRVRQALDMAVNKPQIIDSVYQGAGQLAVNAMPPTQWSYDTTIKDAKYDPEKAKQLLKEAGVKEGTEIVLWAMPVQRPYNPNAKLMAEMLQSDWAKIGLKVKITSYEWGEYIKRSKGGENQAMIIGWSGDNGDPDNWLNVLFGCDSLSGNNFSKWCDKKFDGLVKEAKRTTDQGKRTELYKQAQHVLKDAVPMTPIAHSTVYQPMRANVQDFKISPFGLNSFYGVSVSK
>NZ_CP019426.1|WP_160055837.1|1049764_1051363_-|ABC-transporter-substrate-binding-protein
MRHTLIFSALLGAGLMAAASTSFAASKSLVFCSEGSPAGFDTAQYTTATDNDAAEPIYNRLVEFEKGATNVVPGLATTWDISEDGLKYTFHLREGVKFHTTPYFKPTRDFNADDVLFTFNRMLDAQQPFRKAYPTEFPYFNGMSLNKNIAKVEKTGPLTVEFTLNSVDAAFIQNIAMSFAAILSAEYADKLLAEGKPSDINQKPIGTGPFVFKSYQKDSNIRYTGNKHYWDPSRVKLDNLIFAINTDASVRVQKLKAGECQITLHPRPADVEALKADPKLQLISKPGFNLGYIAYNVRHKPFDQLEVRQALDMAVNKQGILDAVYQGAGQLAVNAMPPTQWSYDDSIKDAAYNPEKAKELLKAAGVKEGTEITLWAMPVQRPYNPNAKLMAEMLQADWAKIGLKVKIVSYEWGEYIKRTKNGEHDISLIGWTGDNGDPDNWLGTLYSCDAIGGNNYSMWCDPAYDKLIKQAKVVTDRDQRTVLYKQAQQLLKQQVPITPVAHSTVNQPLSARIEGFKVSPFGRNVFSGVGID
>NZ_CP019426.1|WP_160055835.1|1048173_1049589_-|outer-membrane-porin,-OprD-family
MKLSSTAILALAISSITATAYAETQSQAFTPVSVNEKSAQAEATGFLEGQSISGSTRNWYANEQLKRGGKFAYRKNGQSTETDRRINWVQGTIIKYNSGFTEGTVGFSTEVAAYNAIALERDRENLASNNGGAPGTRPGAGNNRTLTREGGDAVGQWSKLGLANVKARISNTTLTAGRMNFSSPQVDVIGNRPLPSSFEGIAIHSEELNNLSFDLATFDRVSPRTEESLSKFRSEYGSIDAEADHVNTAGISYQPFASLTTSLWGTQAEDLWNQYYFGATHVLGDSSVLSLTTGLNYYKTVDEGKKLLGDIDNDTYSLSFGLTHLAHTLTFSYQEVNGNEYFDYLHETNGIYLANSLLSDFNGPNEKSFQISYGINMAEYGVPGLKFNIYQARGWGIDGTHYKGGGYDGVQAMDGEHHYEYGVGATYAVQSGPLKATTIRGTYTAHRASENQADGSINEFRLVTTIPFNIL
>NZ_CP019426.1|WP_160055833.1|1046500_1048096_-|ABC-transporter-substrate-binding-protein
MKMLPLRAAIAAALLSAAIGVSAKPLVVCTEASPEGFDMVQYTTAVTADAVAETIFNRLVDFKPGTTEIVPALADTWEISEDGLTYTFHLRQGVKFHTTEYFKPTRDMNADDVVWSFQRQLDPNHPWHKLSSVGFPYFESMGFKELLKSVEKIDDHTVKFTLTRREAPFLADVAMPFTAIYSAEYADQLLKANKTGDLNNKPVGTGPFIFQRYAKDAQVRFKANPEYFRGKPPADALILAIATDNNVRLQKLKANECQIALYPKPDDIPSIKKDDKLKVEELNAMTVSYIAMNTQHKYMSDVRVRKAIDIAFDKAAYVNALFGPGNATVAVNPYPDTLLGYNHDLKNPPRDLDKARALLKEAGVPDGTVFTLFTRNGGGPTNPNPMLGAQMMQADLAKVGIKIDIRVMEWGEMLKRAKAGEHDMVSAGWAGDNGDPDNFLTPMLSCEAAKNGENYARWCNEKFQALLDEARAKVDPAERAKLYEQAQVLFNQDQPWISMAHTRMFTAMRNNVEGYHISPLTTNNFATTQVK
>NZ_CP019426.1|WP_007917620.1|1045416_1046427_-|ABC-transporter-permease-subunit
MFSFIARRLGLLIPTFFGITLLTFALIRMIPGDPVEVMMGERRVDPEMHAQAMERLGLNKPLYAQYLDYIGKLAQGDLGESLRTRESVWTEFTSLFPATLELSMAALLFAGILGLLAGVIAALKRGSLFDHGVMGISLAGYSMPIFWWGLILIMFFSVSLGWTPVSGRIDLLYDIEPRTGFMLIDTLLADDVGAFFDALHHLILPAIVLGTIPLAVIARMTRSSMLEVLREDYIRTAKAKGLSPSRVVFVHGLRNALIPVLTVVGLQVGTLLAGAVLTETIFSWPGIGKWLIEAIGARDYPVVQNGILLIACLVILVNFVVDILYGFANPRIRHQR
>NZ_CP019426.1|WP_160055831.1|1044479_1045406_-|ABC-transporter-permease-subunit
MSTPTSSVATSAANADQSLLYPSPYKEFWQAFSKNKGAVAGLLFMSLVIFCALFAPWVAPHNPSEQYRDFLLTPPAWLEGGQMQFLLGTDELGRDLLSRLIQGSRLSLLIGLSSVVMSLIPGILLGLFAGFFPKMIGPTIMRLMDIMLALPSLLLAVAIVAILGPGLINTVIAIAVVSLPSYVRLTRAAVMGELNRDYVTAARLAGAGLPRLMFITVLPNCMAPLIVQATLSFSSAILDAAALGFLGLGVQPPTPEWGTMLASARDYIERAWWVVSLPGLTILLSVLAINLMGDGLRDALDPKLKNAA
>NZ_CP019426.1|WP_160055829.1|1043500_1044469_-|ATP-binding-cassette-domain-containing-protein
MSLLEIKNLNVRFGDKTATPVVDGLDLKVDKGEVLAIVGESGSGKSVTMMALMGLIEHPGIVTADSLSFDGKDMLKLSNRQRRQIVGKDLSMVFQDPMTALNPSYTVGFQIEEVLRLHLKMSGKQARKRAIELLEKVEIPGAASRMDAYPHQLSGGMSQRVAIAMAIAGEPKLLIADEPTTALDVTIQAQIMDLLLALQKEQNMGLVLITHDLAVVAETAQRVCVMYAGQAVEVGQVPQLFDIPAHPYSEALLKAIPEHSLGATRLATLPGIVPGRYDRPQGCLLSPRCPYVQDSCRAQRPGLDPKAHSLARCFYPLNQEVA
>NZ_CP019426.1|WP_160055827.1|1042520_1043501_-|dipeptide-ABC-transporter-ATP-binding-protein
MAVVLTARDLTRHYEVSRGLFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARALTLIEDPSSGSLKIAGQEVAGADKAQRKQLRKDVQMVFQSPYASLNPRQKVGDQLGEPLLINTNLSAAERREKVQAMMKQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEPTSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVQHVADDVMVMYLGRPVEMGPKNDIYERPLHPYTQALLSATPTIHPDPNKPKIKIVGELPNPLNPPPGCAFHKRCPYATERCSTEEPALRQLDSRQVACHYAEQFLDGAA
>NZ_CP019426.1|WP_095125385.1|1042065_1042323_+|hypothetical-protein
MKSRLLRVLLLLKVMVMLSLGTATAWAECEDHESQAFNGQVGHSGLMLAKSESEPGDQGQGGSADDDDSTTDDPDTDDDEGDSQS
>NZ_CP019426.1|WP_160055841.1|1056185_1056587_+|hypothetical-protein
MAEGGSNDEQIFMKDKIVPDPPLESTSPLEDAIRADDQIKTREAIKRALDFYLSPEPIKPRQPSTMFLIQPNIDTESLLAHACESLASANTLIGNFADQLGRPERNTALAIQQIIMLAELAVNRALDRVDPQT
>NZ_CP019426.1|WP_095119498.1|1056759_1057476_-|SIMPL-domain-containing-protein
MHTFRRSAALLALTVGSVASLPALAADELHYNQISLRAEVSTEVARDLMIVTLYTEEQNTDPAKLAADVSTTMNKALAQAKQVKDITLRQGSRNSYPIYDTKGQKITGWRERAELRLESADFAALSKLTGELLGDLKMGGMDFAIADPTRKSSEDQLLKEAVTAFKARAQLATDALGGKGYKIVNLNLNSNGYPQPYLRAPMMMKAAAMDSAPVTPEVEAGTSQVSMTADGSIEVLMQ
>NZ_CP019426.1|WP_160055843.1|1057791_1059054_+|sensor-histidine-kinase
MLAPVQLTSATRQNLWRLTFIRTLVLAAQAGSVGLAYWLQLLPLPWVQLAMTLGCSTLLCVFTAVRLRTSWPVTELEYALQLACDLVIHSALLYFSGGSTNPFVSYYLVPLTIAAVTLPWRYSVILSGIALALYTVMLTRFYPLETLPVARENLQIYGMWLSFALAAAVITFFAARMAEELRRQEELRAIRREEGLRDQQLLAVATQAAGAAHELGTPLATMSVLLKEMQQDHPDPMLQDDLKVLQDQVKLCKETLQQLVRAAEANRRLAVEMQDVTDWLDEALNRWHLMRPEASYRFHRLGQGTVPRMAPPPDLTQALLNLLNNAADACPENLKVTLDWDLENLTISIRDHGAGVPLAIAEQIGKPFFTTKGKGFGLGLFLSKASVTRAGGSVKLYSHEEGGTLTELRLPHGARGDQHE
>NZ_CP019426.1|WP_003221630.1|1059046_1059607_+|response-regulator-transcription-factor
MSDEIQVEGEELPHLLLVDDDATFTRVMARAMARRGFRVSTAGSAEEGLTIAQADLPDYAALDLKMDGDSGLVLLPKLLELDPEMRVVILTGYSSIATAVEAIKRGACNYLCKPADADDVLAALLSEHADLDSLVPENPMSVDRLQWEHIQRVLTEHEGNISATARALGMHRRTLQRKLQKRPVRR
>NZ_CP019426.1|WP_160055845.1|1059703_1061431_+|ATP-binding-cassette-domain-containing-protein
MNQNAEYSAVNDAVRGQFFRKVWAIITPYWRSEEKGKAWTLLIAVIALSLLSVGISVWFNTWYKDFYNALQKKDEAAFWRLILYFCGIAAVAIIGAVYRLYLTQMLTIRWRAWLTEKHFSRWLADKNYYQLEQGGYTDNPDQRISEDLNNFTSNTLELGIGLLRNIVSLVSFSIILWGVSGSIEIYGVTIPGYMFWCVLVYAVVGSWLTHLIGRRLIGLNNQQQRFEADLRFSMVRIRENAESIALYNGEPNENRRLSARFGNVWHNFWDIMKVSKRLTFFTAGYSQAAIIFPFIVASPRYLAGKIELGELMQISSAFGNVQESFSWFISAYQSLAAWRATCDRLLSFRQAMTDNEQRVPAIDVQNQGSELKVHKLGLDLADGRHLLTSADMTVEPGERVMLSGRSGSGKSTLLRAMGHLWPAGHGNIRLPAARYLFLPQKPYLPIGTLREALSYPQPGDTYAPERYAQVLETCRLPHLVARLDEANHWQRMLSPGEQQRLAFARALLYAPQWLYMDEATSAMDEEDEATLYQALIDQLPGLSIVSVGHRSSLKRFHPRHVRIDSGHLVEQTVTA
>NZ_CP019426.1|WP_160055847.1|1061612_1062368_+|FCD-domain-containing-protein
MHTMENLIDTPRLPRKRRSLAQELVTVLSEQIRDGLLKRGDKLPTESAIMEAHGVSRTVVREAISRLQAAGQVETRHGIGTFVLDTPSPSGFRIDPATVVTLRDVLAILELRISLEVESAGLAAQRRSPEQLATMRAALDALNESAAHASDAVASDFAFHLEIALSTGNRYFTDIMTHLGTSIIPRTRLNSARLAHDDQQHYMGRLSREHEEIYDAIARQDSDAARAAMRLHLTNSRERLRQAHEEAQAQG
>NZ_CP019426.1|WP_160055849.1|1062895_1063276_-|hypothetical-protein
MFVNYAAPTLAQIASSASAPLTLQLSALPDVLIVQVPDSSDFPANWSVYPILGEDPEEPEWAGEEVDTGTWDDAEDEMEKLTGIELQLPKEVLRPYLNREVELRYKFCDESSMEPFSQVLRLRIEG
>NZ_CP019426.1|WP_016984321.1|1063572_1064484_+|5-dehydro-4-deoxyglucarate-dehydratase
MNPQELKSILSAGLLSFPVTDFNAQGDFNRAGYIKRLEWLAPYGASALFAAGGTGEFFSLAASEYSEIIKTAVDTCETSVPILAGVGGSTRQAIEYAQEAERLGAKGLLLLPHYLTEASQDGVAAHVEAVCKSVNIGVVVYNRNVCRLTAPLLERLAERCPNLIGYKDGLGDIELMVSIRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYHAIAREDHATVGKIIDDFFLPYLDIRNRKAGYAVSIVKAGAKIAGYDAGPVRAPLTDLTGEEYEMLAALIDKQGAQ
>NZ_CP019426.1|WP_123375760.1|1064559_1066005_+|aldehyde-dehydrogenase-family-protein
MTTAKRYDNYINGEWVAGADYSANINPSELSDTIGDYAKADLTQVHAAIDAARAAFPAYSTSGIQARHDSLDKVGTEILARREELGTLLAREEGKTLPEAIGEVTRAGNIFKFFAGECLRLSGDYVPSVRPGVNVEVTREALGVVGLITPWNFPIAIPAWKIAPALAYGNCVVLKPADLVPGCAWALAEIISRAGFPAGVFNLVMGSGRVVGDALVQSPKVDGISFTGSVGVGRQIAVNCVSRQAKVQLEMGGKNPQIILDDADLKQAVELSVQSAFYSTGQRCTASSRLIVTAGIHDKFVEAMAERMKSIKVGHALKSGTDIGPVVSQAQLEQDMKYIDIGQSEGARLVSGGGLVTCDTEGYFLAPTLFADSEASMRISREEIFGPVANIVRVADYDAALAMANDTEFGLSAGIATTSLKYANHFKRHSQAGMVMVNLPTAGVDYHVPFGGRKGSSYGSREQGRYAQEFYTVVKTSYIGS
>NZ_CP019426.1|WP_095049741.1|1066115_1067477_+|MFS-transporter
MQSSKPTHVRYLILLMLFLVTTINYADRATIAIAGSSLQKDLGIDAVTLGYIFSAFGWAYVAGQIPGGWLLDRFGSKKVYALSIFTWSLFTVLQGFVGEFGMSTAIVALFMLRFLVGLAEAPSFPGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAPLMGWIVYSFGWEHVFIVMGILGIIFSLVWLKVIYSPREHPRINEAEFKHIAENGGMVDMDQKGKKSDGPKWDYIRQLLTNRMMLGVYLGQYCINGITYFFLTWFPVYLVQERGMTILKAGFIASLPAICGFIGGVLGGVISDYLLRKGHSLTFARKAPIIAGLLVSSSIVACNYVEVEWMVVGFMALAFFGKGVGALGWAVVSDTSPKQIAGLSGGLFNTFGNIASITTPIVIGYIISSTGSFKWALVFVGANALVAVFSYLVIVGPIKRVVLKEPPTNGGTEATGKLSQAHS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019426_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019426_2

2521039-2521131

Orphan

Consensus_repeat	Method
CTGTAGGAGTGAGCCTGCTCGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019426_2

>merge|NZ_CP019426|2|2521039-2521131|CRISPRCasFinder
CTGTAGGAGTGAGCCTGCTCGCGATGGCGGCCTGACAGCCGACCAATATCTTCCAGATGTACATGATCCCTGTGGGAGTGAGCCTGCTCGCGA

>NZ_CP019426|2|2|2521039-2521131|CRISPRCasFinder
CTGTAGGAGTGAGCCTGCTCGCGA	TGGCGGCCTGACAGCCGACCAATATCTTCCAGATGTACATGATCC
CTGTGGGAGTGAGCCTGCTCGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019426.1\|WP_160057315.1\|2528138_2528333_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160057307.1\|2520372_2520630_+\|DUF1652-domain-containing-protein	unknown	unknown	gnl\|CDD\|311697
NZ_CP019426.1\|WP_160057311.1\|2525482_2525911_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160057309.1\|2523083_2524151_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270703
NZ_CP019426.1\|WP_160057305.1\|2518341_2518533_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160057303.1\|2516847_2517276_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160057306.1\|2518738_2520235_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|225107
NZ_CP019426.1\|WP_160060073.1\|2521575_2522175_+\|TRIC-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP019426.1\|WP_160057302.1\|2515024_2516671_+\|malate-dehydrogenase-(quinone)	unknown	unknown	gnl\|CDD\|179979
NZ_CP019426.1\|WP_034152479.1\|2522293_2523061_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180802
NZ_CP019426.1\|WP_095120253.1\|2514122_2514554_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379639
NZ_CP019426.1\|WP_160057312.1\|2525910_2526402_-\|DUF4822-domain-containing-protein	unknown	unknown	gnl\|CDD\|379766
NZ_CP019426.1\|WP_160057304.1\|2517710_2518157_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240044
NZ_CP019426.1\|WP_160057300.1\|2511600_2512122_-\|superoxide-dismutase-family-protein	unknown	unknown	gnl\|CDD\|182357
NZ_CP019426.1\|WP_141129811.1\|2511126_2511441_-\|DUF2388-domain-containing-protein	unknown	unknown	gnl\|CDD\|274137
NZ_CP019426.1\|WP_160057301.1\|2512367_2513981_+\|MCP-four-helix-bundle-domain-containing-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP019426.1\|WP_160057313.1\|2526759_2527284_-\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NZ_CP019426.1\|WP_160057308.1\|2521327_2521540_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234700
NZ_CP019426.1\|WP_160057310.1\|2524341_2525310_-\|2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240633
NZ_CP019426.1\|WP_160057314.1\|2527503_2527887_-\|tautomerase-family-protein	unknown	unknown	gnl\|CDD\|379645

Protein	Function_ID	Function_description	E-value
NZ_CP019426.1\|WP_160057307.1\|2520372_2520630_+\|DUF1652-domain-containing-protein	gnl\|CDD\|311697	pfam07865, DUF1652, Protein of unknown function (DUF1652). This is a family containing hypothetical bacterial proteins.	3.55983e-16
NZ_CP019426.1\|WP_160057309.1\|2523083_2524151_-\|phosphotransferase	gnl\|CDD\|270703	cd05154, ACAD10_11_N-like, N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.90129e-96
NZ_CP019426.1\|WP_160057306.1\|2518738_2520235_+\|PAS-domain-S-box-protein	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	9.86167e-26
NZ_CP019426.1\|WP_160060073.1\|2521575_2522175_+\|TRIC-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	1.51885e-48
NZ_CP019426.1\|WP_160057302.1\|2515024_2516671_+\|malate-dehydrogenase-(quinone)	gnl\|CDD\|179979	PRK05257, PRK05257, malate:quinone oxidoreductase; Validated.	0
NZ_CP019426.1\|WP_034152479.1\|2522293_2523061_-\|SDR-family-oxidoreductase	gnl\|CDD\|180802	PRK07035, PRK07035, SDR family oxidoreductase.	0
NZ_CP019426.1\|WP_095120253.1\|2514122_2514554_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379639	pfam14534, DUF4440, Domain of unknown function (DUF4440).	1.14685e-21
NZ_CP019426.1\|WP_160057312.1\|2525910_2526402_-\|DUF4822-domain-containing-protein	gnl\|CDD\|379766	pfam16103, DUF4822, Domain of unknown function (DUF4822). A lipocain-like domain found in functionally uncharacterized bacterial proteins, often as a repeat of two domains. Proteins with this domain are found in a wide range of bacteria and are often annotated as S-layer proteins, but the origin of this annotation is not clear.	4.48361e-16
NZ_CP019426.1\|WP_160057304.1\|2517710_2518157_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240044	cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.9317e-43
NZ_CP019426.1\|WP_160057300.1\|2511600_2512122_-\|superoxide-dismutase-family-protein	gnl\|CDD\|182357	PRK10290, PRK10290, superoxide dismutase [Cu-Zn] SodC2.	3.3699e-73
NZ_CP019426.1\|WP_141129811.1\|2511126_2511441_-\|DUF2388-domain-containing-protein	gnl\|CDD\|274137	TIGR02448, conserved_hypothetical_protein, conserverd hypothetical protein. This family consists of small hypothetical proteins, about 100 amino acids in length. The family includes five members (three in tandem) in Pseudomonas aeruginosa PAO1, and also in Pseudomonas putida KT2440, four in Pseudomonas syringae DC3000, and single members in several other Proteobacteria. The function is unknown.	8.51294e-33
NZ_CP019426.1\|WP_160057301.1\|2512367_2513981_+\|MCP-four-helix-bundle-domain-containing-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.09689e-61
NZ_CP019426.1\|WP_160057313.1\|2526759_2527284_-\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.57828e-48
NZ_CP019426.1\|WP_160057308.1\|2521327_2521540_+\|hypothetical-protein	gnl\|CDD\|234700	PRK00249, flgH, flagellar basal body L-ring protein FlgH.	0.000404703
NZ_CP019426.1\|WP_160057310.1\|2524341_2525310_-\|2-hydroxyacid-dehydrogenase	gnl\|CDD\|240633	cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase. Hydroxy(phenyl)pyruvate reductase (HPPR) catalyzes the NADP-dependent reduction of hydroxyphenylpyruvates, hydroxypyruvate, or pyruvate to its respective lactate. HPPR acts as a dimer and is related to D-isomer-specific 2-hydroxyacid dehydrogenases, a superfamily that includes groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-Adenosylhomocysteine Hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	2.0206e-131
NZ_CP019426.1\|WP_160057314.1\|2527503_2527887_-\|tautomerase-family-protein	gnl\|CDD\|379645	pfam14552, Tautomerase_2, Tautomerase enzyme.	1.93141e-35

>NZ_CP019426.1|WP_160057307.1|2520372_2520630_+|DUF1652-domain-containing-protein
MMNLAQLRAQLERSFSPLACECLVDGDHSLTVKLYHPVSGQVDLVISGLKLDGLRSPESVEALVEELRYELESNSLRSSRDSGLA
>NZ_CP019426.1|WP_160057306.1|2518738_2520235_+|PAS-domain-S-box-protein
MSQEVLTTETNRRQLQQIIAGLSDGVILLELDQRILWANEAALVMHGVKRITDLGHNADEYAKKFNLRYRNNHSITAENYPISRVARCESFNDVLIEVSPSDDPERIWVHSVRSMILTDREGQPESLVLIMSDVTDWANAEQRFERTFNANPAPAVICRLSDLRYIKVNSGFLDMTGYTREQVIGTSSYEIDIFEQAEHRDLAIQRLRDVATIPQMQAELRLPDGSSKQVIVAGQPLTLNDEDCMLFSFVDMELRHKAEVALRQSEERFAKAFRLTPVPILICSADEQQVIDVNQAFLETLAYDSEDVLGKTVTQLDFIDDSGARTRLLAALAKNGRVDRVDVRVRRKDADLLECALSADTVNIQDTPCYLLVLMDITERKRTELELVAAIEEVMKDASWFSRTLIEKLANVKKVNSPQLPTVSFTDLTARERDVLGLICEGLADKEIAARLKLAPNTVRNHVATVYSKLDVHSRSEAIVWARERGLFSGESGGKGQR
>NZ_CP019426.1|WP_160057305.1|2518341_2518533_-|hypothetical-protein
MTSRRNIEQTYRAWSSPILLELKKREHQMAPVERQALENVLVERRLLDSGGPEGIERRRNNGG
>NZ_CP019426.1|WP_160057304.1|2517710_2518157_+|NUDIX-domain-containing-protein
MAEQRIRALALCVFHHNGKILVNEFRDPVSQQTCFRPIGGGIEFGETSAEAIVREVQEELGLSVSDVRLLGTLESLFVYNGKPGHEIVQVYDATFIDRSVYAHPQIDGHESDGAPFTARWHDSSSFSALAPLVPKGLHDMLENAGLLV
>NZ_CP019426.1|WP_160057303.1|2516847_2517276_-|nuclear-transport-factor-2-family-protein
MTDLNLQANVAESLKQWHEMIRTGSLSALPSLLDPQAVFRSPMAHTPYPGAPVVSMILNTVFEVFEDFIYHRELATADGLNVILEFSAKVGSKELKGIDMIRFNEHGKIVEFEVMVRPLSGLQALGEEMGRRLGAYLAKAKA
>NZ_CP019426.1|WP_160057302.1|2515024_2516671_+|malate-dehydrogenase-(quinone)
MFKKVNTALLGLALAMGMTSANADEAKKVDVLLIGGGIMSTTLGVWINELEPSWSMEMVERLDGVALESSNGWNNAGTGHSALAELNYTPEDDKGNVTIPKAVEINEAFQVSRQFWAWQVQQGVLKNPRSFINTTPHMSFVWGDDNIKFLKKRYEALQASPLFAGMQYSEDPAVIKKWVPLMMEGRDPNQKIAATWSPLGTDMNFGEITRQFAAHLQTKPNFDLKLSSEVQDITKNADGTWRVSYKNLKDGTKTETDAKFVFIGAGGGALHLLQKSGIPEAKEYAGFPVGGSFLVTDNPAIAEQHLAKAYGKASVGAPPMSVPHLDTRVLDGKRVILFGPFATFSTKFLKEGSYLDLLTSTTTHNIWPMTKVGIKEYPLVEYLAGQLMLSDEDRLNALKEYFPNAKAEDWRLWQAGQRVQIIKRDEAAGGVLKLGTEIVAAQDGSIAGLLGASPGASTAAPIMLSVLQKVFKDKVASPEWQTKLHQIVPSYGTQLNSDPAKVAAEWAYTAKILELPTPPVIGQVTAPAAPAAEKAEAPKENAARDMAL
>NZ_CP019426.1|WP_095120253.1|2514122_2514554_-|nuclear-transport-factor-2-family-protein
MTKTRLLIGFLCAFNGYAMAASAPAEKDVAQAVDHLTQAMLHKDIAELNALTAPNLTYGHSSGKIQDKKEFIADIETGKSAFKTLEMQNQTITLSGDTALVRHHFSAQALKGTEVIPTEIENFQIWQKQDGKWLLVGRQAFKF
>NZ_CP019426.1|WP_160057301.1|2512367_2513981_+|MCP-four-helix-bundle-domain-containing-protein
MSIKLRLVLLIVTSLLTALIVSLVSYVGNQRMASAVSDNAVSMSALRNHMEADMMHDALRADVYSAMLVGLGKSTSTASEVRDSINEHAGHFREVLEENLKLPINPRLRTALEKIKPSLDTYINAGERIVGLALDNPDAAQQELGTFNTAFGQLEEQMAALSESIESNTLQTSAATESAIRSANVALGVVLIASLVLLLIQGRWVILSIMGPLKTASRIAESIAHGNLSELIAEPSGKDEASVLIRTLATMQRDLRNMIDVVRRNAHGVSGMSEQLSHGCHQVADSSQQQSVAAGTMAAAASQMTASIEEITRHAERALSMANQAETLAKEGGGVIHQVVSDMDDIARSAQQSAQVIRTLDQESEAIFNIIQVIKSIADQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAARTSASTQEIAAMVARIQHSTREAVSSMEAGVAQVDKGMAVTADVERAIREILEATLSTTQLVNDITRTIGEQSQASNEIAHQVEMIAGMSEGNSRVIGQTANTTDELSSLAGQLAQSVDRFRL
>NZ_CP019426.1|WP_160057300.1|2511600_2512122_-|superoxide-dismutase-family-protein
MKRALWLGLLGTFAIGTAQAATEKVAINLVSADGAPQAIGSVTISETAYGLLFTPDLKSLPAGIHGFHVHENGSCEAGMKDGVKGAALAAGGHFDPQKTGKHLGPYADGHLGDLPAVYVTADGIANYPVLAPRLKKISEIKGHALMIHAGGDNHADMPKPLGGGGDRMACGVI
>NZ_CP019426.1|WP_141129811.1|2511126_2511441_-|DUF2388-domain-containing-protein
MRKLVLVSSLLLCLPVGSALAKVDAGDVATSAGVSASLYSTFKDHKMVIPARDDLSAFVASGGAIRGVYLESVLQQVRQDNPGINASDEDLANAILVHYEGLNQ
>NZ_CP019426.1|WP_160057308.1|2521327_2521540_+|hypothetical-protein
MNNLGKRVLPLVFFTVLLAGCASPPPPPPVAPPPPPERTCQVLENTEVAGDVYADGQVTRHITTTRCVTQ
>NZ_CP019426.1|WP_160060073.1|2521575_2522175_+|TRIC-cation-channel-family-protein
MLVADLAGTAVFAVEGAIAAMRSQLDLLGVMVIAFIVALGGGVTRDLLIGATPPNAVADWRYPALAFFMGGLAFVFHEQVLGWSGSTLIVLDAAGLALFAVAGAQKALNYGITPFVAMLMGTITGVGGGVIRDIVLARIPVVLQADLYASSAFVGAAVLIVARRLGVSPVAAALLAGAGCLMLRLLSVHFGWQLPRVIA
>NZ_CP019426.1|WP_034152479.1|2522293_2523061_-|SDR-family-oxidoreductase
MSKTQLFDLDGKIAFVSGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQHVADAIIAAGGKATAVACHIGEMEQISQVFAGIKEQFGRLDILVNNAATNPQFCNVLDTDLSAFQKTVDVNIRGYFFMSVEAGKLMRENGGGSIINVASINGISPGIFQGIYSVTKAAVINMTKVFAKECAQFGIRCNALLPGLTDTKFASALVKNDAILKQALTQIPLKRVADPSEMAGAVLYLASDASSYTTGVALNVDGGFLS
>NZ_CP019426.1|WP_160057309.1|2523083_2524151_-|phosphotransferase
MALTDQSTRIRSGEELDASLIDPYLKAHIPGLSGTPAISQFPGGASNLTYLLEYPEQEFVLRRPPFGHKAKSAHDMGREFRILNQLRDGFPYCPKAYVHCTDESVIGAEFYVMERVKGIILRSELPPELGLDSAKTEALCKSFIDRFVELHRVDYNACGLGDLGKPEGYVARQIKGWSERYEKALTPDAPHWEKVKAWLNDKMPADHPTSSIVHNDYRFDNVILDPQNPMQIIGVLDWELTTLGDPLMDLGNTLAYWIQAEDPAPVQLMRRQPSHAPGMLTRREFVDYYAERSGIQIDNFDFYYTYGLFRLAGIVQQIYYRFYHGQTQDKRFAQFIHMNKLLEQMSLQVIAKSSL
>NZ_CP019426.1|WP_160057310.1|2524341_2525310_-|2-hydroxyacid-dehydrogenase
MPATVLVLVETINDYLPILEHQGFHLILAPTPAERAQAIATQGSRIDAVLTRGPLGLTTDEIAALPALKIITVIGAGYEQVDLQAASNRGITVTNGAGVNASSVADHAMAMLLALVRDIPRCDAAVRRGEWPKIMRPSLAGKRLGILGLGAVGMAIAKRANLGFDMEISYHSRQVRSDVPYAFCSTPTELARASDFLIIATPGGIGTQHLVTRPVLDALGPKGFIVNIARASVIATTDLITALEQRRIAGAALDVFDHEPQVPDALKTLSNVLLTPHVAGLSPEATQGTVELVGKNLVAFFSGEPVLTPIALPPKLNNQRVH
>NZ_CP019426.1|WP_160057311.1|2525482_2525911_-|hypothetical-protein
MQKSLKTLLISTLVVSSVYCAGVNAQAAAQPAKNAVATADNAMMLTVFLKHDQTRPLNELKAQLTQQGFYKTFPPAGVEVVSWNIMMGIGQVVTVRFPASRLAEVNLALENTAWGSYRTEFYPTYDFKPIALAEQSKAQAAQ
>NZ_CP019426.1|WP_160057312.1|2525910_2526402_-|DUF4822-domain-containing-protein
MQKNLMTGLLLAVLFSSPASADVRELASSPRWLTTRVYIDGAPETDVKAKYPDVVGISTWDPERNRYEFFYADTGESKYSKGGGGYFFVTGDQKQHVLVPDIGPTKTIVRQLETMNSVEFTYSREVPRDMMENNSLVRIHVVHAPYTGTIETKSAINNKARSR
>NZ_CP019426.1|WP_160057313.1|2526759_2527284_-|isochorismatase-family-protein
MPAALLIIDMQVGLFHGPEKPCDGERILANIQRLIAQARASQVPIFAVRHTGPEDSPIAAGSPFWQLLPALELDADLDTLFDKSRPNAFHGTQLARQLESAQVDDLYIVGMKSQFCIDSTCRAAADLGFKPLLVVDAHTCMDTAALPAAAIIEHHNATLGGAFARLIDSAQVTF
>NZ_CP019426.1|WP_160057314.1|2527503_2527887_-|tautomerase-family-protein
MPLVRVDIKQNPDPTFAKRIGEQIYSALRSCIDVPEHDNFQILTEHDGQHFVYDPQYLGIQRSDGVVFIQITISEGRSVEKKQLLFKTIAESLHTQLAVRLEDVFINLVEVKKENWSFGNGVAQYVT
>NZ_CP019426.1|WP_160057315.1|2528138_2528333_+|hypothetical-protein
MHLDDYKNVEIERLQTETQKLGAERRKLLAEEAKLKPETFLYPLVVGAGALTAIATAVGLYLKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019426_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019426_3

2559695-2559796

Orphan

Consensus_repeat	Method
CCTGTGGGAGCGAGCCTGCTCGCGAAGACGCC	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP019426_3

>merge|NZ_CP019426|3|2559695-2559796|CRISPRCasFinder
CCTGTGGGAGCGAGCCTGCTCGCGAAGACGCCAGCCCAGCCACCACAAGTCTCGCGCCACCCACAAACCCCCTGTGGGAGCGAGCTTGCTCGCGAAGACGCC

>NZ_CP019426|3|3|2559695-2559796|CRISPRCasFinder
CCTGTGGGAGCGAGCCTGCTCGCGAAGACGCC	AGCCCAGCCACCACAAGTCTCGCGCCACCCACAAACCC
CCTGTGGGAGCGAGCTTGCTCGCGAAGACGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019426.1\|WP_160057331.1\|2553179_2554832_-\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|235000
NZ_CP019426.1\|WP_160057332.1\|2554965_2555850_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP019426.1\|WP_095047447.1\|2551417_2553040_-\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP019426.1\|WP_116255400.1\|2550993_2551362_+\|DUF427-domain-containing-protein	unknown	unknown	gnl\|CDD\|377265
NZ_CP019426.1\|WP_160057335.1\|2559132_2559612_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP019426.1\|WP_160057334.1\|2558906_2559119_+\|DUF4287-domain-containing-protein	unknown	unknown	gnl\|CDD\|379478
NZ_CP019426.1\|WP_026000441.1\|2556059_2556407_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|236654
NZ_CP019426.1\|WP_160057337.1\|2562919_2563576_+\|DUF2931-family-protein	unknown	unknown	gnl\|CDD\|371398
NZ_CP019426.1\|WP_016982978.1\|2560188_2560551_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160057342.1\|2568392_2568998_-\|glutathione-S-transferase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|198314
NZ_CP019426.1\|WP_122607146.1\|2569059_2569968_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP019426.1\|WP_160057333.1\|2556905_2557595_+\|arsenical-resistance-protein-ArsH	unknown	unknown	gnl\|CDD\|274260
NZ_CP019426.1\|WP_160057339.1\|2564784_2565654_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372995
NZ_CP019426.1\|WP_095111524.1\|2562228_2562888_+\|DUF2931-family-protein	unknown	unknown	gnl\|CDD\|371398
NZ_CP019426.1\|WP_150794676.1\|2556422_2556893_+\|arsenate-reductase-ArsC	unknown	unknown	gnl\|CDD\|319973
NZ_CP019426.1\|WP_160060075.1\|2557887_2558781_+\|sel1-repeat-family-protein	unknown	unknown	gnl\|CDD\|276807
NZ_CP019426.1\|WP_160057336.1\|2560687_2562229_+\|DUF2235-domain-containing-protein	unknown	unknown	gnl\|CDD\|370774
NZ_CP019426.1\|WP_160057338.1\|2563846_2564680_+\|DUF4393-domain-containing-protein	unknown	unknown	gnl\|CDD\|379564
NZ_CP019426.1\|WP_160057341.1\|2567283_2568390_-\|DNA-alkylation-repair-protein	unknown	unknown	gnl\|CDD\|226785
NZ_CP019426.1\|WP_160057340.1\|2565724_2566870_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372947

Protein	Function_ID	Function_description	E-value
NZ_CP019426.1\|WP_160057331.1\|2553179_2554832_-\|GMC-family-oxidoreductase-N-terminal-domain-containing-protein	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP019426.1\|WP_160057332.1\|2554965_2555850_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.71035e-35
NZ_CP019426.1\|WP_116255400.1\|2550993_2551362_+\|DUF427-domain-containing-protein	gnl\|CDD\|377265	pfam04248, NTP_transf_9, Domain of unknown function (DUF427). This domain contains a beta-tent fold.	4.84837e-38
NZ_CP019426.1\|WP_160057335.1\|2559132_2559612_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	5.02215e-12
NZ_CP019426.1\|WP_160057334.1\|2558906_2559119_+\|DUF4287-domain-containing-protein	gnl\|CDD\|379478	pfam14117, DUF4287, Domain of unknown function (DUF4287). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 70 and 180 amino acids in length.	1.91228e-25
NZ_CP019426.1\|WP_026000441.1\|2556059_2556407_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|236654	PRK10141, PRK10141, DNA-binding transcriptional repressor ArsR; Provisional.	1.8686e-36
NZ_CP019426.1\|WP_160057337.1\|2562919_2563576_+\|DUF2931-family-protein	gnl\|CDD\|371398	pfam11153, DUF2931, Protein of unknown function (DUF2931). Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function.	5.41291e-26
NZ_CP019426.1\|WP_095047447.1\|2551417_2553040_-\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.11058e-127
NZ_CP019426.1\|WP_160057342.1\|2568392_2568998_-\|glutathione-S-transferase-N-terminal-domain-containing-protein	gnl\|CDD\|198314	cd03205, GST_C_6, C-terminal, alpha helical domain of an unknown subfamily 6 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs, including Pseudomonas fluorescens GST with a known three-dimensional structure. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Though the three-dimensional structure of Pseudomonas fluorescens GST has been determined, there is no information on its functional characterization.	4.18249e-37
NZ_CP019426.1\|WP_122607146.1\|2569059_2569968_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.1922e-59
NZ_CP019426.1\|WP_160057333.1\|2556905_2557595_+\|arsenical-resistance-protein-ArsH	gnl\|CDD\|274260	TIGR02690, arsenical_resistance_protein_ArsH_putative, arsenical resistance protein ArsH. Members of this protein family occur in arsenate resistance operons that include at least two different types of arsenate reductase. ArsH is not required for arsenate resistance in some systems. This family belongs to the larger family of NADPH-dependent FMN reductases (pfam03358). The function of ArsH is not known. [Cellular processes, Detoxification].	3.53209e-117
NZ_CP019426.1\|WP_160057339.1\|2564784_2565654_-\|hypothetical-protein	gnl\|CDD\|372995	pfam14279, HNH_5, HNH endonuclease. This domain is related to other HNH domain families such as pfam01844. Suggesting that these proteins have a nucleic acid cleaving function.	9.80015e-07
NZ_CP019426.1\|WP_095111524.1\|2562228_2562888_+\|DUF2931-family-protein	gnl\|CDD\|371398	pfam11153, DUF2931, Protein of unknown function (DUF2931). Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function.	3.86828e-24
NZ_CP019426.1\|WP_150794676.1\|2556422_2556893_+\|arsenate-reductase-ArsC	gnl\|CDD\|319973	cd16345, LMWP_ArsC, Arsenate reductase of the LMWP family. Arsenate reductase plays an important role in the reduction of intracellular arsenate to arsenite, an important step in arsenic detoxification. The reduction involves three different thiolate nucleophiles. In arsenate reductases of the LMWP family, reduction can be coupled with thioredoxin (Trx)/thioredoxin reductase (TrxR) or glutathione (GSH)/glutaredoxin (Grx).	2.07582e-51
NZ_CP019426.1\|WP_160060075.1\|2557887_2558781_+\|sel1-repeat-family-protein	gnl\|CDD\|276807	sd00010, SLR, Sel1-like repeat. Sel1-like repeats (SLRs) share similar alpha-helical conformations with Tetratricopeptide repeats (TPRs), but with different consensus sequence lengths and superhelical topologies. SLRs contain 36 to 44 amino acids and are present in bacteria and eukaryotes but not in archaea. SLR proteins are involved in a variety of functions, and many serve as adaptor proteins for the assembly of macromolecular complexes. The SLR family was named after the Caenorhabditis elegans Sel1 protein which is predicted to fold into 11 SLRs, a transmembrane domain, and an N-terminal signal sequence. The human Sel1L protein contains an additional fibronectin type-II domain and an N-terminal PEST sequence. Its downregulation is associated with the development of breast and pancreatic carcinomas.	6.01697e-11
NZ_CP019426.1\|WP_160057336.1\|2560687_2562229_+\|DUF2235-domain-containing-protein	gnl\|CDD\|370774	pfam09994, DUF2235, Uncharacterized alpha/beta hydrolase domain (DUF2235). This domain, found in various hypothetical bacterial proteins, has no known function.	3.87027e-15
NZ_CP019426.1\|WP_160057338.1\|2563846_2564680_+\|DUF4393-domain-containing-protein	gnl\|CDD\|379564	pfam14337, DUF4393, Domain of unknown function (DUF4393). This family of proteins is found in bacteria, archaea and viruses. Proteins in this family are typically between 254 and 285 amino acids in length.	4.47094e-48
NZ_CP019426.1\|WP_160057341.1\|2567283_2568390_-\|DNA-alkylation-repair-protein	gnl\|CDD\|226785	COG4335, COG4335, DNA alkylation repair enzyme [DNA replication, recombination, and repair].	1.14786e-55
NZ_CP019426.1\|WP_160057340.1\|2565724_2566870_-\|hypothetical-protein	gnl\|CDD\|372947	pfam14175, YaaC, YaaC-like Protein. The YaaC-like protein family includes the B. subtilis YaaC protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 320 and 333 amino acids in length.	3.89951e-25

>NZ_CP019426.1|WP_160057335.1|2559132_2559612_+|GNAT-family-N-acetyltransferase
MNFTHRPVTADDVNILCSFPQGEQELFFMFPKANFPLTEEQMHSAISQRFDSTAFLANGEFVGFANFYRAEHDGICCIGNVIVAPYARGQGVARYIVETMTALGFEKYQAKEVQLSCFNENTAGLLLYPKLGFVPYSIEERPAPNGGRSALINMTRRRP
>NZ_CP019426.1|WP_160057334.1|2558906_2559119_+|DUF4287-domain-containing-protein
MSEDNKVKGPASYFPSIEKKYGRPIDHWLNLLAGITDKKHMELVAWLKEEHGMGHGHANALVAHHLAGKK
>NZ_CP019426.1|WP_160060075.1|2557887_2558781_+|sel1-repeat-family-protein
MNKVVAVLALTALVAGCKSHHHPNFADDEFPSFRCAAYFKQASISEQQFDEIRYLSTQNANCKVILGEMYEQGHGVPKNIEKAKDIYESVARRAPNVYSRLGDMAAAGVGGPVDLVAARDFYERSIAEPGNTAMELKVAEFLENGKGGPQDLQGALKLYFKADSWDNLQRLGTKGVVMTIEQQQQYNKVYLNRMQYGVRAKIEGIEKALAQEKLSTPERKSVQLELTYTPGSLVPVIALRQSCGNSAIDQKVMQGFSDYRYPGEPILSPQQKNHTTVASVRTDGLTDRERLRALSKK
>NZ_CP019426.1|WP_160057333.1|2556905_2557595_+|arsenical-resistance-protein-ArsH
MSEHLPHLDHSLFEGSALDKHKPRILLLYGSTRERSFSRLLVEEAARLLEHFGAETRIFNPSGLPLPDDVPVDHPKVQELRDLVLWSEGQVWCSPERHGAMSAVFKAQIDWIPLELGAVRPTQGKTLAVMQVCGGSQSFNVVNQLRVLGRWMRMFTIPNQSSVPKAYMEFDDTGRMNASPFYDRVVDVMEELVKFTVLLRDQQAHLVDRYSERKESSEQLMARVNQRST
>NZ_CP019426.1|WP_150794676.1|2556422_2556893_+|arsenate-reductase-ArsC
MRILFMCTANSCRSILSEAMFNHLARPGFEAVSSGSFPKGQVLPRSLSTLQQAGIAIDGLYSKGNDAFEDNPPDIVITVCDKAAGESCPVYFGPALKAHWGLADPSDVLGDDAAVDAAFAATLAIIERRCATFLGLPFKALSRAELQRELDRIGSL
>NZ_CP019426.1|WP_026000441.1|2556059_2556407_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MITPTEVFKSLADETRVRAMLLIADQGELCVCELMCALDDSQPKISRHLAQLRSNGLLLDRRQGQWVYYRLNPDLPAWVREILQVTSKANADWLKDNAARLQNMDGRPVRETACC
>NZ_CP019426.1|WP_160057332.1|2554965_2555850_+|LysR-family-transcriptional-regulator
MFDWNDLRFFLELQRSGRLLTAARRLNTTHATVARHIEAIEKSLGTALFVQHAQGYEMTPAGEALLKHAEAMENVALLAQEEITQSTAPLGKIRVGVTEGLGIKFLASRMIGLFERYPGLEVELVAVPRFVSILNREAEISIHLERPAADMLVTRKLTDYRLALYASQRYLDKAPPLQSREDLGRHAWIGYVDDLLFSQELMFLNSFCRSPRVVFHSTSVIAQQEAARSGLGIAVLPCYMAESDPDLVPLLPDESIERSYWISTRRELHKSVRLRVVWDYVVGLCEAEQGLLRG
>NZ_CP019426.1|WP_160057331.1|2553179_2554832_-|GMC-family-oxidoreductase-N-terminal-domain-containing-protein
MQTSLDEYDYIVVGAGPAGCLLANRLSADAQQRVLLLEAGGRDNYAWIHIPVGYLFCIGNPRTDWCFKTEEQPGLNGRALSYPRGKVLGGCSSINGMIYMRGQANDYDGWAAEGNPGWAWNDVLPLFKQSENHFAGAAEFHGAKGEWRVEQQRLSWPILDAFRSAAEQSGIASIDDFNQGDNEGCGYFQVNQKSGVRWNAAKAFLKPVRDRTNLTVLTGVEVDRVLLEDGRASKVSARHEGQAKQFKARKEIVLCAGAVGSPSILQRSGIGPRPLLERLGIGVIHELPGVGGNLQDHLQLRLIYKLENARTLNQIAGSVWGKMGMGLRYLYDRSGPLSMAPSQLGAFARSGPEQTSANLEYHVQPLSLERFGEPLHSFPAFTASVCDLRPQSRGRIDIRSADPQEAPLIQPNYLSHPEDLRVAADAIRLTRRIVSAPALQAFKPVEYLPGANLQSEEQLQQAAATIGTTIFHPVGTCRMGNDGDAVVDAQLRVHGVPGLRIADASIMPRITSGNTCSPTLMIAEKAAQLILNPNAVNTTPVGASLLAMTE
>NZ_CP019426.1|WP_095047447.1|2551417_2553040_-|MHS-family-MFS-transporter
MSEHVQPLDAVRSAETSPDTRKVIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDTTAFIFALMAFAAGFIVRPFGALVFGRLGDMIGRKYTFLATIILMGVATFCVGLLPTYASIGIAAPIILVVLRMLQGLALGGEYGGAATYVAEHAPIGKRGFHTSWIQSTATLGLLLSLLVVLGCRYFTGDQFEVWGWRIPFLLSIVLLGISTWIRLSLHESPAYLKMKEEGKTSKAPIRESFGKWENLKVVLIALFSINAGQAVTFYAAQFYVLFFLTQFLKMDPAVANTLLIISVVIGAPFFIFFGWLSDKVGRKPVLMLGLLLATALYFPIFKSLAHYANPAIDQASRQAPITVLADPATCTFQFDPVGKAKFDSPCDKVKTFLVKQGLPYSSAAAPAGSAVQVSVGDVKLDGFDEAALRGAITLAGYPQQADLQQINKPMIVALIVALIIISAMCYGPLAALMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLITGVSLVVGMICLRETKNIDLDKN
>NZ_CP019426.1|WP_116255400.1|2550993_2551362_+|DUF427-domain-containing-protein
MKSSGPSPVIALEQLPGCLIVKFHGIQVAASSHVLILNEANYPPVYYIPREDIDEKYFARTDHTSYCPYKGDANYFSLQVPGHEGANAVWTYEKPKISVGPIKDYVAFYPDQVKFEVIKADA
>NZ_CP019426.1|WP_016982978.1|2560188_2560551_+|hypothetical-protein
MIKPTPNPPETDPTSPYESPDSKRFHEAAERALDHYLKPASQIMASTQQPERMYLANPKYNSESLLANASETLGSASEMLLNFAAMLDTPHRKTALGIAQVVMLGEIAVNQALDNVEIAS
>NZ_CP019426.1|WP_160057336.1|2560687_2562229_+|DUF2235-domain-containing-protein
MSGYVPNPPKNYRYEEAKPVDIHAQRWAEYEKHGKEPAREPEKIGIALRIGVFFDGTGNNANNTAAGLLCGAQHPIAPEDIPASCQPYMRDPDSSYANDTTNVQKLSELYFAPQKAEGDSSQKQAFRMIYIEGIGTQSGKKDSTLGGGTGRGETGVAGRVQLSFAEIKTRIKDVLDNNPNSEITSLTFDAFGFSRGAAAARHFANEVVRGKQGPLGEVLRSNANALSRTFIEEYKSSINIGFIGLFDTVPSIAGWSNLGDIKSPIATGIKLYLDRRFFTDVVQLSARDEYRANFALSRVKADHLEITLPGVHSDIGGGYRDKVEECVLVSPMQTLEVSQFTDVSTTSIYRDAVTVKAQWLAKGWPEEMLEIVTPDALPLPIDRQDRLSPRMKRVYAAVQLKRPVSGLLSRVYLRVMHRLAKEKGVRFQDIPDTPELAVPAELQALCDRFLAGSYDTSMQEDQLLKLKYIHMSANWNHPLGRRDGTGVRAVYINAPTPDSIRVQHPHVADWKLW
>NZ_CP019426.1|WP_095111524.1|2562228_2562888_+|DUF2931-family-protein
MKVLFTLLCALFITGCQSADPLSAKNDPKSEWWELAFTEPDYMKVWVENSSVQDINGRIFYKTGGGTAAGGEPEDGTESARGWTGGVGGSGRRVVGADLPVRIWVRWQSIVEQKTWQAWVEIPEEARQLMVASVNQRCPQTPDQEARFMASVYLGLAPGGVVQVWVRDSCHHPVKVARAQAEIEPLGPSQGKNEGRYAYPVSEKAKRYIDKYGIPYGSW
>NZ_CP019426.1|WP_160057337.1|2562919_2563576_+|DUF2931-family-protein
MNARIALLGALLISGCQIGGPETGENDPKYPWWELVFVEPNYMRVWVEDSSVQDINNRIFFRAGKSTAASGEPDISTESARGWGTVSGTGMPVTGADLPKQIFVRWQSITEQKTYQGFIEIPEEGRQLMVKSTHQRCPETPEKTARFMASLYVGLAPGGVLQAWVRDSCRNPVAVARGQGGIEVLGPEQGKHGGRYAYPVSEKAKRYVEEYGIPYGSW
>NZ_CP019426.1|WP_160057338.1|2563846_2564680_+|DUF4393-domain-containing-protein
MSESGNVKSTIDAVTGLVKEIPVYQDLLQPSVREVGKGLHTVAKTVNIALSPLGALVWGYDQISKFVTIKVAEKLSHTPVENIIPPKLNVAGPALDALRYIGHDEALSDLYASLLATAMDKETAESSHPAFVEIIRQMTADEAKIMKLFLDRNACPTITIRAEVKEGNAGFDHTILINFLGDDAQCELPDMSPYYLDNLRRLGLLEVLPVYGLHDSDGYSRLEDGEETQKIILSISEESEYKPRVIRGGVKISPLGSLFLDACIKLKKPLSESSPTV
>NZ_CP019426.1|WP_160057339.1|2564784_2565654_-|hypothetical-protein
MSNYCIYLDGPSTDLSKEHIIPISLGGLDSFCIQADRKFNNEVGSKVDGAIANDFLMLFNRDRANAKGHSGSQPQPKARRATLIDGSPVQVTFSKNGLQIYDLKQRRYLKKGERRGGQVKIDGLTLDLNADIKFVAKVALAAGFYAYGDLFRKGVMHSEPRKIVTANSLMDIRPDVRLYTRFQNDQDLPDPGDFQMFKMIVELSNCSCVLIIPGKGCFGVVVGILGEFMGMINIPADTTGFPNENDYDLGHCIFLQNGKVKRMSFRHIAKNLSDYLEAKNENLTTLLEF
>NZ_CP019426.1|WP_160057340.1|2565724_2566870_-|hypothetical-protein
MRLPPARPGKRVDSRQRVVDFSFWPATLAHKNRYKVQHTLFALDPWSIIEGSISQKCPAAAKEEAQACLRQARDFFQAANQAQTLESRPLSLYYSYMNLVKAFCLTRGQQPTFDKAQHGLSEQLRAPNVELVDAYLAAFPSPNNKQILQNFDEFLRAVTGTSLSASFNYELTKLLPQTVSGHRLWCAAEDADERMFPIESIQYWKDYQGKTAWIRMILKTENLTRHGMTRSQLLKRTGLNVDFKMVSQDPITDKVLTTLEMKAPIPIGGYATDKVQELSKIIKDRIWSIVSTVPPYRKYYLYACPPAEQQHVLPQLLSIYAISYYLGSITRYRPHQLPKISQGNFGPLIQDFITGQPMQFLYLMASEFSEQDVAKPAIVLQ
>NZ_CP019426.1|WP_160057341.1|2567283_2568390_-|DNA-alkylation-repair-protein
MSTTDTAAPALKEIFNAERLQHIASEMSAVYPAFKAKAFLKHAQDGLAELSVMQRMARVSESLHAVLPLDYQDSLDVFRELAPRLNSGFVSMCLPHYVASYGGHAFDTSMDALKYFTTFGSSEFAIRHFLRSDLERSLERMHDWTRDENHHVRRLASEGSRPRLPWSFRLEAVQADPQLAAGILDRLKADESLYVRKSVANHLNDVTKVHPEWVLDTIEGWSLENKHTAWIAKHALRSLIKQGDLRALTVIGAGAKAEVELLDVRVEPAVVRLGEAITLSFVVKSTVAHEQRLVIDYAIDYVKANGGVSGKVFKLKTVGLAGFESLGVGRRQVIRDFTTRKHFVGRHGVRVMVNGEVLGNAAFDIVAG
>NZ_CP019426.1|WP_160057342.1|2568392_2568998_-|glutathione-S-transferase-N-terminal-domain-containing-protein
MKLIGMLDSPYVRRVAISAKRLGIDLEHESVSVFRHFEQFQQINPVVKAPTLILDDGVVLMDSTLILDYLEASAGKSLLPTDLKQRAQALRLIGLSLAACEKAVQLYYERNLRPADIQYQPWVERVEGQLAAAFTALEQELEKTGLPTDGTLTQAGISLAVAWSFTDLVVPDQIDTRRYPHIAQYTAYAETLEAFVSTPMT
>NZ_CP019426.1|WP_122607146.1|2569059_2569968_-|MurR/RpiR-family-transcriptional-regulator
MPRPDLPATDEVSLASPPINAERLLQLITDEYDALPRQLKRIASYISQQSDRIMVDRISDIARECEVHPSAIVRFSQRFGFSGFSEMQALFRSAYTHKASPVQNYQQRIRSMIANQSQQASAGDLARECIDATRSGIERLGRELDDTAFEKAVDLIVNADNIYVVGVRRSFAVADYLVYNLQHTQKKIHLVSGLGGSYREQMRSVRANDLVIAISFVPYAKETQHCLRFARQQQANTLILTDSHLSPLAKLANSVLLVNEGSALAFRSLSATLCLCQALFVAVAYRLELNVDEIHEQPGFDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019426_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019426_4

4092937-4093033

Orphan

Consensus_repeat	Method
TCGCGAGCAGGCTCACTCCTACAGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019426_4

>merge|NZ_CP019426|4|4092937-4093033|CRISPRCasFinder
TCGCGAGCAGGCTCACTCCTACAGTTGGATCGGGTACATCAGCAAGAGATTGGTCGGCTGGCAGGCCGCCTTCGCGAGCAGGCTCACTCCCACAGTT

>NZ_CP019426|4|4|4092937-4093033|CRISPRCasFinder
TCGCGAGCAGGCTCACTCCTACAGTT	GGATCGGGTACATCAGCAAGAGATTGGTCGGCTGGCAGGCCGCCT
TCGCGAGCAGGCTCACTCCCACAGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019426.1\|WP_160058587.1\|4089075_4090407_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|224089
NZ_CP019426.1\|WP_160058584.1\|4086617_4088261_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP019426.1\|WP_160058595.1\|4096602_4097622_-\|DUF1311-domain-containing-protein	unknown	unknown	gnl\|CDD\|226868
NZ_CP019426.1\|WP_160058598.1\|4100303_4100819_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|234860
NZ_CP019426.1\|WP_160058583.1\|4085993_4086473_+\|phage-infection-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160058600.1\|4101506_4102565_-\|chitinase	unknown	unknown	gnl\|CDD\|226000
NZ_CP019426.1\|WP_160058593.1\|4095307_4095766_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP019426.1\|WP_160058582.1\|4085266_4085836_+\|chorismate-mutase	unknown	unknown	gnl\|CDD\|236441
NZ_CP019426.1\|WP_160058585.1\|4088261_4088555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160058581.1\|4083710_4085066_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240543
NZ_CP019426.1\|WP_160058589.1\|4091392_4092208_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP019426.1\|WP_160058592.1\|4095008_4095317_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019426.1\|WP_160058588.1\|4090495_4091389_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP019426.1\|WP_160058591.1\|4093406_4094852_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|223732
NZ_CP019426.1\|WP_160058590.1\|4092339_4092852_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|130981
NZ_CP019426.1\|WP_160058594.1\|4095909_4096554_+\|TetR-family-transcriptional-regulator-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|312013
NZ_CP019426.1\|WP_160058597.1\|4098420_4100148_-\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
NZ_CP019426.1\|WP_160058599.1\|4100820_4101411_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|184971
NZ_CP019426.1\|WP_160058586.1\|4088636_4089023_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|226005
NZ_CP019426.1\|WP_160058596.1\|4097820_4098354_-\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496

Protein	Function_ID	Function_description	E-value
NZ_CP019426.1\|WP_160058587.1\|4089075_4090407_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.8669e-103
NZ_CP019426.1\|WP_160058584.1\|4086617_4088261_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.54232e-64
NZ_CP019426.1\|WP_160058595.1\|4096602_4097622_-\|DUF1311-domain-containing-protein	gnl\|CDD\|226868	COG4461, LprI, Uncharacterized protein conserved in bacteria, putative lipoprotein [Function unknown].	3.19105e-16
NZ_CP019426.1\|WP_160058598.1\|4100303_4100819_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|234860	PRK00901, PRK00901, methylated-DNA--protein-cysteine methyltransferase; Provisional.	2.19481e-61
NZ_CP019426.1\|WP_160058600.1\|4101506_4102565_-\|chitinase	gnl\|CDD\|226000	COG3469, COG3469, Chitinase [Carbohydrate transport and metabolism].	2.32345e-176
NZ_CP019426.1\|WP_160058593.1\|4095307_4095766_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	7.84752e-17
NZ_CP019426.1\|WP_160058582.1\|4085266_4085836_+\|chorismate-mutase	gnl\|CDD\|236441	PRK09269, PRK09269, chorismate mutase; Provisional.	2.11e-60
NZ_CP019426.1\|WP_160058589.1\|4091392_4092208_-\|cupin-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.56523e-25
NZ_CP019426.1\|WP_160058581.1\|4083710_4085066_-\|MATE-family-efflux-transporter	gnl\|CDD\|240543	cd13138, MATE_yoeA_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Bacillus subtilis yoeA. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. A number of family members are involved in the synthesis of peptidoglycan components in bacteria.	7.17166e-98
NZ_CP019426.1\|WP_160058588.1\|4090495_4091389_+\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	2.51696e-10
NZ_CP019426.1\|WP_160058591.1\|4093406_4094852_-\|STAS-domain-containing-protein	gnl\|CDD\|223732	COG0659, SUL1, Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism].	9.12042e-124
NZ_CP019426.1\|WP_160058590.1\|4092339_4092852_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|130981	TIGR01926, peroxid_rel, uncharacterized peroxidase-related enzyme. This protein family with length of about 200 amino acids. One member, from Myxococcus xanthus, is a selenoprotein, with an otherwise conserved Cys replaced by Sec. This family is drawn narrowly enough to suggest that These proteins contain a domain described by TIGR00778, with a CxxCxxxHxxxxxxxG motif. Some members of that family are known to act as peroxidases or correlate with resistance to oxidative stress.	4.32625e-18
NZ_CP019426.1\|WP_160058594.1\|4095909_4096554_+\|TetR-family-transcriptional-regulator-C-terminal-domain-containing-protein	gnl\|CDD\|312013	pfam08362, TetR_C_3, YcdC-like protein, C-terminal region. This family comprises proteins that belong to the TetR family of transcriptional regulators. They bear particular similarity to YcdC, a putative HTH-containing protein. This family features the C-terminal region of these sequences, which does not include the helix-turn-helix.	1.37037e-44
NZ_CP019426.1\|WP_160058597.1\|4098420_4100148_-\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
NZ_CP019426.1\|WP_160058599.1\|4100820_4101411_-\|NUDIX-domain-containing-protein	gnl\|CDD\|184971	PRK15009, PRK15009, GDP-mannose pyrophosphatase NudK; Provisional.	3.75047e-71
NZ_CP019426.1\|WP_160058586.1\|4088636_4089023_-\|c-type-cytochrome	gnl\|CDD\|226005	COG3474, COG3474, Cytochrome c2 [Energy production and conversion].	7.22462e-41
NZ_CP019426.1\|WP_160058596.1\|4097820_4098354_-\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.10138e-60

>NZ_CP019426.1|WP_160058590.1|4092339_4092852_+|carboxymuconolactone-decarboxylase-family-protein
MSRIHAISLETAADASRPVLEGVKKKIGFLPNVFTTLAKAPVALETYVQASAILGKTSLSAQEKEAVYLATSQVNGCDYCLAAHTLFAGKAGLSAQDIVAARQGELNAYATLARQLTESRGHLSDAQIAAARAAGIDDVKIIEVIALVAVQSLTNYLNNAALTDIDFPAI
>NZ_CP019426.1|WP_160058589.1|4091392_4092208_-|cupin-domain-containing-protein
MDRLSTLLSHFGVTAGTFHSGTFCGVAVHENEPVGHVHLLQAGELLLKPGSEREVRLSEPSLIFFPRPFAHRMFADEAMDTQVVCATLTFDGGSGNALAAALPDYLVLKLTDIPELGNTVEWLFKEAFEGHCGRVAVMDRLFELLVILLLRHLISSREQQPGMIAGLADPRLSRALNSMHEEPQKPWSVADLASVANMSRAGFAEQFRRVVGQTPADYLLSWRVSLAQKRLREGKPIALIAEEVGYESPSALARAFRRKTGLSPREWKAGA
>NZ_CP019426.1|WP_160058588.1|4090495_4091389_+|EamA-family-transporter
MERTSNLTTPALEKTSGWINGFIGVVIFSGSLPATRLAVLEFDPVFLTVVRAAIAGVLAAALLWLFRERRPARDQWLSLLIVALGVVLGFPLLTALALQHVTSAHSIVFVGLLPLATAIFAVLRGGERPRPVFWMFSILGSALVVGFALAQGLTASPTGDLLMLAAILACGLGYAEGAKLSRSLGGWQVICWALVLSLPVMAVLSLWLAPASFSTISLSAWVCLGYVSLFSMLIGFVFWYRGLAQGGIAAVGQLQLLQPFFGLALAATLLHEHVSLGMLAVTLGVILCVAGAKKFAK
>NZ_CP019426.1|WP_160058587.1|4089075_4090407_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MPRSRYKTIVDAYAADIRSGQLPPGTRLPTHRQLAAEKGLALVTASRVYAELEAMGLVSGETGRGTFVRETSLAPGQGIDQKQVAVGMIDLNFNYPSLPVQADLLRSALRQLALSGDLEALLRYQPHAGRAHERASVARHLLTRGVNVEAEQVLIVNGAQQGLAVTLMALLKPGDVIAADALTYSGFKVLAEALHLEVVAIPFSDQGPDLAALDKLCRSRSVRAVYSMPTLHNPLGWVMPFAQREQLVAIARRHDLTLIEDAAYAFLVENPPPALVDLAPERTVYVSGLSKNIATGLRVGFIAAPTETVAALERIIRATTWNTPGIMTAIACGWLDDGTVTLLEEQKRNDAKVRQALAAELLKGLPSIGHPASYFLWLPLPEDVRADQIVVELMHEQISVTTAEPFSVSGHVPHAIRLALGSVELEVLRQALIKIRKIIGAYL
>NZ_CP019426.1|WP_160058586.1|4088636_4089023_-|c-type-cytochrome
MKNTAALSLALMLATSLFTTFSHAAGDPEAGAKIFPRLCGGCHQVGESARPGFGPQLNGIIGRPAGTSANYVYSDAMKNSGVTWDRETLIAYLKDPKGVVPGTRMIFWGLSDEEKLENLLAYLQTFSQ
>NZ_CP019426.1|WP_160058585.1|4088261_4088555_-|hypothetical-protein
MKFLLLVTPLLLATGLAYAGIPMFNATCPGKIEVHADEGGPIYINGKEGQLKKFNDNYFEAKGSGVTISLSINPDGSPAVSYTGKNRANGVCEVKKG
>NZ_CP019426.1|WP_160058584.1|4086617_4088261_+|diguanylate-cyclase
MLKASLRSHLTLWFAGLSLLTLLSVGFYVGHIATEQMKQASGNALLNTARSAASLLGEQLRERQLEVYLLSRAPHLERGDLDNPAILKSMQLRTQARTEYAWMGVTDAEGKVHQAVNDLLVGLSVQQRPWFQAGLRSEYTGDPHEAVLLAKMLPALPNGEPLRFIDFAAPIHNADGQVIGVLGAHAHWSWVTRIVESAAFAHKNSMPDIEALIIDHDGKILYPEALMGQQLAATDSKLQDWTAGNGFLTSMVTVPTPSSTALSWSIAVRQPLETALQPARLLMYKLLILGVVAAVLFGLVAYYLALYLSRPIEQLARSARKVQNKEPGAQFPLQHPVREIAQLGQSIDAMTQSLLGKERELQEANASLEATVAQRTAALTQANAELLSLATHDGLTGVYNRRRFDEKLTEYTLLFRRTGRPFSLLLIDADHFKRINDTHGHAVGDEVLQQLAQLIQSSLRTTDFVARYGGEEFAVLLPEIAQPDTPEVVAEKIRAAIAKADFPAVGNVTVSIGVGLADPADNSHNALIKRADQQLYQAKAAGRNQVA
>NZ_CP019426.1|WP_160058583.1|4085993_4086473_+|phage-infection-protein
MKRQTLLSIAFSVFAINAFAATPAHTQVAEGGPDKLIESRVAEGGSDRLLERRVAEGGSDRLLERRVAEGGSDRLIERRVAEGGSDRLIERRVAEGGSDRLIERRVAEGGSDRLIERRVAEGGSDRLIERRVAEGGSDRLIERRVAEGGSDRLIERRVA
>NZ_CP019426.1|WP_160058582.1|4085266_4085836_+|chorismate-mutase
MPHFANLLTASLLALLATSAHAAAAAPAETLKPLLETLNERLNIGDLVALTKWDSGKPIQDSPREAQVIANARALAAEHKLDPEEVAQLIAAQMEANKLVQYGLLSQWQAAGAAPDTPRPDLGKQIRPRLDELQTRLLQQYADFAPYRHDANCSVWLAKARSGLSHDALHELALTRATGELCVRAAKSL
>NZ_CP019426.1|WP_160058581.1|4083710_4085066_-|MATE-family-efflux-transporter
MQAVAQRPLWHTYLLFLAPMVLSNFLQSMSGTVNSIYIGQMLGTQALAAVSGMFPIVFFFIALVIGLGAGAGVLIGQAWGAREPHMVKAIAGATLLLGVLIGLVAAVLGSVFARQALAGLGTPADVLDDAVAYAHVMMWILPSLLVFVLFTQLLRGVSDTLSPLLALMVSTCVGLALTPALIRGWFGLPQLGIQSAAYAGLAGNLAAMAWLAWRLIRKGHPLAPDREFFAALRLDGAILGKVLRIGLPTGVQMIVLSLSELVILALVNQHGSQATAAYGAVTQIVNYVQFPALSIAITASILGAQAIGAGRLERMGPILRTGLLINVCLTGGLIVLGYLLSHWLLGLFLTEDSTRAMAEHLLHIMLWSLLVFGFQAIIGGIMRASGTVLVPVVIAIICVVGVQLPAAYWLDGKYGLQGVWMAFPVAYLGMLVLQTLYYKLVWQHQKIERLV
>NZ_CP019426.1|WP_160058591.1|4093406_4094852_-|STAS-domain-containing-protein
MKPIRLRADVLAGLTTSFALLPECIAFALVAHLNPLMGLYGAFIICTLTALFGGRPGMVSGAAGSMAVVIVALVVQHGVQYLLATVLLGGLIMMAFGLLRLGKLVRMVPHPVMLGFVNGLAIIIALAQLEHFKSGEDWLSGTPLYLMTGLVALTMAIVYILPRLTRAVPPALVAILGVGLLVYLFGLPTRTLGDMAHIAGGLPTFALPDIPWNLETLRIIAPYAILMALVGLLETLLTLNLTDEITETRGYPDRECVALGAANVVSGAFGGMGGCAMIGQTVINLSSGGRGRLSGVVAGVLILLFILFLSPLIERIPLAALVGVMFVVSQQTFAWASLRVVNKVPLNDVLVIIAVTTITVFTDLATAVLCGIIIAALNFAWQQARELYADEHLEADGSKLYRLHGTLFFASTAPFLNQFDPANDPARVTLDCRHLSFVDYSAIAALRTLRERYAKAGKHLQVFHLSERCKKLLKRAGEVHH
>NZ_CP019426.1|WP_160058592.1|4095008_4095317_+|hypothetical-protein
MSAFLSAREVCQRLREAALGVLAFKVCERPAEAGLVAVDIEGWLLLLDFEGGRLHHCECARNGDGQEGSLERWQRYGTDPVSLLSTWELAQIEQMLMAAVQP
>NZ_CP019426.1|WP_160058593.1|4095307_4095766_-|GNAT-family-N-acetyltransferase
MTLQVLRADVTHLDAVAQLFDAYRGFYKQPSNLEQSRAFIAERMAGDESAIFLAQDENGEALGFVQLYPMFSSIDAHRTWLLSDLFTAPAARGRGVGRLLMNTARDFASETGAKGLMLETATDNFTAQGLYESLGYVRDTGYYTYLLDLRQG
>NZ_CP019426.1|WP_160058594.1|4095909_4096554_+|TetR-family-transcriptional-regulator-C-terminal-domain-containing-protein
MRAIRVRNEQLILAAASEEFAVNGFDATQTRDIAARAGVPKANLYYYFQTKENLYGKVLLGFVEPLLEASAVLRESDDPLTGLRAYVAARIRIAREHPAIAKVFSGELLLGGRQLPDECRDLLHAEARRNVECLRSWIERGLLAPVDPEHLMLFIWSATRTYTNIGWQMGQIMGREVPQDEDYQTAAQTITRMVLEGVVVAPRTGEIRGVLFAT
>NZ_CP019426.1|WP_160058595.1|4096602_4097622_-|DUF1311-domain-containing-protein
MFALSLRHALLLTALAFAAVTQASSFDCASAASKTEKAICADPDLSRLDEQLAVRWRSTLNKAADPKALKADQRGWLKQRNQCDDLAPCLRRQYLMRLTALEYMVKPFSWDATWQLIPWGVSEGAEITTRRQDASHIAFDISAANGSHSGELEGVATIEGTQARYEQGECVLTFKALNGVMDVAQDGADFDCGAGMGVYYGGRYVSSKQTVLVDYDLLTLGVAQTQRENEVLHTLLKGDYQTLLQNCGLKMDGESSEDVPNSEVSNYWVRGLPSSNAAIVMRAPNEQFWIIVLVPQAGGKTLARYYTNVAQWKGRMPDVLQAWYASKGGEGYMPLDFML
>NZ_CP019426.1|WP_160058596.1|4097820_4098354_-|isochorismatase-family-protein
MTTALLIIDVQRALCSGEYQCYDIHRVIDTINGLSVRARKAGVPVVLIQHEEKESPLAHGAEGWQLAEGLETSAEDLRVRKTTPDSFYQTDLRKLLPSEDFEKLVICGLQTDYCVNATVRQAHQLGYDVVLVADAHSTVDNGNMSAEDIIAEHNKDLAHLTGATGRIDVKPAADITF
>NZ_CP019426.1|WP_160058597.1|4098420_4100148_-|gamma-glutamyltransferase
MKYEPLAKSLIATSLALSCLMAHAASVAPVAAENGMVVTAQHLATHVGVDVLKSGGNAVDAAVAVGYALAVVYPAAGNLGGGGFMTIQLADGRKTFLDFREKAPLAATANMYLDKEGNVIPDLSTRGHLAVGVPGTVSGMELALSKYGTKPRKEMIAPAIKLAEDGFELEQGDVELLEYATDVFKKDMRDSGSIFLSKGEPMHVGQKLVQKDLGKTLRSISEKGADGFYKGWVADAIVTSSQANKGIITQADLDKYKTRELAPVECDYRGYHVVSAPPPSSGGVVICQIMNILEGYPMKDLGFHSAQGMHYQIEAMRHAYVDRNSYLGDPDFVKNPIEHLLDKNYATKLRDAIQPQKAGVSAELKPGVAPHEGSNTTHYSIVDKWGNAVSVTYTLNDWFGAGVMASKTGVILNDEMDDFTSKVGVPNMYGLVQGEANAIAPGKAPLSSMSPTIVTKDGKVVMVVGTPGGSRIITATLLTMLNVIDYGMGLQEAVDAPRFHQQWMPEETNLEDFAASPDTRKILESWGHKFAGPQDANHIAAILVGAPSLGGKPVGKNRFYGANDPRRNTGLSLGY
>NZ_CP019426.1|WP_160058598.1|4100303_4100819_+|methylated-DNA--[protein]-cysteine-S-methyltransferase
MPYTFITLPSPVGELKLVANGSRLAAILWENDKPNRVRLGPMSEAPDNPILIRTARQLEEYFSGTRDCFDLELDFAGTDFQKKVWAALLTIPFGETRTYSQIAELIGNPSAVRAVGAANGRNPISIVAPCHRVIGASGKLTGFAGGLEAKERLLTLEGGDWSTVGKTGDLF
>NZ_CP019426.1|WP_160058599.1|4100820_4101411_-|NUDIX-domain-containing-protein
MSNTAERVNIVDTQVLSHDWYLLKKITFDYHRNNGEWQRQTREVYDRGNGAAILLFNREQRTVVLTRQFRLPVFVNGHDGLLIEVAAGLLEGAAPEQRIRDEAEEETGYRVHDVKKVFEAYMSPGSVTEKLHFFIAEYDAAWKVSDGGGLEEETEELEVLEWAFDDALAAFQRGEICDAKTIMLLQYAAMNNLFGV
>NZ_CP019426.1|WP_160058600.1|4101506_4102565_-|chitinase
MSKIDFSLMQNPASDAASLMPSIAGKKILMGFWHNWPAGPSDGYRQGRFASLSLEEVPKEYNVVAVAFMKGSGIPTFKPFNVSDAEFRRQVGVLNSQGRAVLISLGGADAHIELRSGQEQPLANEIIRLVEIYGFDGLDIDLEQSAIDFAANKTVLPAALKLVKDHYAGLGKHFIISMAPEFPYLTSTGKYLSYLQALEGYYDFIAPQFYNQGGDGVWVPEANNGAGAWIAQNNDALKEDFLFYLTESLVTGTRGFTRIPADKFVIGLPANNDAAATGYVIDKTVVGNVLKRLAIKGIPIKGLMTWSVNWDNGTSKDGVPYNWEFSRRYGPLIHGVPAAKQAVGDMQSLIAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

351838 : 382487

Pseudomonas_phage(62.5%)

portal,head,integrase,plate,terminase,capsid,lysis,tail

attL 351674:351726|attR 384718:384770

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
351674:351726	attL	NA	NA	NA	NA
WP_160054814.1\|351838_352987_-\|integrase	integrase	V9IQN0	Stenotrophomonas_phage	6.9e-72	41.3
WP_160054816.1\|353287_353497_-	hypothetical protein	NA	NA	NA	NA
WP_160054818.1\|353694_354003_-	hypothetical protein	NA	NA	NA	NA
WP_160054820.1\|354018_356805_-	toprim domain-containing protein	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	64.4
WP_160054822.1\|356801_357053_-	hypothetical protein	NA	NA	NA	NA
WP_160054834.1\|357128_357494_-	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	1.0e-08	38.6
WP_160054837.1\|357490_357970_-	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	1.3e-43	55.8
WP_160054840.1\|357999_358200_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	4.1e-12	55.4
WP_160054843.1\|358287_358656_+	helix-turn-helix domain-containing protein	A0A2H4JFL3	uncultured_Caudovirales_phage	1.6e-22	50.5
WP_160054845.1\|358759_358945_+	hypothetical protein	NA	NA	NA	NA
WP_008084736.1\|359005_359263_-	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	3.0e-15	48.2
WP_174244490.1\|359328_360207_-\|portal	phage portal protein	A0A0U4B0L9	Pseudomonas_phage	1.7e-102	77.2
WP_160054848.1\|360118_362176_-\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	3.8e-270	71.4
WP_160054851.1\|362339_363257_+\|capsid	GPO family capsid scaffolding protein	A0A0U4JVV6	Pseudomonas_phage	5.2e-62	59.0
WP_160054854.1\|363258_364278_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	1.4e-124	67.6
WP_160054857.1\|364274_365000_+\|terminase	terminase	A0A0U4JEJ1	Pseudomonas_phage	2.6e-72	63.0
WP_160060041.1\|365097_365559_+\|head	head completion/stabilization protein	A0A0U4J933	Pseudomonas_phage	1.3e-45	61.4
WP_160054860.1\|365555_366002_+\|tail	phage tail protein	A0A0U4IBS7	Pseudomonas_phage	2.8e-53	69.0
WP_160054862.1\|365988_366672_+	phage virion morphogenesis protein	A0A0U4ISN1	Pseudomonas_phage	8.3e-65	61.5
WP_160054865.1\|366683_367799_+	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.1e-143	69.8
WP_064381012.1\|367804_368254_+	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	2.2e-61	77.2
WP_160054868.1\|368253_368466_+	TraR/DksA C4-type zinc finger protein	NA	NA	NA	NA
WP_064392730.1\|368462_368669_+	hypothetical protein	NA	NA	NA	NA
WP_160054871.1\|368665_369199_+	lysozyme	NA	NA	NA	NA
WP_160054874.1\|369198_369654_+\|lysis	lysis protein	A0A0U4JXC2	Pseudomonas_phage	6.2e-24	46.5
WP_064392723.1\|369698_369992_+	hypothetical protein	A0A0U4B0P2	Pseudomonas_phage	2.4e-21	63.9
WP_163005298.1\|370015_370156_+	hypothetical protein	A0A0U4B0S4	Pseudomonas_phage	1.6e-15	78.3
WP_160054877.1\|370163_372194_+\|tail	phage tail tape measure protein	A0A0U4IJ81	Pseudomonas_phage	6.4e-137	40.8
WP_160054879.1\|372190_372508_+	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	1.3e-36	79.4
WP_160054881.1\|372504_373680_+\|plate	baseplate J/gp47 family protein	A0A0U4JJ14	Pseudomonas_phage	1.8e-168	76.0
WP_160054884.1\|373672_374197_+\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	6.0e-79	79.3
WP_160054886.1\|374205_375924_+\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	8.5e-98	63.5
WP_160054889.1\|375931_376618_+	hypothetical protein	R9U4D4	Rhizobium_phage	2.1e-07	31.0
WP_160054891.1\|376614_377538_+	hypothetical protein	NA	NA	NA	NA
WP_160054894.1\|377534_378077_+	DNA-binding protein	A0A0U4J942	Pseudomonas_phage	3.9e-49	58.6
WP_160054897.1\|378073_378766_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	3.6e-39	40.3
WP_160054900.1\|378750_379728_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	2.0e-120	65.2
WP_160054903.1\|379754_380714_-	DUF4238 domain-containing protein	V9IQH5	Stenotrophomonas_phage	8.5e-23	27.8
WP_160054927.1\|380788_382069_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	4.3e-107	48.8
WP_160054930.1\|382055_382487_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.5e-19	43.4
384718:384770	attR	NA	NA	NA	NA

DBSCAN-SWA_2

927725 : 1004562

Pseudomonas_phage(62.79%)

holin,portal,head,protease,terminase,capsid,tRNA,lysis,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160055663.1\|927725_928901_-	DUF3596 domain-containing protein	A0A1W6JTA0	Pseudomonas_phage	6.7e-179	80.5
WP_137218918.1\|929121_929319_-	hypothetical protein	NA	NA	NA	NA
WP_160055665.1\|929560_929746_-	carbon storage regulator CsrA	J7I430	Pseudomonas_phage	2.1e-10	62.7
WP_160055667.1\|929814_930198_-	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	8.0e-33	66.1
WP_160055669.1\|930331_931096_-	XRE family transcriptional regulator	B5TK58	Pseudomonas_phage	1.3e-66	71.2
WP_160055671.1\|931964_932276_+	hypothetical protein	NA	NA	NA	NA
WP_160055673.1\|932272_932611_+	hypothetical protein	NA	NA	NA	NA
WP_160055675.1\|932607_933111_+	helix-turn-helix domain-containing protein	H2BDH4	Pseudomonas_virus	1.8e-08	52.5
WP_160055677.1\|933107_933839_+	Rha family transcriptional regulator	A0A1W6JTB2	Pseudomonas_phage	1.5e-40	42.4
WP_160055679.1\|933835_934168_+	hypothetical protein	NA	NA	NA	NA
WP_160055681.1\|934164_934452_+	hypothetical protein	NA	NA	NA	NA
WP_160055683.1\|934448_934673_+	hypothetical protein	A0A1W6JTF8	Pseudomonas_phage	7.3e-18	72.4
WP_160055685.1\|934675_935410_+	helix-turn-helix domain-containing protein	A0A0P0ZC04	Stx2-converting_phage	2.4e-33	44.2
WP_160055687.1\|935390_936194_+	ATP-binding protein	A0A1W6JTD8	Pseudomonas_phage	1.5e-73	53.9
WP_160055689.1\|936190_937564_+	AAA family ATPase	A0A2H4J8N1	uncultured_Caudovirales_phage	1.9e-169	65.2
WP_160055691.1\|937560_937845_+	hypothetical protein	A0A1W6JTC1	Pseudomonas_phage	2.1e-14	44.9
WP_160055693.1\|937841_938231_+	antitermination protein Q	A0A1W6JTD2	Pseudomonas_phage	1.0e-35	55.5
WP_160055695.1\|938390_938858_+	hypothetical protein	NA	NA	NA	NA
WP_160055697.1\|938943_939456_+	hypothetical protein	NA	NA	NA	NA
WP_160055699.1\|939482_940031_-	hypothetical protein	NA	NA	NA	NA
WP_160055701.1\|940138_940471_+\|holin	phage holin, lambda family	A0A2H4J1U5	uncultured_Caudovirales_phage	1.5e-51	90.0
WP_160055703.1\|940531_940984_+	hypothetical protein	NA	NA	NA	NA
WP_160055705.1\|940985_941300_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	1.4e-27	60.9
WP_127648860.1\|941456_941933_+	TerS protein	A0A0F7L441	uncultured_marine_virus	1.1e-31	49.0
WP_160055707.1\|941932_943474_+\|terminase	terminase large subunit	Q9MCT1	Enterobacteria_phage	6.2e-201	69.6
WP_160055709.1\|943481_944693_+\|portal	phage portal protein	A0A2H4JFN7	uncultured_Caudovirales_phage	3.7e-172	72.3
WP_160055711.1\|944676_945321_+\|head,protease	HK97 family phage prohead protease	A0A2H4JA51	uncultured_Caudovirales_phage	4.3e-87	75.7
WP_160055713.1\|945317_946523_+\|capsid	phage major capsid protein	A0A2H4J8D1	uncultured_Caudovirales_phage	3.3e-149	67.7
WP_160055715.1\|946580_946799_+	hypothetical protein	NA	NA	NA	NA
WP_160055717.1\|946799_947099_+\|head,tail	phage head-tail connector protein	A0A2H4J8C5	uncultured_Caudovirales_phage	4.9e-38	77.8
WP_174244431.1\|947098_947431_+\|head,tail	head-tail adaptor protein	A0A2D1GNG1	Pseudomonas_phage	1.3e-34	75.3
WP_160055719.1\|947441_947624_+	hypothetical protein	A0A2D1GNQ5	Pseudomonas_phage	7.7e-10	61.7
WP_160055721.1\|947627_948206_+	HK97 gp10 family phage protein	A0A2D1GNN2	Pseudomonas_phage	8.9e-60	64.4
WP_160055723.1\|948198_948585_+	DUF3168 domain-containing protein	A0A2D1GNT4	Pseudomonas_phage	2.7e-60	93.0
WP_127648850.1\|948640_949138_+	hypothetical protein	A0A2D1GNF2	Pseudomonas_phage	1.2e-84	95.8
WP_160055725.1\|949177_949504_+	hypothetical protein	A0A2D1GNT5	Pseudomonas_phage	5.8e-48	92.6
WP_160055727.1\|949545_949755_+	hypothetical protein	A0A2D1GNK2	Pseudomonas_phage	4.8e-16	83.7
WP_160055729.1\|949815_950226_+	hypothetical protein	NA	NA	NA	NA
WP_160055731.1\|950280_953709_+	tape measure protein	A0A2D1GNQ1	Pseudomonas_phage	0.0e+00	66.5
WP_160055733.1\|953708_954053_+\|tail	phage tail protein	A0A2D1GNJ1	Pseudomonas_phage	3.8e-42	70.2
WP_160055735.1\|954107_954809_+\|tail	phage minor tail protein L	A0A2D1GNF3	Pseudomonas_phage	1.1e-117	85.9
WP_160055737.1\|954812_955595_+	Mov34/MPN/PAD-1 family protein	A0A2D1GNP8	Pseudomonas_phage	5.3e-132	82.7
WP_160055739.1\|955591_956176_+\|tail	tail assembly protein	A0A2D1GNM2	Pseudomonas_phage	2.2e-82	79.5
WP_160055741.1\|956218_956575_-	hypothetical protein	NA	NA	NA	NA
WP_160055743.1\|956709_960333_+	DUF1983 domain-containing protein	A0A2D1GNE3	Pseudomonas_phage	0.0e+00	71.3
WP_160055745.1\|960336_960693_+	hypothetical protein	A0A059VJS9	Pseudomonas_phage	1.4e-34	63.6
WP_160055747.1\|960689_961352_+	hypothetical protein	A0A059VF40	Pseudomonas_phage	1.2e-95	73.2
WP_160055749.1\|961378_962518_+\|tail	tail fiber domain-containing protein	A0A059VJZ6	Pseudomonas_phage	2.1e-36	45.8
WP_160055751.1\|962578_963001_+	cell wall hydrolase	A0A2D1GNI1	Pseudomonas_phage	4.5e-61	75.9
WP_160055753.1\|963000_963510_+\|lysis	lysis protein	B5TK84	Pseudomonas_phage	3.0e-51	69.6
WP_160055755.1\|963535_964000_-	hypothetical protein	NA	NA	NA	NA
WP_160055757.1\|964347_964728_-	hypothetical protein	NA	NA	NA	NA
WP_160055759.1\|964820_965348_-	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_160055761.1\|966067_966346_-	hypothetical protein	NA	NA	NA	NA
WP_160055763.1\|966476_969287_-	FAD-binding protein	NA	NA	NA	NA
WP_160055765.1\|969283_969955_-	LUD domain-containing protein	NA	NA	NA	NA
WP_034154406.1\|969954_971409_-	iron-sulfur cluster-binding protein	NA	NA	NA	NA
WP_160055767.1\|971405_972230_-	(Fe-S)-binding protein	NA	NA	NA	NA
WP_160055769.1\|972380_974075_-	lactate permease LctP family transporter	NA	NA	NA	NA
WP_007915207.1\|974337_975105_+	FCD domain-containing protein	NA	NA	NA	NA
WP_008088297.1\|975224_975707_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.0e-24	42.0
WP_016986511.1\|975826_977230_+	sodium-dependent transporter	NA	NA	NA	NA
WP_053117014.1\|977237_977672_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_160055771.1\|977664_977979_+	RnfH family protein	NA	NA	NA	NA
WP_160055773.1\|978038_978566_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_064119476.1\|978663_979068_+	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_160055775.1\|979143_980817_-	DNA repair protein RecN	NA	NA	NA	NA
WP_007915219.1\|981057_981624_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_160055777.1\|981726_983643_+	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	4.2e-146	47.4
WP_160055779.1\|983940_985065_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	3.7e-25	38.3
WP_160055781.1\|985074_985881_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_007915228.1\|986138_987275_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
WP_160055783.1\|987401_990623_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_064119469.1\|990619_991096_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_105705402.1\|991124_991529_+	MFS transporter	NA	NA	NA	NA
WP_007915235.1\|991538_991847_-	YhbY family RNA-binding protein	NA	NA	NA	NA
WP_105705404.1\|991948_992578_+	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_160060049.1\|992780_994685_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	8.4e-115	49.7
WP_160055785.1\|994693_995545_+	dihydropteroate synthase	NA	NA	NA	NA
WP_064119464.1\|995561_996899_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_016986498.1\|996964_997720_+	triose-phosphate isomerase	NA	NA	NA	NA
WP_016986497.1\|997724_998111_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_007993601.1\|998531_998990_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_008088341.1\|999037_1000519_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_160055787.1\|1000546_1003078_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.5e-21	23.7
WP_007915259.1\|1003238_1003640_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_160055789.1\|1003644_1004562_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA

DBSCAN-SWA_3

1351348 : 1445196

Pseudomonas_phage(45.28%)

holin,protease,plate,tRNA,lysis,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160056199.1\|1351348_1352167_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.1e-07	31.9
WP_160056201.1\|1352256_1352661_-	SufE family protein	NA	NA	NA	NA
WP_160056203.1\|1352657_1353863_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	1.7e-68	36.1
WP_122591337.1\|1353996_1355031_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_003222107.1\|1355064_1355427_-	ArsC family reductase	NA	NA	NA	NA
WP_160056205.1\|1355698_1357333_+	Na+/H+ antiporter	NA	NA	NA	NA
WP_108225209.1\|1357357_1358113_-	peptidase M12	NA	NA	NA	NA
WP_160056207.1\|1358337_1359537_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_160056209.1\|1359580_1362283_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_016985097.1\|1362324_1363107_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003222119.1\|1363480_1364218_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_007908856.1\|1364421_1365285_+	elongation factor Ts	NA	NA	NA	NA
WP_003222124.1\|1365494_1366238_+	UMP kinase	NA	NA	NA	NA
WP_160056211.1\|1366234_1366792_+	ribosome recycling factor	NA	NA	NA	NA
WP_007908854.1\|1366806_1367562_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.1e-17	38.1
WP_160056213.1\|1367561_1368368_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_160056215.1\|1368364_1369555_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_160056217.1\|1369609_1370962_+\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
WP_160056219.1\|1371036_1373412_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_007908849.1\|1373457_1373961_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_160056221.1\|1373964_1375020_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003222142.1\|1375126_1375567_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_064393182.1\|1375563_1376340_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_160056223.1\|1376342_1377473_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_007908845.1\|1377484_1378111_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	3.7e-27	38.9
WP_160056225.1\|1378187_1381709_+	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	3.3e-197	36.8
WP_158960639.1\|1381848_1382796_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_160056227.1\|1382928_1384257_+\|tRNA	tRNA lysidine(34) synthetase TilS	A7IXR9	Paramecium_bursaria_Chlorella_virus	9.1e-07	24.5
WP_160056229.1\|1384531_1386163_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-157	53.3
WP_160056231.1\|1386168_1387014_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.4e-48	42.4
WP_007908839.1\|1387171_1388461_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.8e-138	59.7
WP_007908838.1\|1388632_1388911_+	cell division protein FtsB	NA	NA	NA	NA
WP_160056233.1\|1388907_1389615_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_034156318.1\|1389758_1390655_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008081726.1\|1390771_1391884_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	6.2e-33	29.1
WP_174244494.1\|1391974_1392826_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_034149878.1\|1392870_1393344_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_160056237.1\|1393340_1394399_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_007908831.1\|1394386_1395136_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.7e-67	52.6
WP_171057346.1\|1395177_1395813_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.0e-41	52.3
WP_160056239.1\|1396025_1396907_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	6.6e-06	33.3
WP_016985073.1\|1397013_1398024_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.1e-34	35.8
WP_008077096.1\|1398551_1398875_-	ferredoxin family protein	NA	NA	NA	NA
WP_160056241.1\|1399038_1401621_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.4e-27	23.8
WP_007908821.1\|1401832_1402567_+	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	2.3e-129	92.6
WP_160056243.1\|1403084_1403489_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_160056245.1\|1403539_1403962_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
WP_160056247.1\|1404102_1404441_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	2.2e-50	86.6
WP_160056249.1\|1404512_1405034_+	hypothetical protein	NA	NA	NA	NA
WP_160056251.1\|1405037_1405646_+\|plate	phage baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	1.4e-42	51.2
WP_160056253.1\|1405660_1405993_+\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	6.1e-37	69.1
WP_160056255.1\|1405989_1406985_+\|plate	baseplate J/gp47 family protein	A0A2H4JC04	uncultured_Caudovirales_phage	4.3e-110	63.8
WP_160056257.1\|1406981_1407617_+\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	1.4e-45	53.3
WP_160056259.1\|1407617_1410392_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	1.3e-87	38.7
WP_160056261.1\|1410401_1410911_+	DUF4376 domain-containing protein	A0A1S5R1J2	Pseudomonas_phage	3.2e-21	44.9
WP_160056263.1\|1410994_1411417_+\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	1.0e-20	42.6
WP_007908808.1\|1411516_1411702_+	hypothetical protein	NA	NA	NA	NA
WP_034154903.1\|1411704_1412871_+\|tail	tail protein	B0ZSG8	Halomonas_phage	8.5e-126	57.0
WP_160056265.1\|1412870_1413377_+\|tail	phage major tail tube protein	Q6R4W3	Vibrio_virus	3.7e-25	35.7
WP_160056267.1\|1413545_1414127_+\|tail	phage tail assembly protein	B0ZSH0	Halomonas_phage	5.5e-25	35.0
WP_160056269.1\|1414255_1416643_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
WP_160056271.1\|1416642_1417026_+\|tail	phage tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	6.1e-33	52.0
WP_064393145.1\|1417018_1417231_+\|tail	tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.6e-19	64.3
WP_160056273.1\|1417240_1418272_+	phage late control D family protein	B0ZSH3	Halomonas_phage	2.1e-96	51.8
WP_160056275.1\|1418414_1418999_+	hypothetical protein	B5TK65	Pseudomonas_phage	2.6e-83	77.8
WP_093436496.1\|1418995_1419175_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	2.6e-18	78.3
WP_160056277.1\|1419174_1420671_+\|tail	phage tail sheath subtilisin-like domain-containing protein	B5TK67	Pseudomonas_phage	2.8e-262	92.2
WP_007908779.1\|1420738_1421086_+\|tail	phage tail tube protein	B5TK68	Pseudomonas_phage	3.8e-58	93.9
WP_007908778.1\|1421082_1421379_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	1.1e-40	90.8
WP_160056279.1\|1421509_1423495_+	hypothetical protein	B5TK70	Pseudomonas_phage	1.3e-22	70.5
WP_160056281.1\|1423481_1424717_+	DNA circularization N-terminal domain-containing protein	B5TK71	Pseudomonas_phage	5.8e-149	66.5
WP_160056283.1\|1424720_1425764_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	1.4e-156	79.7
WP_110720163.1\|1425904_1426414_+\|plate	phage baseplate assembly protein	B5TK73	Pseudomonas_phage	4.9e-78	86.4
WP_003222234.1\|1426413_1426812_+	phage GP46 family protein	B5TK74	Pseudomonas_phage	1.6e-68	94.7
WP_160056285.1\|1426801_1427848_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	6.2e-152	80.3
WP_034154917.1\|1427835_1428435_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	1.9e-105	90.5
WP_160056287.1\|1428448_1429606_+\|tail	phage tail protein	B5TK77	Pseudomonas_phage	8.0e-169	75.1
WP_160056289.1\|1429602_1430118_+\|tail	phage tail protein	B5TK78	Pseudomonas_phage	4.5e-47	61.2
WP_160056291.1\|1430257_1431355_+\|tail	phage tail protein	B5TK79	Pseudomonas_phage	4.5e-121	60.4
WP_160056293.1\|1431362_1431929_+\|tail	tail fiber assembly protein	B5TK80	Pseudomonas_phage	4.8e-58	58.8
WP_160056295.1\|1432050_1432971_+\|tail	phage tail protein	B5TK81	Pseudomonas_phage	9.0e-38	39.6
WP_160056297.1\|1432973_1433414_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	6.4e-18	40.6
WP_160056299.1\|1433423_1434584_+	hypothetical protein	B5TK79	Pseudomonas_phage	2.4e-19	68.1
WP_160056301.1\|1434583_1434838_+	hypothetical protein	NA	NA	NA	NA
WP_160056303.1\|1434874_1435441_+	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	5.4e-86	82.6
WP_160056305.1\|1435419_1435938_+\|lysis	lysis protein	B5TK84	Pseudomonas_phage	9.8e-58	71.2
WP_160056307.1\|1436005_1436506_+	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	8.5e-75	88.0
WP_007908746.1\|1436589_1437645_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	7.7e-110	58.2
WP_160056309.1\|1437653_1438124_+	recombination regulator RecX	NA	NA	NA	NA
WP_160056311.1\|1438178_1439297_-	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_034154934.1\|1439635_1439830_+	hypothetical protein	NA	NA	NA	NA
WP_008077172.1\|1439830_1440256_-	hypothetical protein	NA	NA	NA	NA
WP_034154936.1\|1440445_1441192_+	DTW domain-containing protein	NA	NA	NA	NA
WP_160056313.1\|1441264_1441423_-	hypothetical protein	NA	NA	NA	NA
WP_077571373.1\|1441415_1442066_+	response regulator transcription factor	NA	NA	NA	NA
WP_042557932.1\|1442140_1442503_+	diacylglycerol kinase	NA	NA	NA	NA
WP_160056315.1\|1442499_1443426_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007908723.1\|1443559_1444339_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_160056317.1\|1444497_1445196_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA

DBSCAN-SWA_4

4106309 : 4112569

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160058607.1\|4106309_4106702_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.3e-51	76.7
WP_160058608.1\|4106703_4107060_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.0e-37	65.0
WP_160058609.1\|4107059_4107353_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	4.9e-30	65.7
WP_160058610.1\|4107349_4107685_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.8e-44	76.6
WP_160058611.1\|4107681_4108683_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.4e-161	84.1
WP_160058612.1\|4108774_4109776_+	glutathione S-transferase C-terminal domain-containing protein	NA	NA	NA	NA
WP_160058613.1\|4109893_4111288_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_007908080.1\|4111288_4112569_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.3e-98	53.9

DBSCAN-SWA_5

4229986 : 4265840

Insectomime_virus(20.0%)

protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160058667.1\|4229986_4230958_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_160058668.1\|4230954_4233312_-	fimbria/pilus outer membrane usher protein	NA	NA	NA	NA
WP_160058669.1\|4233391_4234180_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_160058670.1\|4234213_4234714_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_160058671.1\|4234718_4235255_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_160058672.1\|4235275_4235809_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_160058673.1\|4235908_4236430_-\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_160058674.1\|4236717_4237848_+	cell division protein ZapE	NA	NA	NA	NA
WP_160058675.1\|4238063_4239377_+	protein kinase	V5L5T2	Insectomime_virus	9.6e-09	27.4
WP_160058676.1\|4239489_4240194_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_160058677.1\|4240415_4241813_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_160058678.1\|4241839_4243231_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_095118172.1\|4243304_4244630_-	MFS transporter	NA	NA	NA	NA
WP_160058679.1\|4244911_4245784_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_160058680.1\|4245881_4246742_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_160058681.1\|4246854_4247964_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_160058682.1\|4248108_4248936_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_038362764.1\|4249125_4249674_+	cytochrome b	A0A0U2QLA7	Escherichia_phage	8.0e-18	41.5
WP_160058683.1\|4249677_4250604_-	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_160058684.1\|4250829_4252869_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_160058685.1\|4253077_4254208_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_160058686.1\|4254211_4255252_+	AraC family transcriptional regulator ligand-binding domain-containing protein	NA	NA	NA	NA
WP_016983898.1\|4255638_4256493_-	DUF2242 domain-containing protein	NA	NA	NA	NA
WP_160058687.1\|4256585_4257485_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_160058688.1\|4257603_4258809_+	MFS transporter	NA	NA	NA	NA
WP_160058689.1\|4259475_4261347_-	SurA N-terminal domain-containing protein	NA	NA	NA	NA
WP_003183171.1\|4261575_4261848_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.2e-19	58.4
WP_160058690.1\|4261996_4264393_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	8.4e-221	51.9
WP_003223632.1\|4264556_4265840_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.8e-138	59.6

DBSCAN-SWA_6

6018738 : 6067997

Tupanvirus(16.67%)

protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008078089.1\|6018738_6019242_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_160059693.1\|6019548_6020436_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_160059694.1\|6020437_6020995_-	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_160059695.1\|6021144_6021780_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_160059696.1\|6021776_6022451_+	anti-sigma factor	NA	NA	NA	NA
WP_034155015.1\|6022717_6023917_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.9e-11	28.9
WP_008086918.1\|6024092_6024950_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_160059697.1\|6025166_6025799_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_160059698.1\|6025959_6028977_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_007913119.1\|6028973_6029303_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_003206307.1\|6029317_6030568_-	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_007913117.1\|6030588_6031842_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	4.1e-102	53.4
WP_160059699.1\|6032114_6032825_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_160059700.1\|6032951_6033992_+	threonine aldolase	NA	NA	NA	NA
WP_160059701.1\|6034166_6034991_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_160059702.1\|6035199_6036300_-	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_150617784.1\|6036596_6037892_+	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_077574827.1\|6038694_6039465_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_160059703.1\|6039474_6040695_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_160059704.1\|6040694_6042644_-	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_016983627.1\|6042756_6044817_-	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_005792152.1\|6044832_6045363_-	hypothetical protein	NA	NA	NA	NA
WP_160059705.1\|6045470_6046448_-	membrane dipeptidase	NA	NA	NA	NA
WP_160059706.1\|6046682_6047084_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_160059707.1\|6047185_6047509_+	helix-turn-helix domain-containing protein	A0A1S5NNJ5	Burkholderia_phage	8.3e-31	65.7
WP_116028358.1\|6047538_6047955_+	DUF3010 family protein	NA	NA	NA	NA
WP_160059708.1\|6048077_6049022_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_160059709.1\|6049214_6050159_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_122612398.1\|6050268_6051156_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_160059710.1\|6051308_6052274_+	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_160059711.1\|6052501_6052978_+	thioesterase family protein	NA	NA	NA	NA
WP_160059712.1\|6053002_6054166_+	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
WP_160059713.1\|6054511_6054775_+	hypothetical protein	NA	NA	NA	NA
WP_007949927.1\|6054863_6055967_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_160059714.1\|6056481_6057858_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_064119194.1\|6058295_6059240_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016983941.1\|6059306_6060152_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_064119193.1\|6060148_6061327_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-25	37.1
WP_160059715.1\|6061567_6063565_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.1e-19	27.4
WP_160059716.1\|6063628_6063823_-	hypothetical protein	NA	NA	NA	NA
WP_007918292.1\|6063994_6064588_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_160059717.1\|6064676_6066149_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_160059718.1\|6066293_6067997_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.0e-50	30.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019426

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection