CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP019427	Pseudomonas sp. S04 chromosome, complete genome	2 crisprs	csa3,DinG,cas3,RT,DEDDh	1	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP019427_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019427_1

628183-628292

Orphan

Consensus_repeat	Method
TGGCCTTGTGGGGTACGGTCGTAGCCATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019427_1

>merge|NZ_CP019427|1|628183-628292|CRISPRCasFinder
TGGCCTTGTGGGGTACGGTCGTAGCCATCTTCAACCAGGCCTTTCTCTTCCAGGCGATCACGGCCGCCTTCGGCAACGGTCTGGCCTTGTGGGGTGCGGTCGTAGCCATC

>NZ_CP019427|1|1|628183-628292|CRISPRCasFinder
TGGCCTTGTGGGGTACGGTCGTAGCCATC	TTCAACCAGGCCTTTCTCTTCCAGGCGATCACGGCCGCCTTCGGCAACGGTC
TGGCCTTGTGGGGTGCGGTCGTAGCCATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019427.1\|WP_159993477.1\|631759_632650_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224001
NZ_CP019427.1\|WP_159993469.1\|623513_624647_-\|AGE-family-epimerase/isomerase	unknown	unknown	gnl\|CDD\|225493
NZ_CP019427.1\|WP_159993473.1\|626621_627122_-\|urease-accessory-protein-UreE	unknown	unknown	gnl\|CDD\|237322
NZ_CP019427.1\|WP_095169537.1\|627323_627956_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|236881
NZ_CP019427.1\|WP_095169531.1\|633632_634415_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP019427.1\|WP_095169528.1\|636108_637122_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223701
NZ_CP019427.1\|WP_159993483.1\|637849_639025_-\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234
NZ_CP019427.1\|WP_095169540.1\|625312_625927_-\|urease-accessory-protein-UreG	unknown	unknown	gnl\|CDD\|349776
NZ_CP019427.1\|WP_159993481.1\|634635_635541_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019427.1\|WP_159993471.1\|625950_626625_-\|urease-accessory-protein-UreF	unknown	unknown	gnl\|CDD\|223900
NZ_CP019427.1\|WP_095169546.1\|619366_620239_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|183080
NZ_CP019427.1\|WP_095169541.1\|624702_625275_-\|HupE/UreJ-family-protein	unknown	unknown	gnl\|CDD\|368209
NZ_CP019427.1\|WP_159993479.1\|632660_633536_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP019427.1\|WP_159993485.1\|639307_640582_-\|Hsp70-family-protein	unknown	unknown	gnl\|CDD\|212673
NZ_CP019427.1\|WP_095169545.1\|620235_620952_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223487
NZ_CP019427.1\|WP_095169543.1\|622568_623477_+\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|226474
NZ_CP019427.1\|WP_159993475.1\|628855_630925_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_CP019427.1\|WP_095169529.1\|635675_635981_+\|phosphate-starvation-inducible-protein-PsiF	unknown	unknown	gnl\|CDD\|183165
NZ_CP019427.1\|WP_095169534.1\|630990_631521_-\|bacterioferritin	unknown	unknown	gnl\|CDD\|225104
NZ_CP019427.1\|WP_095169544.1\|621703_622471_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187604

Protein	Function_ID	Function_description	E-value
NZ_CP019427.1\|WP_159993477.1\|631759_632650_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	1.02709e-39
NZ_CP019427.1\|WP_159993469.1\|623513_624647_-\|AGE-family-epimerase/isomerase	gnl\|CDD\|225493	COG2942, COG2942, N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism].	9.14908e-50
NZ_CP019427.1\|WP_159993473.1\|626621_627122_-\|urease-accessory-protein-UreE	gnl\|CDD\|237322	PRK13261, ureE, urease accessory protein UreE; Provisional.	3.18899e-58
NZ_CP019427.1\|WP_095169537.1\|627323_627956_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|236881	PRK11202, PRK11202, HTH-type transcriptional repressor FabR.	1.65618e-39
NZ_CP019427.1\|WP_095169531.1\|633632_634415_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	5.95943e-28
NZ_CP019427.1\|WP_095169528.1\|636108_637122_+\|hypothetical-protein	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	3.34135e-11
NZ_CP019427.1\|WP_159993483.1\|637849_639025_-\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.30409e-16
NZ_CP019427.1\|WP_095169540.1\|625312_625927_-\|urease-accessory-protein-UreG	gnl\|CDD\|349776	cd05540, UreG, urease accessory protein UreG. UreG is one of the four accessory proteins of urease. Urease is an enzyme which catalyzes the decomposition of urea to form ammonia and carbon dioxide. Bacterial urease is a trimer of three subunits which are encoded by genes ureA, ureB, and ureC. Up to four accessory proteins (ureD, ureE, ureF, and ureG) are required for urease catalytical function. UreG may play an important role in nickel incorporation of the urease metallocenter. UreG is a member of the Fer4_NifH superfamily which contains an ATP-binding domain. Proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.	5.06997e-128
NZ_CP019427.1\|WP_159993471.1\|625950_626625_-\|urease-accessory-protein-UreF	gnl\|CDD\|223900	COG0830, UreF, Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones].	3.42146e-59
NZ_CP019427.1\|WP_095169546.1\|619366_620239_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|183080	PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional.	1.12698e-132
NZ_CP019427.1\|WP_095169541.1\|624702_625275_-\|HupE/UreJ-family-protein	gnl\|CDD\|368209	pfam04955, HupE_UreJ, HupE / UreJ protein. This family of proteins are hydrogenase / urease accessory proteins. The alignment contains many conserved histidines that are likely to be involved in nickel binding. The members usually have five membrane-spanning regions.	5.08428e-42
NZ_CP019427.1\|WP_159993479.1\|632660_633536_-\|EamA-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	4.32339e-11
NZ_CP019427.1\|WP_159993485.1\|639307_640582_-\|Hsp70-family-protein	gnl\|CDD\|212673	cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins. This bacterial subfamily includes the uncharacterized Escherichia coli YegD. It belongs to the heat shock protein 70 (HSP70) family of chaperones that assist in protein folding and assembly and can direct incompetent "client" proteins towards degradation. Typically, HSP70s have a nucleotide-binding domain (NBD) and a substrate-binding domain (SBD). The nucleotide sits in a deep cleft formed between the two lobes of the NBD. The two subdomains of each lobe change conformation between ATP-bound, ADP-bound, and nucleotide-free states. ATP binding opens up the substrate-binding site; substrate-binding increases the rate of ATP hydrolysis. YegD lacks the SBD. HSP70 chaperone activity is regulated by various co-chaperones: J-domain proteins and nucleotide exchange factors (NEFs). Some family members are not chaperones but instead, function as NEFs for their Hsp70 partners, other family members function as both chaperones and NEFs.	0
NZ_CP019427.1\|WP_095169545.1\|620235_620952_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223487	COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].	3.24879e-132
NZ_CP019427.1\|WP_095169543.1\|622568_623477_+\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|226474	COG3965, COG3965, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	8.34633e-80
NZ_CP019427.1\|WP_159993475.1\|628855_630925_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	2.32518e-167
NZ_CP019427.1\|WP_095169529.1\|635675_635981_+\|phosphate-starvation-inducible-protein-PsiF	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	4.40311e-21
NZ_CP019427.1\|WP_095169534.1\|630990_631521_-\|bacterioferritin	gnl\|CDD\|225104	COG2193, Bfr, Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism].	2.40782e-38
NZ_CP019427.1\|WP_095169544.1\|621703_622471_+\|SDR-family-oxidoreductase	gnl\|CDD\|187604	cd05346, SDR_c5, classical (c) SDR, subgroup 5. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	6.10968e-146

>NZ_CP019427.1|WP_095169537.1|627323_627956_-|TetR-family-transcriptional-regulator
MLPRAEQKQQTRNALMDAARHLMECGRGFGSLSLREVAKTAGIVPTGFYRHFADMDQLGLVLVSEVGQTFRETIRLVRHNEFVMGGIIDASVRIFLDVVAANRSQFLFLAREQYGGSLPVRLAIGQLRENISADLAADLALMPKLQHLDLAGLSVMADLIVKSVFATLPDIIDPPLEALPEHLTPQAKITQQLRFIFIGLKHWQGLGSTE
>NZ_CP019427.1|WP_159993473.1|626621_627122_-|urease-accessory-protein-UreE
MLVIHRRIDPQPLWAAELHLNFEARSKSRLRCFSAAGEDVGLFLERGQPPLFNGECLEAEDGRIVRVCARPEQLLHVTCANAFELTRAAYHLGNRHVALQVGDGWLRLLDDYVLKAMLEQLGARTVSIEAPFQPEHGAYGGGHHHSRHGDEDFNYAPKLHQFGVRL
>NZ_CP019427.1|WP_159993471.1|625950_626625_-|urease-accessory-protein-UreF
MNPAWALLRLASPQLPIGGYSYSQGLEMAVDNGRVSDPSTARRWISDQLLLNLARFEAPLLLAHCNAAASADWPQLSSLCEQHRASRETRELHQESRQMGYSLQQLLSGLPELDPPARAFLERCHEPHLALCWALAARAWHITPQDALAAWLWSWLENQLAVLMKTLPLGQQAAQRLTSQLLPLLQQAQQDASRINPEHLGSAAFGLSLACMAHERQYSRLFRS
>NZ_CP019427.1|WP_095169540.1|625312_625927_-|urease-accessory-protein-UreG
MNTQPLRVGIGGPVGSGKTALTLALCLALRERYNLAVVTNDIYTREDADFLVRNQALAPERIIGVETGGCPHTAIREDASINLEAVDQLNRRFPGLDLILVESGGDNLSATFSPELSDLTIYVIDVSAGDKLPRKGGPGICKSDLLVINKIDLAPLVGASLSLMDSDTQRMRNGKPFVFSNQKTGQGLEQIIAFIERQGLLTAA
>NZ_CP019427.1|WP_095169541.1|624702_625275_-|HupE/UreJ-family-protein
MTLKRLFAAAALLLTPALAFAHPGHGDNGLLAGISHPIGGLDHLLAMLAVGLWAAQQQGAARWALPCTFVGTMLLGGFLGFEGLSLPALESGIAASVLALGLAVALAVRPALSLAVGATALFALFHGVAHGLELPEMSSPWTYAGGFVIATASLHAAGYALVRVLPQAAAPLVRLAGAASAATGAWLLAG
>NZ_CP019427.1|WP_159993469.1|623513_624647_-|AGE-family-epimerase/isomerase
MPDAPRSASQPELTALFATVQQHFRGVIVPLWQGPGWNAQIALPYEALDARHQPLPPQRYRAMACARQLYLFASLIGEVPAAEERAAALFRSLQQHFHDSEHGGWFYSIDPQGAPLDQRKDLYTHAFILFACAHYWAKVREPLVESVLNAALQVLAQHFATGNGLYEASLDRDWSSLGAGPLQNPLMHLAEAFLATLAVREDLAVEAALKALCAAMQQHFIDPQHGVMMEKPLGAVDNWFEPGHQFEWFFLLDASPTLRGSALHASLDRAFAFTEQRGVEPQTGAVAAMLDLVEGQQPRDATQRIWAQAEYLRALTLRPASQAALLHQLQALQQRFLHAGGWHECLDASGTVSRQDMPSTTPYHLATCYRGLAEYLG
>NZ_CP019427.1|WP_095169543.1|622568_623477_+|cation-diffusion-facilitator-family-transporter
MSNRGEQALLKQSTVLMLAVAIAGIVTGFVSGSQSILFDGFFSLIATFIKVLMLITAKLIAKQSNQRFQFGFWHLEPMVLLIEGSFLLLIAIYAFLNGVFGIINGGREIELGLVIVYAAVFTVVEFAYFFYIRQRNRALKSTLIQFDNISWLVDAMLSVGLLVSFLTALLLKTQGYGQWALYVDPLILILLALSMLAPAWKILRPALRDVLGIAPDQLDDKVRQVMDAAKAEHGFADYVSYVQKHGRARFIEIHVVLPVDYRLEGVATLDALREQISAQLGKPDAARWLTISFTADPKWIAG
>NZ_CP019427.1|WP_095169544.1|621703_622471_+|SDR-family-oxidoreductase
MSNTLFITGATSGFGEACARRFAEAGWKLVLTGRREERLNALCAELSKQTEVHGLVLDVRDRQAMEAAIANLPPSFATLRGLINNAGLALGVDPAPKCDLDDWDTMVDTNIKGLMYSTRLLLPRLIAHGRGAGIINLGSIAGNYPYPGSHVYGASKAFVKQFSLNLRCDLQGTGVRVSNIEPGLCESEFSLVRFAGDQARYDATYAGAEPIQPQDIADTIFWVLNAPAHININRLELMPVSQTWGGFAIDRNAKG
>NZ_CP019427.1|WP_095169545.1|620235_620952_+|ABC-transporter-ATP-binding-protein
MSQPILELKELDVFYGPIQALKKVSLHINEGETVSLIGSNGAGKSTLLMSIFGQPRAADGQIIYQGVDITHKSSHYIASNGIAQSPEGRRVFPDMTVEENLLMGTIPIGDKYASEDMQRMFELFPRLKERRTQRAMTMSGGEQQMLAIARALMSRPKLLLLDEPSLGLAPIVVKQIFATLRELAKTGMTIFLVEQNANHALRLSDRAYVMVNGQIRLTGTGKELLVNEEVRNAYLGGH
>NZ_CP019427.1|WP_095169546.1|619366_620239_+|ATP-binding-cassette-domain-containing-protein
MSEVVLSVEKLMMHFGGIKALSDVSLKVHRNSIFALIGPNGAGKTTVFNCLTGFYKASGGKIELNTRGQATNVIQLLGESFKASDFVSPKNFASRLYYKMFGGTHLVNRAGLARTFQNIRLFKEMSVLENLLVAQHMWVNRSLLAGILNTKGYRKAESDALDCAFYWLEVVDLVDCANRLAGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEALSAMIRLLRDEHDLTVVLIEHDMGMVMSISDHIVVLDHGNVIAEGGPEAIRNDPKVIAAYLGADEEELV
>NZ_CP019427.1|WP_159993475.1|628855_630925_+|AsmA-family-protein
MTRTRKILAWVFASLVLLIAVLVLVIAFFDWNRIKPPLNAKVSEELHRPFAINGNLSVVWQRELDEGGWRAWVPWPHVVAEDLSLGNPHWSKQPQMVSLKRVELRISPLALLAQRVVIPRIDLTEPNAQLQRLADGRANWTFTFDPKDPNAEPSSWVVDIGAIGFDKGHVTLDDQSLKTRLDLLIDPLGKPIPFSDIVGDKTAKKAQDQGAAPQDYAFALQVKGQYHGQALSGQGKIGGLLALQDAAKPFPLQAQVRIADTRVELAGTLTDPLNLGALDLRLKLAGSSLGNLYPLTGITLPDSSPYATDGHLIANLRAPEGAKFRYEDFNGTIGGSDIHGNLAYVASQPRPKLSGALVSNQLLFADLAPLIGADSNAKQKARGGDSKQPADKLLPVEEFRTERWRDMDADVEFTGKRIVHSEKLPFNDLYAHVILNDGQLNLQPLRFGVAGGKLDAQIRLNGQTTPLEGRAKLSARGFKLKQLFPTFEPMKTSFGELNGDADITGRGNSVAALLGSANGDLKMLINDGAISRELMELAGLNVGNYLVGKIFGDKEVKINCAAADFGIKSGLATTRLFVFDTENAIIYIDGTANMASEQLDLTITPESKGWRLISLRSPLYVRGKFIKPDAGVKGVPLMLRGAGMVALGVIAGPAAGLLALVAPSGGEPNQCAPLLEQMKSGKAPKTVKD
>NZ_CP019427.1|WP_095169534.1|630990_631521_-|bacterioferritin
MSEQQLSDINTLRQRARTHVENGAVTEGYSADREEVLRLLNESLATELVCVLRYKRHYFMADGLKAAVAAQEFLEHATQEAEHADKLAERIVQLGGEPEFNPDLLSKNSHAQYIAGNTLKEMVYEDLVAERIAIDSYREIIQYIGDKDPTTRRLFEDILAQEEEHADDMADLLKDL
>NZ_CP019427.1|WP_159993477.1|631759_632650_+|alpha/beta-fold-hydrolase
MSQDTATRYPLVLVPGMLGFVRLVLYPYWYAIIPALRRGGAKVIAVQVSPVNSNEVRGEELLLQIEAILRETGASKVNLIGHSQGSLTARYAAAKRPDLVASVTSVAGPNHGSELADYLHQHYPPESAKGRLLSALLQGVAWLMGLLETGHHVRRWPVDVHASHNSLTSAGVALFNQCYPQGLPQTWGGQGPEEVNGVRYYSWSGTLQPGITDRGGNLIDGTNRSCRLFARTFVREAGHCDGMVGRYSSHLGTVIGDDFPLDHFDIVNQSLGLVGKGADPVRLFVEHAQRLKAAGV
>NZ_CP019427.1|WP_159993479.1|632660_633536_-|EamA-family-transporter
MQYAYPLLAIFIWAGNTVITKMSAGAIFPAEIGFYRWLLAGLLFTPFMLKPVLQHWPLIRPNLGKIFVLGVLGMAVYQSLAYFAASLTSATNMGIILSLMPLMSLAMAIISLGQRLTAGALVGALLSFSGVLVVVSSGSLATLLEHGLNLGDAMMLIATLAYAIYSTLLKKWQLRLPPLVLLYLQVLVAVVVLFPLFVASPKTGLTLHNVPLVLYACLLASMVAPLAWMQAVVRLGPSRTTQFFNLLPLITALIAAVVLHEQLALYHLVGGALTLGGVIVCERWTRVLGRR
>NZ_CP019427.1|WP_095169531.1|633632_634415_+|helix-turn-helix-transcriptional-regulator
MSRKHIDLLDFSELPAPVYFRYADFDAHLYAAAHRHPWGTLEYSAHGVLHMEVGGSRFMSPPQYAIWVPPQTEHSFYSDQPINYRAVCLAPQVCRELPAQACTLAISDILKAILKDFAARDVKIPALAADQRLAEVLIDQLHQAPVHNGYLPYARSAALSAVLEALQAAPGDNRTQAQWAAHVHISERTLARQCLRELGMGFGEWRQRLRFLASIEALDSSRSIQEIAFDMGYSTASAFTAMFQRQAGCSPEHYRRNKGF
>NZ_CP019427.1|WP_159993481.1|634635_635541_+|hypothetical-protein
MAMTARYLKQTGRASEYDALAQSTTAEGTRSDTAADLFSYAQLFDLPVQPGRVIEVDAPTMANLQLAQRTVARSKELLPLSGNQRPSIWEKGGSAIAKLKNLRKIDLATGQATAELTIGEAAQAAMKIMGGNCSENSKVTFSILASQPRSAAVHIVRASDFDHQYVLIGDLSKPAELVVADSWPELPAAHLAQEGCFGFDPDPVISLEPGPAIAEYSFINDTPPGPPTLPARGTDDSTLRSIKVAKLHQKGSYAQWTSSNALGATYREPGGQPVSFERFRAELIERRIKAYEEYVQAIGPV
>NZ_CP019427.1|WP_095169529.1|635675_635981_+|phosphate-starvation-inducible-protein-PsiF
MKMLRIPLLMVGLLLCSQGFAATAQQNKMTTCNADATTKALKGDERKAFMSDCLKAQPAANDAKALTPQQEKMKTCNATAATQALTGEARKTFMSDCLKKK
>NZ_CP019427.1|WP_095169528.1|636108_637122_+|hypothetical-protein
MPTFSQRHVLLVVSWVIIFGGLLLVLPLRLLPSLLAGLLVYELVNMLTPQLQRLIEGRRARWLAVALLGTLVVSVLALIFAGAFSFLLHEAENPGASLDKFMGVVDKARGQLPPFVDAYLPASAAEFRVAIGEWLSKHLSDLQLVGKDAAHMFVTLLIGMVLGAIIALQRVPDLTKRKPLAAALFDRLHLLVQAFRNIVFAQIKISLLNTFFTGIFLAVILPMFGIHLPLTKTLIVLTFLLGLLPVIGNLMSNTLITIVGLSLSIWVAMAALGYLIFIHKLEYFLNARIVGGQISAKSWELLLAMLVFEAAFGLPGVVAGPIYYAYLKSELKQAGMV
>NZ_CP019427.1|WP_159993483.1|637849_639025_-|DDE-type-integrase/transposase/recombinase
MPWRELKPMDRKVMFIAAYLADKHTFSKLCSDYEISRKTGYKWVERYKAEGPSGLEERSRCRHNQSYVVPVAVRQAIIELRSIGETTPGPKKIQNDLLKRFPDQDPPSKTTIYNTLKAADLITPQRVRRRVAVYPKPLSKAEKPNQLFSADYKGQFLTGAGVWCYPLTIMDHASRFLLACQSMSSTNLKETQQTFERVFREYGLPERIRTDNGVPFASTGRAGLSQLSIWWLRLGIIPERIEPGRPDQNGRHERMHRTLKSTLPQPPAIPWEAQQRQFDRFMQHYNYERGHEALDQKTPASCYSPSTRTYPEKLPEMGYASHVECYLADSNGIINRAGLRIYIANVLKHQTIGMEMISDDVWEVIFGPVILGRVYAREAKNGYVSIKVLPM
>NZ_CP019427.1|WP_159993485.1|639307_640582_-|Hsp70-family-protein
MKNASPARACGIDFGTSNSTVGWLRPGMETLIALEDDKITLPSVVFFNIEERRPVYGRLALHEYLEGYEGRLMRSLKSLLGSKLIKHDTSVLGTAMPFKDLLGLFIGQLKLRAETAAGREFEEVVLGRPVFFVDDDPMADKEAEDTLVDVARAIGFKEVSFQYEPIAAAFDYESTIEREELVLIVDIGGGTSDFSLVRLSPERRGLDQRQDDILATGGVHVGGTDFDKQLSLQGVMPLFGYGSRMKSGAYMPTSQHMNLATWHTINSVYSQKSQLALGSMRYDIEDTGGIDRLFKLIEQRAGHWLAMEVEETKIQLTHADSRHVPLDRIEPGLSVELSRALFESAIDGLLERVRNSVSQLLLDANVSVDQVDTVFFTGGSSGIPALRNSVSAMLPNARHVEGNIFGSIGSGLAIEAAKRYGSMD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP019427_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP019427_2

2718847-2718927

Orphan

Consensus_repeat	Method
TTGATGTGGTGTATACAGAATCTGTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP019427_2

>merge|NZ_CP019427|2|2718847-2718927|CRISPRCasFinder
TTGATGTGGTGTATACAGAATCTGTGAACAGCCAAAACCACTGTGGGAGCGGGCTTGATGTGGTGTATACAGAATCTGTGA

>NZ_CP019427|2|2|2718847-2718927|CRISPRCasFinder
TTGATGTGGTGTATACAGAATCTGTGA	ACAGCCAAAACCACTGTGGGAGCGGGC
TTGATGTGGTGTATACAGAATCTGTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP019427.1\|WP_159995520.1\|2714919_2715972_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378704
NZ_CP019427.1\|WP_159995518.1\|2713564_2714923_+\|glutathione-disulfide-reductase	unknown	unknown	gnl\|CDD\|235701
NZ_CP019427.1\|WP_159995516.1\|2712195_2712384_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019427.1\|WP_095168464.1\|2710519_2711443_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225797
NZ_CP019427.1\|WP_095168451.1\|2716917_2718480_+\|alkyl-hydroperoxide-reductase-subunit-F	unknown	unknown	gnl\|CDD\|237942
NZ_CP019427.1\|WP_095168446.1\|2721880_2722243_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|320084
NZ_CP019427.1\|WP_095108460.1\|2712595_2713435_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP019427.1\|WP_159995532.1\|2727420_2728302_-\|EamA-family-transporter-RarD	unknown	unknown	gnl\|CDD\|225510
NZ_CP019427.1\|WP_159993242.1\|2720528_2721734_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP019427.1\|WP_159995530.1\|2726280_2727357_+\|4-hydroxyphenylpyruvate-dioxygenase	unknown	unknown	gnl\|CDD\|273528
NZ_CP019427.1\|WP_095168449.1\|2719078_2719606_-\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319900
NZ_CP019427.1\|WP_159995514.1\|2711776_2712058_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019427.1\|WP_095168453.1\|2716232_2716796_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|211789
NZ_CP019427.1\|WP_159995534.1\|2728377_2729391_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381313
NZ_CP019427.1\|WP_095168462.1\|2711534_2711765_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP019427.1\|WP_159995528.1\|2725091_2726033_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP019427.1\|WP_159995524.1\|2722465_2724025_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP019427.1\|WP_159995522.1\|2719805_2720366_+\|DUF4946-domain-containing-protein	unknown	unknown	gnl\|CDD\|318518
NZ_CP019427.1\|WP_095168465.1\|2709875_2710523_+\|cytochrome-c4	unknown	unknown	gnl\|CDD\|225418
NZ_CP019427.1\|WP_159995526.1\|2724140_2725013_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176102

Protein	Function_ID	Function_description	E-value
NZ_CP019427.1\|WP_159995520.1\|2714919_2715972_-\|DNA-binding-protein	gnl\|CDD\|378704	pfam11740, KfrA_N, Plasmid replication region DNA-binding N-term. The broad host-range plasmid RK2 is able to replicate in and be inherited in a stable manner in diverse Gram-negative bacterial species. It encodes a number of co-ordinately regulated operons including a central control korF1 operon that represses the kfrA operon. The KfrA polypeptide is a site-specific DNA-binding protein whose operator overlaps the kfrA promoter. The N-terminus, containing an helix-turn-helix motif, is essential for function. Downstream from this family is an extended coiled-coil domain containing a heptad repeat segment which is probably responsible for formation of multimers, and may provide an example of a bridge to host structures required for plasmid partitioning.	9.84635e-12
NZ_CP019427.1\|WP_159995518.1\|2713564_2714923_+\|glutathione-disulfide-reductase	gnl\|CDD\|235701	PRK06116, PRK06116, glutathione reductase; Validated.	0
NZ_CP019427.1\|WP_159995522.1\|2719805_2720366_+\|DUF4946-domain-containing-protein	gnl\|CDD\|318518	pfam16304, DUF4946, Domain of unknown function (DUF4946). This small family consists of uncharacterized proteins around 180 residues in length and is mainly found in various Pseudomonas species, especially in Pseudomonas aeruginosa. The function of this family is unknown.	1.66781e-62
NZ_CP019427.1\|WP_095168464.1\|2710519_2711443_+\|c-type-cytochrome	gnl\|CDD\|225797	COG3258, COG3258, Cytochrome c [Energy production and conversion].	5.40196e-114
NZ_CP019427.1\|WP_095168451.1\|2716917_2718480_+\|alkyl-hydroperoxide-reductase-subunit-F	gnl\|CDD\|237942	PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional.	0
NZ_CP019427.1\|WP_095108460.1\|2712595_2713435_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	4.85085e-155
NZ_CP019427.1\|WP_159995532.1\|2727420_2728302_-\|EamA-family-transporter-RarD	gnl\|CDD\|225510	COG2962, RarD, Predicted permeases [General function prediction only].	3.07136e-70
NZ_CP019427.1\|WP_095168446.1\|2721880_2722243_-\|DNA-binding-protein	gnl\|CDD\|320084	cd16170, MvaT_DBD, DNA-binding domain of the bacterial xenogeneic silencer MvaT. MvaT is a xenogeneic silencer conserved in Pseudomonas which assists in distinguishing foreign from self DNA. It prefers binding to flexible DNA segments with multiple TpA steps, and forms nucleoprotein filaments through cooperative polymerization.	7.28013e-19
NZ_CP019427.1\|WP_159995530.1\|2726280_2727357_+\|4-hydroxyphenylpyruvate-dioxygenase	gnl\|CDD\|273528	TIGR01263, 4-hydroxyphenylpyruvate_dioxygenase, 4-hydroxyphenylpyruvate dioxygenase. This protein oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic (see . In some bacterial species, this enzyme has been studied as a hemolysin. [Energy metabolism, Amino acids and amines].	1.43249e-176
NZ_CP019427.1\|WP_095168449.1\|2719078_2719606_-\|lactoylglutathione-lyase	gnl\|CDD\|319900	cd07233, GlxI_Zn, Glyoxalase I that uses Zn(++) as cofactor. This family includes eukaryotic glyoxalase I that prefers the divalent cation zinc as cofactor. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic glyoxalase I uses nickel. However, eukaryotic Trypanosomatid parasites also use nickel as a cofactor, which could possibly be explained by acquiring their GLOI gene by horizontal gene transfer. Human glyoxalase I is a two-domain enzyme and it has the structure of a domain-swapped dimer with two active sites located at the dimer interface. In yeast, in various plants, insects and Plasmodia, glyoxalase I is four-domain, possibly the result of a further gene duplication and an additional gene fusing event.	4.89513e-89
NZ_CP019427.1\|WP_159995526.1\|2724140_2725013_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176102	cd05466, PBP2_LTTR_substrate, The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, oxidative stress responses, nodule formation of nitrogen-fixing bacteria, synthesis of virulence factors, toxin production, attachment and secretion, to name a few. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.29251e-47
NZ_CP019427.1\|WP_095168453.1\|2716232_2716796_+\|peroxiredoxin	gnl\|CDD\|211789	TIGR03137, AhpC, peroxiredoxin. This peroxiredoxin (AhpC, alkylhydroperoxide reductase subunit C) is one subunit of a two-subunit complex with subunit F(TIGR03140). Usually these are found as an apparent operon. The gene has been characterized in Bacteroides fragilis, where it is important in oxidative stress defense. This gene contains two invariant cysteine residues, one near the N-terminus and one near the C-terminus, each followed immediately by a proline residue. [Cellular processes, Detoxification, Cellular processes, Adaptations to atypical conditions].	2.51697e-140
NZ_CP019427.1\|WP_159995534.1\|2728377_2729391_-\|aldo/keto-reductase	gnl\|CDD\|381313	cd19087, AKR_AKR12A1_B1_C1, AKR12A, AKR12B, AKR12C families of aldo-keto reductase (AKR). Streptomyces fradiae TylCII, Saccharopolyspora erythraea EryBII, and Streptomyces avermitilis aveBVIII are founding members of aldo-keto reductase family 12 member A1 (AKR12A1), B1 (AKR12B1), and C1(AKR12C1), respectively. TylCII acts as a NDP-hexose 2,3-enoyl reductase. EryBII is a mycarose/desosamine reductase involved in L-mycarose and D-desosamine production. aveBVIII functions as a dTDP-4-keto-6-deoxy-L-hexose-2,3-reductase.	1.19344e-155
NZ_CP019427.1\|WP_159993242.1\|2720528_2721734_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	2.61355e-80
NZ_CP019427.1\|WP_159995524.1\|2722465_2724025_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	8.22038e-89
NZ_CP019427.1\|WP_095168465.1\|2709875_2710523_+\|cytochrome-c4	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	3.62199e-21
NZ_CP019427.1\|WP_159995528.1\|2725091_2726033_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.90422e-20

>NZ_CP019427.1|WP_095168451.1|2716917_2718480_+|alkyl-hydroperoxide-reductase-subunit-F
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLSSQITLLDNGADARTPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIRSLKGEFHFETYFSLSCQNCPDVVQALNLMAVLNPNIHHVAIDGALFQAEVDERQIMAVPSVYLNGVNFGQGRMGLEEILAKIDTSGIERQAEKISAKPAFDVLVVGGGPAGASAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADALVPGQNGEPHQVKFASGATLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDGQKVNGLRYKDRQSGETLNVELEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDNRGETSIPGVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
>NZ_CP019427.1|WP_095168453.1|2716232_2716796_+|peroxiredoxin
MPIINSQVKPFTATAYKNGDFVQVSDADLKGKWSVVFFYPADFTFVCPTELEDLADNYAEFQKLGVEIYSVSTDTHFAHAAWHNTSPAIGKIQYTMIGDPTHVISRNFDVLIEEAGLADRGTFVINPEGQIKIVELNDGGVGRDASELLRKIKAAQYVAAHPGQVCPAKWKEGEATLAPSLDLVGKI
>NZ_CP019427.1|WP_159995520.1|2714919_2715972_-|DNA-binding-protein
MARGGINKAVVQAARLAILARGDNPSIDAVRIEMGNTGSKTTIHRYLKELDDEVAARQSEPQEQIDDELTGLVARLAQRLREQGQERIDHAQEGFEQARKALESQLAEALQLQAQLTRQLETQGATLASESAALQDTRASLQGEQTRNASLSQALSDFELRLNDKDEQIRSLEEKHLHARDALEHYREAIKDQREQEQRRHEGQVQQIQMELRQAQQSAMVRQDEITQLNRDNERLLTENRGTVRELHLLQDQLKHSETRQAQAQEQIRRHEAEATLLQERLRVAVLESTSAKQAAAEQLHANAELELRAASAEASLQALHLAVATQAALEPAPVPVPVPSPASKQSKKP
>NZ_CP019427.1|WP_159995518.1|2713564_2714923_+|glutathione-disulfide-reductase
MAYDFDLYVIGAGSGGVRAARFAAGFGAKVGVAESRYLGGTCVNVGCVPKKLLVYGAHFAEDFEQAAGFGWSLDQAQFDWATLIANKDREINRLNGIYRNLLVNSGVTLHEGHARIVAPHTVEINGERFSAKHILIATGGWPQIPQIPGAEHAISSNEAFFLKTLPKRVLVVGGGYIAVEFAGIFHGLGASTSLLYRGDLFLRGFDGAVRKHLQEELTKRGMDLQFNADIERIDRQADGSLSVTLKDGRKLETDCVFYATGRRPMLDNLGLENTAVKLDQKGFVEVDELYQTAEPSILAIGDVIGRVQLTPVALAEGMAVARRLFKPEQYRLVDYQMIPTAVFSLPNIGTVGLTEEQAREAGHEVQIFESRFRPMKLTLTECQERTLMKLVVDAKTDKVLGCHMVGPEAGEIVQGLAIALKAGATKRDFDETIGVHPTAAEEFVTMRTPVAG
>NZ_CP019427.1|WP_095108460.1|2712595_2713435_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKRALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIGDEPFAVVLADDLCVNLEGDGVLTQMVKLYKQYRCTIVAIQEVDPQETHKYGVIAGDLIGDDLYRVRNMVEKPKPEDAPSNLAIIGRYILTPDIFKLIEETEPGKGGEIQITDALMKQAQDGCVIAYKFKGTRFDCGGAEGYIEATNFCFEHFYKTGKAY
>NZ_CP019427.1|WP_159995516.1|2712195_2712384_-|hypothetical-protein
MSAAKSVNGYLINKAKDGQWWVDSAGGENIAGPFPTEAMAIEVASVLQDTPPAPKRRGAKPE
>NZ_CP019427.1|WP_159995514.1|2711776_2712058_-|hypothetical-protein
MKITLAVMAVLVLSGCATASKTYLDDGQQGLSIDCSGEANSWATCYEKADASCAGTGYKIVGTEGTPALKESDKTLGADVGNYKSRSVVVVCN
>NZ_CP019427.1|WP_095168462.1|2711534_2711765_+|hypothetical-protein
MKREQVRERHAEGHISATHVIQNPATPGEWIVFFKKSAGRSFFLVDDNDEVESFTHLDDLVETVRGLGIKFAEIHM
>NZ_CP019427.1|WP_095168464.1|2710519_2711443_+|c-type-cytochrome
MKFLSFAPLALALASLNGYAAQTVMDDQSELKIPAATSAKVEYFQAPAEHELPDNAFGKLVRQGHSLFVDTKRQAPAYVGNGLNCSNCHLDQGRLPNSAPLWGAYPMYPAYRKKNDKVNTFAERLQGCFEFSMNGKPPAADGPEISALSAYAYWLATKAPIGVELPGRGYPEVKQPAKGYDIAQGAQVYKAQCAVCHGDSGQGQKVGEDYVMPPLWGKDSYNWGAGMHRINTAASFIQYNMPLGKAQSLSDQQAWDVAAFINSHERPQDPRLIDGSVEKTRVKFHANDGVNLYGQTVDGVLIGQGIR
>NZ_CP019427.1|WP_095168465.1|2709875_2710523_+|cytochrome-c4
MDFKPTVLGSLMLIAVSVVNADDGQKIYTQGGALPAATACFACHGADGMGMPAAGFPRLAGLSAGYLSKQLADFRSGSRVSPVMQPLAKALSEGEIQAVTSTLAAMPAPATPQVTRNTTPTEPGARLALRGAWDRQIPECVMCHGPGGVGVGTAFPPLAGQSASYLVGQLNAWRDGTRHNDPNDLMGHIAKSLTPDEIKAVADYFATLGSQEAKP
>NZ_CP019427.1|WP_095168449.1|2719078_2719606_-|lactoylglutathione-lyase
MSLHDLNTFPGVTAQPDTATQQFVFNHTMLRVKDITKSLDFYTRILGFSLVEKRDFPEAEFSLYFLALVDKNQIPADAAARTEWMKSIPGILELTHNHGTENDPDFAYHNGNTDPRGFGHICISVPDIRAACERFEALGCDFQKRLNDGRMKSLAFIKDPDAYWVEIIQPAPLLA
>NZ_CP019427.1|WP_159995522.1|2719805_2720366_+|DUF4946-domain-containing-protein
MIRTIRSLLLLTGLFAAAAAAQPQLAEITWPDGWQAQALEPEAAPEPAPETAPSEAPAKVSRQRAVKNDENGDTILVMELTMTQVEVGHVVNLQGVLLEMRKSIQKDFFQGGYQSVCNKIHPATLSRLAALETTCTITQNGRHVLSQTLVAAVEADKAYVFSYAGQADAYAASQKEIQALRESLKL
>NZ_CP019427.1|WP_159993242.1|2720528_2721734_-|ISL3-family-transposase
MRDINTFLPFWEGFSVVTIKPDGDALQIDLIPHATRFPSCSGCQKPCSTTHEYCERTVRDLPILGRAVRLSVLLRRVGCRDCGKRMEAVSWLDRYARMTRRLAEAVIQACERLPTLHVAQLFGLHWDTVRLLERRALQAALSVLPKAQPRRLVMDEFALFKGHRYASVVLDADTRRVLWIGEGRSRAAIRPFFEELGPEGCARIEAVAMDMNTAFDLEVRQHCPNARVVYDLFHVVAKYGREVIDRVRVDEANRLRHDKPARKVIKQARWLLLRNPQNLKTPEQQVRLEDLLAANQALMTVYLMKAELKTLWTPSTAWGWRSAWKQWLRHAHESEIPALIQFAKRLKGYWRGIVSRVRWPMHTGQLEGINNRIKVIKRMAYGYRDSEFFFMKIKSVFPGNP
>NZ_CP019427.1|WP_095168446.1|2721880_2722243_-|DNA-binding-protein
MSRLAEFRAAEKALQEQLAQLESLKNDAGLKKEIEFEEKLQGLMKTYGKSLRDIIAILDPNAKASLQPAAAPKTRRARVVKVYQNPHTGELIETKGGNHRGLKAWKEQYGASTVDSWLRA
>NZ_CP019427.1|WP_159995524.1|2722465_2724025_-|EAL-domain-containing-protein
MPLTLKRRRKSAYRNAITVLVALVPVVLGGAILYMQAESRLSQSTHQTAEEAVRQFDLMLDNTAHAAQLLLPLAGQPCADVKLALREQVTRRPFVRSTNLVWDNNLYCSSLFGEFEEKVDPGEYTHGKLWLMNGNPVTPNTALLVFRQSEGRQGALTTLDGYHLSNVLRLIGRQTLLLLQVGDNWLSADGQVHEGALPELPVARNYLESSRYAFKVEAGFPEGETWRYMVSEYPPLFSLLIFFGAIAGTLAHWLQKRSTSPSLELQRAMEAREFVPYFQPVVHGDSKGWAGTEVLMRWNHPKDGLVRPDLFIPFAEHSGLIVPMTRSLMQQTAAVLGPQARHFGERFHIGINITASHCQDLDLVADCREFLAAFPPGKVALVLELTERELIEPTAITHQLFEQLHGLGVMIAIDDFGTGHSSLGYLRQFNVDFLKIDQSFVAMIGVDALSRHILDSIIELSGKLDLGIVAEGVETLEQSEYLAGHGVNFLQGYLYGRPMPAGEFIIELNKHLAVEQNAL
>NZ_CP019427.1|WP_159995526.1|2724140_2725013_-|LysR-family-transcriptional-regulator
MTLSQLEIFSLVAELQGFTSAAHRLGISQSAVSHAIKALEQELGVELLRRQQSQVELSDIGQQLLVRARAMLGLASTLRQEAADARGMKSGTLRIGSFGPTASIGLLPKILPQYRAAYPGIEVHIDEGPDRQVLQWLDERRIDVGFVVLPEERFDTFPLVEDQMVALIPVGHALARRDSLTLRELCDDPFILTEAGSAELVTRLFSAARLSPDIRYRCSQLLSTLATVSRGEALTLVAERSLPDTPQAHYVKRPLSPMVKRQVGLAVLDQRQCSPATLAFIKLATGLSLS
>NZ_CP019427.1|WP_159995528.1|2725091_2726033_+|EamA-family-transporter
MKSLVQSGWRGADVPVYLKLASVTMLWGGTFVAGRYLAGSLSPLFAASLRFALASLALLLFMGLARIPLARPSGRQWLQLGLLGFFGIYVYNLCFFYGLQYIHASRASLIVALNPAVIGLASWLLFKERLSASKVVGILLCLGGAGLVIVSGDQSVFTGGAWLGDLLLLGCVLGWGVYSLFSRGLNQALGPLHTVTYSVVLGTLMLWLTCAVRGEVQWQVLAQLPPGQVISLLYLGVLGSALAYIWYYDGIRRIGATRSGAFIALNPLTAVILGALLLGEPMTGAMYLGGAVILLGIYLCNKAFAATAKRRIL
>NZ_CP019427.1|WP_159995530.1|2726280_2727357_+|4-hydroxyphenylpyruvate-dioxygenase
MADLYENPMGLMGFEFIEFASPTPNTLEPIFEIMGFTKVATHRSKNVHLYRQGAINLILNNEPNSVASYFAAEHGPSVCGMAFRVKDSQLAYNRALELGAQPIHIETGPMELNLPAIKGIGGAPLYLIDRFGEGSSIYDIDFVFIEGVDRNPVGAGLKIIDHLTHNVYRGRMAYWANFYEKLFNFREIRYFDIKGEYTGLTSKAMTAPDGMIRIPLNEESSKGAGQIEEFLMQFNGEGIQHVAFLADDLIKTWDHLKSIGMRFMTAPPDTYYEMLEGRLPNHGEPVGELQARGILLDGSSEAGDKRLLLQIFSETLMGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLSTD
>NZ_CP019427.1|WP_159995532.1|2727420_2728302_-|EamA-family-transporter-RarD
MSKGIALSVSASVLFAVMYFYTSLLSPLDGVEIFGWRMLLTVPCMTVFMLVSGEWQRVVEILRRLAAKPLLLGGLLVSSALLGVQLWLFMWAPLNGHSLDVSLGYFLLPLTMVLTGRIVYGERLSYLQKIAASLATLGVLNELYQVGSFSWATMLVAIGYPTYFVLRRRLAADNLGGLWLDMALLLPVAYWFVHNGAQGFGVFDQYPWLTLLIPVLGIISASALVVYIIASRLLPFSLFGLLSYVEPVLLLGVALLLGESIKAGEWLTYIPIWLAVLVLVFEGFKHLVRQRRP
>NZ_CP019427.1|WP_159995534.1|2728377_2729391_-|aldo/keto-reductase
MSYRTLGHSGLQVSTLTLGTMMFGEQTSTEDSLRIIDKAWDQGINFIDTADVYTNGRSEEIVGEAIAGNRHEWVVASKVGFGPVDGLPNRSGLSRKHIFNGIDASLTRLDTDYLDIYYLHREDHNTPLHVTVSAIGDLIRQGKIRYWGLSNYRGWRIAEVIRVAEQLGVDRPVISQPLYNIVNRQAETEQITAANAYGLGVVPYSPLARGVLSGKYAPDIRPDANSRAGRQDKRILETEWRVESLRIAQQIQAYTEQRGVGMVEFAIAWVLNNAAVTSAIVGPRTEEQWDAYTKAQDVKISAEDEAFIDSLVTPGHASTPGFNDVSHFVSGRKALSS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3039755-3039781	1	0.963
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3782909-3782935	1	0.963
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3907342-3907368	1	0.963
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3608858-3608884	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2039267-2039293	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2535377-2535403	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2547932-2547958	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2928855-2928881	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2928988-2929014	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2929121-2929147	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	2929254-2929280	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3172020-3172046	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3172289-3172315	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3172558-3172584	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3701519-3701545	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3701666-3701692	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	3906942-3906968	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4106687-4106713	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4106820-4106846	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4107086-4107112	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4107352-4107378	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4107465-4107491	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4107977-4108003	2	0.926
NZ_CP019427_2	2.1\|2718874\|27\|NZ_CP019427\|CRISPRCasFinder	2718874-2718900	27	NZ_CP019427.1	4404317-4404343	2	0.926

1. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3039755-3039781, mismatch: 1, identity: 0.963

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcactgtgggagcgggc	Protospacer
**********.****************

2. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3782909-3782935, mismatch: 1, identity: 0.963

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcactgtgggagcgggc	Protospacer
**********.****************

3. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3907342-3907368, mismatch: 1, identity: 0.963

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcactgtgggagcgggc	Protospacer
**********.****************

4. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3608858-3608884, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

5. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2039267-2039293, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

6. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2535377-2535403, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcagtgtgggagcgggc	Protospacer
**********.** *************

7. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2547932-2547958, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcactgtgggagcgagc	Protospacer
**********.*************.**

8. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2928855-2928881, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

9. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2928988-2929014, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

10. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2929121-2929147, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

11. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 2929254-2929280, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

12. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3172020-3172046, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

13. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3172289-3172315, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

14. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3172558-3172584, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

15. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3701519-3701545, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcattgtgggagcgggc	Protospacer
**********.**.*************

16. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3701666-3701692, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaatcattgtgggagcgggc	Protospacer
**********.**.*************

17. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 3906942-3906968, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acagccaaaaccaccgtgggggcgggc	Protospacer
**************.*****.******

18. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4106687-4106713, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

19. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4106820-4106846, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

20. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4107086-4107112, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

21. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4107352-4107378, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

22. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4107465-4107491, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

23. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4107977-4108003, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

24. spacer 2.1|2718874|27|NZ_CP019427|CRISPRCasFinder matches to position: 4404317-4404343, mismatch: 2, identity: 0.926

acagccaaaaccactgtgggagcgggc	CRISPR spacer
acacccagaaccactgtgggagcgggc	Protospacer
*** ***.*******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1273056 : 1281774

Pseudomonas_phage(42.86%)

holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095166837.1\|1273056_1273914_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	8.4e-06	33.3
WP_095166839.1\|1274018_1275023_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	3.8e-34	35.8
WP_095166841.1\|1275531_1275855_-	ferredoxin family protein	NA	NA	NA	NA
WP_159994051.1\|1275995_1278575_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.6e-28	23.4
WP_159994053.1\|1278767_1279511_+	helix-turn-helix domain-containing protein	B5TK58	Pseudomonas_phage	7.1e-126	89.9
WP_159994055.1\|1279695_1280037_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	4.8e-37	66.4
WP_159994057.1\|1280140_1280641_+	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	2.7e-73	86.7
WP_159994059.1\|1280724_1281774_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.9e-110	59.5

DBSCAN-SWA_2

2581142 : 2655381

uncultured_Caudovirales_phage(69.05%)

integrase,tail,capsid,holin,head,lysis,protease,transposase,terminase,plate,portal

attL 2580803:2580818|attR 2602016:2602031

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2580803:2580818	attL	NA	NA	NA	NA
WP_159993658.1\|2581142_2582318_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_095169634.1\|2583150_2583759_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_095169739.1\|2583745_2584597_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_159995322.1\|2584611_2585796_-	beta-ketothiolase BktB	NA	NA	NA	NA
WP_159995324.1\|2585972_2587016_+	AraC family transcriptional regulator ligand-binding domain-containing protein	NA	NA	NA	NA
WP_159998792.1\|2587106_2588945_+	amidohydrolase family protein	NA	NA	NA	NA
WP_159995326.1\|2589027_2590317_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_095169638.1\|2590342_2590900_+	cupin domain-containing protein	NA	NA	NA	NA
WP_159995328.1\|2590923_2592270_+	glutamine synthetase	NA	NA	NA	NA
WP_159995330.1\|2592944_2593904_+	DUF4365 domain-containing protein	NA	NA	NA	NA
WP_162530201.1\|2594244_2596431_-	NTPase	NA	NA	NA	NA
WP_159995332.1\|2596638_2597706_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	1.9e-116	59.4
WP_159995334.1\|2597708_2597975_-	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	1.9e-25	73.7
WP_159995336.1\|2598134_2598377_-	pyocin activator PrtN family protein	A0A2H4J8B4	uncultured_Caudovirales_phage	4.7e-23	67.5
WP_159995338.1\|2598373_2598748_-	hypothetical protein	A0A2H4J897	uncultured_Caudovirales_phage	1.1e-47	75.8
WP_159995340.1\|2598744_2599020_-	phage antirepressor KilAC domain-containing protein	A0A2H4JBX5	uncultured_Caudovirales_phage	1.0e-21	59.3
WP_159995342.1\|2599030_2599405_-	hypothetical protein	NA	NA	NA	NA
WP_159995344.1\|2599401_2599602_-	hypothetical protein	A0A2H4JG20	uncultured_Caudovirales_phage	2.4e-12	59.1
WP_159998796.1\|2599739_2600417_-	helix-turn-helix domain-containing protein	A0A2H4J8I0	uncultured_Caudovirales_phage	7.0e-40	55.3
WP_159995346.1\|2600519_2600717_+	hypothetical protein	NA	NA	NA	NA
WP_159998798.1\|2600857_2601346_+	hypothetical protein	A0A2H4JFM0	uncultured_Caudovirales_phage	7.8e-49	75.0
WP_159995348.1\|2601338_2601545_+	TraR/DksA C4-type zinc finger protein	A0A2H4JDJ0	uncultured_Caudovirales_phage	3.3e-17	61.8
WP_159995350.1\|2601541_2604244_+	bifunctional DNA primase/polymerase	A0A2H4JF22	uncultured_Caudovirales_phage	0.0e+00	77.8
2602016:2602031	attR	NA	NA	NA	NA
WP_159995352.1\|2605225_2605576_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	1.0e-18	51.5
WP_159995354.1\|2605711_2606275_+	hypothetical protein	A0A2H4JG15	uncultured_Caudovirales_phage	2.5e-35	43.8
WP_159995356.1\|2606279_2608304_+\|terminase	phage terminase large subunit family protein	A0A2H4J898	uncultured_Caudovirales_phage	0.0e+00	84.8
WP_159995358.1\|2608305_2608512_+	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	2.4e-23	77.9
WP_159995360.1\|2608511_2609993_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	5.2e-245	85.8
WP_159995362.1\|2609989_2611141_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A2H4JDI2	uncultured_Caudovirales_phage	2.0e-148	73.5
WP_159995364.1\|2611137_2611482_+\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	5.5e-49	88.6
WP_159995366.1\|2611543_2612539_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	2.7e-173	90.0
WP_159995368.1\|2612541_2612856_+	hypothetical protein	A0A2H4J879	uncultured_Caudovirales_phage	3.1e-30	59.6
WP_159995370.1\|2612852_2613515_+	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	8.3e-78	67.4
WP_159995372.1\|2613507_2614038_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	2.4e-35	48.0
WP_159995374.1\|2614034_2614637_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	1.1e-47	72.1
WP_159995376.1\|2614680_2614929_+	hypothetical protein	NA	NA	NA	NA
WP_159995378.1\|2614931_2615258_+	GPW/gp25 family protein	A0A2H4JA09	uncultured_Caudovirales_phage	3.1e-33	65.7
WP_159995380.1\|2615254_2616235_+\|plate	baseplate J/gp47 family protein	Q37840	Escherichia_phage	1.3e-50	39.4
WP_159995382.1\|2616231_2616954_+\|tail	phage tail protein I	V5YTN0	Pseudomonas_phage	3.2e-14	32.0
WP_159995384.1\|2616950_2617817_+\|tail	phage tail protein	A2I2X8	Vibrio_virus	9.1e-24	45.7
WP_159995386.1\|2617822_2618572_+	hypothetical protein	NA	NA	NA	NA
WP_159995388.1\|2618580_2619045_+	hypothetical protein	B5TK78	Pseudomonas_phage	3.7e-08	39.5
WP_159995390.1\|2619111_2619435_+	hypothetical protein	B0ZSG7	Halomonas_phage	5.0e-12	43.1
WP_159995392.1\|2619499_2620669_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A2H4J869	uncultured_Caudovirales_phage	2.8e-169	77.8
WP_159995394.1\|2620681_2621191_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.4e-61	68.3
WP_159995396.1\|2621237_2621534_+\|tail	phage tail assembly protein	A0A2H4J873	uncultured_Caudovirales_phage	8.7e-19	51.6
WP_159995398.1\|2626215_2627061_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	4.2e-90	57.9
WP_159995400.1\|2627035_2627242_+\|tail	tail protein X	A0A2H4J9Z9	uncultured_Caudovirales_phage	7.4e-17	61.2
WP_159995402.1\|2627302_2628346_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.1e-140	71.3
WP_159995404.1\|2628383_2628932_+	glycoside hydrolase family 19 protein	A0A2H4JHX4	uncultured_Caudovirales_phage	1.6e-66	70.6
WP_159995406.1\|2628928_2629450_+\|lysis	lysis protein	A0A2H4JBH9	uncultured_Caudovirales_phage	1.2e-31	53.8
WP_159995408.1\|2629600_2630395_+	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.6e-99	66.2
WP_159995410.1\|2630518_2630944_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.3e-15	40.3
WP_159995412.1\|2630936_2632214_+	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	1.1e-110	51.0
WP_159995414.1\|2632628_2633810_-	hypothetical protein	NA	NA	NA	NA
WP_159995416.1\|2633879_2634089_-	hypothetical protein	A0A1B0VP78	Pseudomonas_phage	5.2e-10	52.3
WP_174244573.1\|2634509_2634668_-	hypothetical protein	NA	NA	NA	NA
WP_159995418.1\|2634707_2635244_-	N-acetyltransferase	NA	NA	NA	NA
WP_159995420.1\|2635728_2636874_-	putative DNA binding domain-containing protein	NA	NA	NA	NA
WP_159995422.1\|2637409_2637619_-	hypothetical protein	A0A1B0VP78	Pseudomonas_phage	2.1e-11	56.9
WP_159995424.1\|2638636_2640763_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_095169714.1\|2641230_2642109_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159995426.1\|2642241_2643120_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_159995428.1\|2643246_2644815_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_159995430.1\|2644826_2645768_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_095169718.1\|2645764_2646634_+	ABC transporter permease	NA	NA	NA	NA
WP_159995432.1\|2646636_2648268_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.2e-18	30.1
WP_095169720.1\|2648398_2649679_+	OprD family porin	NA	NA	NA	NA
WP_159995434.1\|2649746_2651264_+	serine hydrolase	NA	NA	NA	NA
WP_095169722.1\|2651260_2652586_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_159995436.1\|2652600_2654019_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_159995438.1\|2654132_2654519_+	hypothetical protein	NA	NA	NA	NA
WP_159995440.1\|2654649_2655381_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

4002177 : 4007803

uncultured_Caudovirales_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_095171372.1\|4002177_4002681_+	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	4.3e-10	32.1
WP_095171374.1\|4002677_4003421_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_095171376.1\|4003497_4003836_-	hypothetical protein	NA	NA	NA	NA
WP_095171377.1\|4004004_4004253_+	hypothetical protein	NA	NA	NA	NA
WP_159996912.1\|4004312_4004642_+	DNA repair protein	NA	NA	NA	NA
WP_159996914.1\|4004645_4005350_+	DUF1275 family protein	NA	NA	NA	NA
WP_159996916.1\|4005415_4005808_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	5.9e-55	79.2
WP_159996918.1\|4005811_4006174_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.3e-37	63.3
WP_159996920.1\|4006173_4006473_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.2e-33	69.7
WP_159996922.1\|4006469_4006805_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	2.7e-45	80.2
WP_159996924.1\|4006801_4007803_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	2.8e-162	84.5

DBSCAN-SWA_4

4074292 : 4081833

Leptospira_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159996973.1\|4074292_4074763_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.9e-52	66.7
WP_159996974.1\|4074777_4075473_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.5e-98	77.6
WP_159998872.1\|4075940_4076297_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.3e-16	40.2
WP_159996975.1\|4076315_4077848_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.4e-83	36.6
WP_159996976.1\|4078232_4079558_-	hypothetical protein	NA	NA	NA	NA
WP_159998872.1\|4079925_4080282_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.3e-16	40.2
WP_159996975.1\|4080300_4081833_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.4e-83	36.6

DBSCAN-SWA_5

5629084 : 5676923

Tupanvirus(16.67%)

protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159998298.1\|5629084_5629591_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_159998299.1\|5629876_5630764_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_095164329.1\|5630771_5631317_-	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_095164333.1\|5631495_5632695_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	4.2e-11	27.4
WP_095164335.1\|5632866_5633724_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_095164337.1\|5633875_5634508_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_095164338.1\|5634636_5637654_-	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_095081389.1\|5637650_5637980_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_027617102.1\|5637995_5639246_-	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_095164340.1\|5639270_5640524_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	7.8e-101	53.0
WP_174244600.1\|5640805_5641627_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_095164344.1\|5641653_5642694_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_159998303.1\|5642912_5643737_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_095164347.1\|5643863_5644964_-	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_159998305.1\|5645246_5646542_+	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_159998307.1\|5647350_5648271_-	hypothetical protein	A0A1W5K0N1	Bacteriophage	3.4e-21	45.8
WP_159998309.1\|5648379_5649150_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_159998311.1\|5649165_5650386_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_159998313.1\|5650385_5652335_-	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_095164363.1\|5652498_5654559_-	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_008033249.1\|5654574_5655105_-	hypothetical protein	NA	NA	NA	NA
WP_159998315.1\|5655183_5656161_-	membrane dipeptidase	NA	NA	NA	NA
WP_159998317.1\|5656395_5656794_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_159998319.1\|5656836_5657253_+	DUF3010 family protein	NA	NA	NA	NA
WP_095164371.1\|5657274_5658219_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_095164372.1\|5658413_5659358_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_159998321.1\|5659446_5660334_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_159998323.1\|5660476_5661442_+	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_095164378.1\|5661580_5662057_+	thioesterase family protein	NA	NA	NA	NA
WP_159998325.1\|5662078_5663242_+	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
WP_159998327.1\|5663587_5663851_+	hypothetical protein	NA	NA	NA	NA
WP_095164384.1\|5663949_5665053_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_159998329.1\|5665497_5666874_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_095164388.1\|5667309_5668257_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_095164390.1\|5668322_5669171_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_095164392.1\|5669167_5670346_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-26	37.6
WP_095164394.1\|5670547_5672545_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	4.1e-19	27.9
WP_159998331.1\|5672866_5673460_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_095164398.1\|5673570_5675043_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_159998333.1\|5675219_5676923_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	5.0e-50	30.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP019427

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection