CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP047218	Sphingobium yanoikuyae strain YC-JY1 chromosome, complete genome	1 crisprs	RT,csa3,cas3,DEDDh,WYL,DinG	0	8
NZ_CP047221	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
NZ_CP047219	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed1, complete sequence	0 crisprs	RT	0	0
NZ_CP047222	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed4, complete sequence	0 crisprs	RT	0	0
NZ_CP047223	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	1 crisprs	NA	1	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047218_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047218_1

2105794-2105894

Orphan

Consensus_repeat	Method
CGCGATCCCTCGACCGCTGCCCTTGCCGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047218_1

>merge|NZ_CP047218|1|2105794-2105894|CRISPRCasFinder
CGCGATCCCTCGACCGCTGCCCTTGCCGCAGAACTCAGCGCCATCGCCCATCATCGCGAGGCGGTGCGGGCCGCGATCCCTCGACCGCTGCCCTTGCCGCA

>NZ_CP047218|1|1|2105794-2105894|CRISPRCasFinder
CGCGATCCCTCGACCGCTGCCCTTGCCGCA	GAACTCAGCGCCATCGCCCATCATCGCGAGGCGGTGCGGGC
CGCGATCCCTCGACCGCTGCCCTTGCCGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047218.1\|WP_010339098.1\|2099940_2100684_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP047218.1\|WP_159366356.1\|2107779_2108619_+\|TauD/TfdA-family-dioxygenase	unknown	unknown	gnl\|CDD\|367137
NZ_CP047218.1\|WP_159366353.1\|2103903_2104152_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047218.1\|WP_159366351.1\|2101735_2102869_+\|N-acetylglucosamine-6-phosphate-deacetylase	unknown	unknown	gnl\|CDD\|224733
NZ_CP047218.1\|WP_159366359.1\|2113708_2114695_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|188554
NZ_CP047218.1\|WP_097382962.1\|2104193_2105366_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379194
NZ_CP047218.1\|WP_159366350.1\|2097079_2099740_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NZ_CP047218.1\|WP_159366361.1\|2115294_2117442_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP047218.1\|WP_037521522.1\|2109704_2110673_-\|magnesium-and-cobalt-transport-protein-CorA	unknown	unknown	gnl\|CDD\|213364
NZ_CP047218.1\|WP_159366360.1\|2114691_2115219_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047218.1\|WP_159366358.1\|2110735_2113177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047218.1\|WP_159366348.1\|2092207_2094676_-\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP047218.1\|WP_159366349.1\|2094672_2096949_-\|family-20-glycosylhydrolase	unknown	unknown	gnl\|CDD\|119333
NZ_CP047218.1\|WP_159367969.1\|2100704_2101736_+\|SIS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225132
NZ_CP047218.1\|WP_159366347.1\|2090531_2092211_-\|PTS-transporter-subunit-EIIC	unknown	unknown	gnl\|CDD\|273920
NZ_CP047218.1\|WP_159366354.1\|2106235_2106991_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187639
NZ_CP047218.1\|WP_159366355.1\|2106987_2107761_+\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|235546
NZ_CP047218.1\|WP_159366352.1\|2102994_2103309_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047218.1\|WP_159366357.1\|2108623_2109619_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378890
NZ_CP047218.1\|WP_037521519.1\|2113336_2113714_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224916

Protein	Function_ID	Function_description	E-value
NZ_CP047218.1\|WP_010339098.1\|2099940_2100684_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	5.81481e-79
NZ_CP047218.1\|WP_159366356.1\|2107779_2108619_+\|TauD/TfdA-family-dioxygenase	gnl\|CDD\|367137	pfam02668, TauD, Taurine catabolism dioxygenase TauD, TfdA family. This family consists of taurine catabolism dioxygenases of the TauD, TfdA family. TauD from E. coli is a alpha-ketoglutarate-dependent taurine dioxygenase. This enzyme catalyzes the oxygenolytic release of sulfite from taurine. TfdA from Burkholderia sp. is a 2,4-dichlorophenoxyacetic acid/alpha-ketoglutarate dioxygenase. TfdA from Alcaligenes eutrophus JMP134 is a 2,4-dichlorophenoxyacetate monooxygenase. Also included are gamma-Butyrobetaine hydroxylase enzymes EC:1.14.11.1.	3.95083e-54
NZ_CP047218.1\|WP_159366351.1\|2101735_2102869_+\|N-acetylglucosamine-6-phosphate-deacetylase	gnl\|CDD\|224733	COG1820, NagA, N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].	2.14642e-145
NZ_CP047218.1\|WP_159366359.1\|2113708_2114695_-\|c-type-cytochrome	gnl\|CDD\|188554	TIGR04039, MXAN_0977_Heme2, di-heme enzyme, MXAN_0977 family. This model describes a subfamily of di-heme proteins related to the di-heme cytochrome c peroxidase and to MauG (methylamine utilization G), an enzyme that performs a tryptophan tryptophylquinone modification to the methylamine dehydrogenase light chain.	3.90404e-102
NZ_CP047218.1\|WP_097382962.1\|2104193_2105366_-\|hypothetical-protein	gnl\|CDD\|379194	pfam13452, MaoC_dehydrat_N, N-terminal half of MaoC dehydratase. It is clear from the structures of bacterial members of MaoC dehydratase, pfam01575, that the full-length functional dehydratase enzyme is made up of two structures that dimerize to form a whole. Divergence of the N- and C- monomers in higher eukaryotes has led to two distinct domains, this one and MaoC_dehydratas. However, in order to function as an enzyme both are required together.	3.14335e-21
NZ_CP047218.1\|WP_159366350.1\|2097079_2099740_-\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	0
NZ_CP047218.1\|WP_159366361.1\|2115294_2117442_+\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	1.31394e-47
NZ_CP047218.1\|WP_159366348.1\|2092207_2094676_-\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP047218.1\|WP_159366349.1\|2094672_2096949_-\|family-20-glycosylhydrolase	gnl\|CDD\|119333	cd06563, GH20_chitobiase-like, The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.	0
NZ_CP047218.1\|WP_159367969.1\|2100704_2101736_+\|SIS-domain-containing-protein	gnl\|CDD\|225132	COG2222, AgaS, Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane].	2.40315e-104
NZ_CP047218.1\|WP_159366347.1\|2090531_2092211_-\|PTS-transporter-subunit-EIIC	gnl\|CDD\|273920	TIGR01998, N-acetylglucosamine_and_glucose_PTS, PTS system, N-acetylglucosamine-specific IIBC component. This model represents the combined B and C domains of the PTS transport system enzyme II specific for N-acetylglucosamine transport. Many of the genes in this family also include an A domain as part of the same polypeptide and thus should be given the name "PTS system, N-acetylglucosamine-specific IIABC component". This family is most closely related to the glucose-specific PTS enzymes. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	0
NZ_CP047218.1\|WP_159366354.1\|2106235_2106991_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187639	cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR. CAD catalyzes the NADP-dependent reduction of clavulanate-9-aldehyde to clavulanic acid, a beta-lactamase inhibitor. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.53324e-73
NZ_CP047218.1\|WP_159366355.1\|2106987_2107761_+\|glucose-1-dehydrogenase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	5.74235e-78
NZ_CP047218.1\|WP_037521522.1\|2109704_2110673_-\|magnesium-and-cobalt-transport-protein-CorA	gnl\|CDD\|213364	cd12830, MtCorA-like, Mycobacterium tuberculosis CorA-like subfamily. This bacterial subfamily belongs to the Thermotoga maritima CorA (TmCorA)-like family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subfamily includes the Mg2+ transporter Mycobacterium tuberculosis CorA (which also transports Co2+). Thermotoga maritima CorA forms funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport by a related protein, Saccharomyces cerevisiae Alr1p. Natural variants in this signature sequence may be associated with the transport of different divalent cations. The functional diversity of the MIT superfamily may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.5304e-144
NZ_CP047218.1\|WP_159366357.1\|2108623_2109619_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	4.17617e-26
NZ_CP047218.1\|WP_037521519.1\|2113336_2113714_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|224916	COG2005, ModE, N-terminal domain of molybdenum-binding protein [General function prediction only].	2.47755e-21

>NZ_CP047218.1|WP_097382962.1|2104193_2105366_-|hypothetical-protein
MTSPTLDCSDIDNYLGKPIQPARMVEPINNGDIRRWVQAMHYPNRLHYDAGYAAQSRWGGMVAPQSFAVTMDCAHGSAPSCIGRVPNSHMLFGGDEWWFYGPRMVAGDRILNERIPFDYTVKDTKFAGPTCFQRGDNFYYNQQGDLIAKQRSTSIRYSQEAGKDNVPTEGFDDPVWTDDQLEELEARKMQWIQMLHDLGHDRRWWDDVTVGAALPERVVGPHSIVSFATEWRSYIFTQWGGTHRRTDLDMEALGFVKEMAGHENDPVMEAINPEFTDGAYVGPSRGHLFPRWARFIGMPRGYGYGASMGAWITDYFAGWAGEWGMIRHSACNYRSPALTGDITITTGTILDKFVDEDGRHMVQVDCRMANQAGAVLATAKAEIELPKRPA
>NZ_CP047218.1|WP_159366353.1|2103903_2104152_-|hypothetical-protein
MDLDDQFRHYFGTDDLASVTPEGMAAGIERMQVAFGLETDRPRRFALWTLLYMLGAAPDLDVAFEEEADRNAARDVMDMLDE
>NZ_CP047218.1|WP_159366352.1|2102994_2103309_+|hypothetical-protein
MKTVLIAASLLLTAATPHIAMAQAPAAAPAPAYSVETTDIGTLLDNPATKAVLDKNLPGFTANPQIDMARSMTLKGVQQYAADTLTDAALAKVQADLNKIPAKK
>NZ_CP047218.1|WP_159366351.1|2101735_2102869_+|N-acetylglucosamine-6-phosphate-deacetylase
MRHALVNGSILIDGHFHAGKALVIEGNRIAAILPDADVPADVPQRDLGGDRLVPGFIDTQVNGGGGVLFNDAPTVEGIAAIGAAHRRFGTTGFLPTLISDDLAVIRQAVAAVDAAIEAGVPGVLGIHIEGPYLNIERKGIHDGDKIRPLDAEGLEVLSSLKRGRTLVTLAPERTSPDMVRQLVERGVIVAAGHSNGCYEDMIGAVEAGLSGVTHLYNAMSPLGSRKPGIVGAALEQDSVTCGIIVDGHHVSATALKIALRCKPCDKLMLVTDAMPSVGSDADEFMLQGRHILVRYGACTDDAGTLAGSNLDMITAVHNSVAMLDVPIERAIAMASAAPAAFLGLAAETGRIAPGLRADLLQLNAQGAVVRSWIGGSY
>NZ_CP047218.1|WP_159367969.1|2100704_2101736_+|SIS-domain-containing-protein
MLNPQDTLMFAEAAEAGAVIARQFAANAETVKALAASLRANPPRGIVTCARGSSDHAATFAKYLFETRLGLLTTSAAPSIASVYGTAPALADMLAIAISQSGKSPDILATVDAAKSAGARTVAMVNVADSPLAGQVDTLLPLHAGPERSVAATKSYIASIASLLNLAAHWSGDAELLAALETAPALLAQAWACDWTPLVEQLATARGLYVIGRGIGFGIAQEAALKFKETSGLHAEAFSAAEVKHGPMALVGPDFPLLVFRQADETAESVDELVREVVARGGQVLIAGEPVDGAIHLPVPAAHPAIEPMLQVQAFYRAVNALSVRRGFNPDQPPHLAKVTETL
>NZ_CP047218.1|WP_010339098.1|2099940_2100684_+|GntR-family-transcriptional-regulator
MPLLAEQIGPLDALGGGPLYRRLEDALREALRTQRLKPNEALPPERDLASELSVSRITLRKALDSLVEEGLLVRKQGAGTFVANRVEKQFAKLSSFSEDMAARGRTVRSEWLGRSVGAVTPDDALTLGLSPGAAVYRFNRIRYADDVAMALEYSTIPGFGLDGVDVVGASLYAALEAAGNRPVRALQRLRAVLFNAEQAKLLGIEAGAPGLYIERRGFLDDGRVIEATQSWYRGDAYDFVAELDMRA
>NZ_CP047218.1|WP_159366350.1|2097079_2099740_-|TonB-dependent-receptor
MGIRTFLVGTASAIALFSGAAHAQGSDASAPDADANASDIVVTGYRASLAKAIDVKRNADAIVDSISAEDVGKFPNTNVAEALTLVPGVTVDRQFGQGEKVSILGTDPALNRTLLDGQTVASADWFILDSPGRTFNYALLAPQLVGRVDVYKSPEPRIDEGSIGGTVNVVTRKPLDLKPFTMAGQLGYLYNDRSKKGDIQGSALVSWHNEEGTFGILASFQRAKDRLRRDGVETYGTMKADQWAGGNADNPVDSRDNGCVGECATTLSNNLDAISPNAFGTSYFEQGRERLTYSATAQWKPVDELTLEASWLKIDATYNNLNQSMYAFQGNTWNSLGALTGIEVNNGIVTSASFKNALSVLDVQYREAEMKSDTYRGKARWDGGTWDLTVEGGLSDADGGTKRQVFLEFLNWADYTVNIGGAPKSPGSLSYATDVQGNPNAFVTDPGWSGNTVTKPTSDKERYGQADLGFDFDGALKRIQIGYKYRHHETGQQYAGIALNGLGVAAAQFDPKTVAGNYLRGFSGVNDQMTDRFIISGPSMVDYLEGQTLPTPSIFAAAEFTAGNWNIQEDINAVYAQANFDTGTLRGNFGVRYVNTKTDSAGYVCNAGAPCNSAADWAWQTTKRSYDNWLPSANIAWTAQQDLILRFSAAKVMSRPNYADMTNYFWLSDTVLTGGGGNPNLKPYTSGNLNASIEWYFKQGSILSAEVFYKDISNYILQKTAPESYFNQSQGRVTTYQISRPYNAGSAEVKGFAVAYQQNLPYGFGILANYTYSDGSGEGGQALPYNSKHQASVSPFFESGPVALRATYTWRSKYFTGIDRGDNMFVRDSDNLDVSATYNVTPQIGITLSGMNLTDAEYYAYANTTALPRGVYRSGRKFLVTVNFNY
>NZ_CP047218.1|WP_159366349.1|2094672_2096949_-|family-20-glycosylhydrolase
MIRARRLTLLASLMLSGIATAPAMAELPRLLPVPAQMREGQGAFLISSTTPIRVPVGDAAARNAAERFADLVARSRGFRPRIETGADANNAIVFRRAKTGAAESYTLDVTGKGATIAAGDDAGLLYGAVTLWQAMTQDQAAGPVSVAAMQIADAPRFQWRGLMLDSARHFQSPAYVRQLIDWMAVNKLNRLHWHLVDDQGWRIEIPKYPRLTEVSAWRVPAGAPGAPPLPKVGGFYTQAEIREIVAYAAARGVMIVPEIEMPGHALAAIRAYPKLGMGVPIPPGTESDWGVFPWLYNADDATFAFLEDVLTDVMALFPSPYIHIGGDEAVKDQWKSSPAMQAKMKALGIGSEDAMQGWFMHRIDDFLTKHGRKPIGWDEILEGGASPHATITSWRGIEGAVTAAKSGHDAILSPAPILYFDNRQGFGPLEPPGRGHLSDLHSVYDFNPEPEGLSAAEQQHILGLQGNLFTEHVRTEERAQWQQFPRGSAVAEIGWSPVTSHDFASFMDRLVPQMARMGTLGLKPAISALTVTAKTDYAPGDKNTRVTLESQSGFPIHYTLDGSVVTPRAPVYKDGLSLPVGTRLRAGTVWRGGMMPGAIDIGLDASFLRRRTDEQLASYANKVVLSLEDDAPAQGERAHFLTDILQPCWLYAEAPVGGASRIAIDVGQLPFNFQIGKDRDAIRFRAPATPAGEMEVRAGSCEGERIAVLPLAPAVGNPEVTRLIAPIARRSGKENLCITYTAKDVEPLWAIKQVELIP
>NZ_CP047218.1|WP_159366348.1|2092207_2094676_-|phosphoenolpyruvate--protein-phosphotransferase
MSGMMASVTLRAPLTGWLAPIESVPDPVFAERMMGEGFAIDPIEGEVRAPVDATVLTVAPTGHSVSLRLANGAELLIHVGLETVTLGGRGFTPQVKPGDAVAAGDLLIDFDLDAVAEGAKALITPVVLAGEGYALSLEPLDRLVGWQDGVARITALAPVAAKGDSEGDSHEQVVRVDAPHGIHARPAARIAALLRTFVAPVSIMRDGKSVNARSTVALLGLGVRCGDEIIIRGEGSDARAAVEALVALIEAGLGEEAKADHPAPAPVVPQHGPVTAAPGLAIGQVVQLRVADVDVPRDGQGGAAEHAALARAMAAVDAELSAGHGLAAEIAAAHRALLADPELAEAAGHQIDAGRSAAFAWRHATAQAAEAIRATGDPLLMERVADLIDIERQLIAALLGSEASAVPRLPPQSILIAEDLLPSQFLALDRDRLAGICTAAGGPTSHVAILAASAGIPMLVAAGRDVLAIADGRTVILDADGARIDADPGVNTLSEVSERIAAAREQRSRDRSQAHADCRMADGTRIEIFANLGSQADAAAAVAAGAEGCGLLRTEFLFLEREEAPDEAEQREIYSGIATTLGDRPLIVRTLDIGGDKPVPYLPMAAEDNPALGLRGVRLSLARPDLMQVQLRAILRAVPADQCRIMLPMIVDLSDYRAVKAMLDAEKAALGIDLPVPLGVMIETPAAAMLADMLAAEADFLSVGTNDLTQYTLAVDRGNAAVSHRIDALHPAVLRLIREVGRGAQRHGRWAGVCGGLASDPLAAPILIGLGITELSATPAAIARLKAVVRTLDMDRCIDLAERACAAGSAAAVREMAQGVLA
>NZ_CP047218.1|WP_159366347.1|2090531_2092211_-|PTS-transporter-subunit-EIIC
MSFRPATLLARLQPLGRALMLPIAVLPIAALLLRLGQPDMLAIPFIAAAGDAIFSNLGLLFAAGVAVGLARENHGAASLAGVIAYLVTTEGAKVLLVLPPDVAEVAQAAWRAKEIAKVSVPAGILSGIVAGLLYNRFSDIKLPDYLAFFAGRRFVPIVAGLAGLFGALMFGLGFPWIEAGIDRLSQWVVAAGPLGLFVYGLLNRLLLITGLHHIINNVAWFLLGDFHGATGDIKRFFAGDPTAGGFMSGFFPVMMFGLPAACLAMYRTALPDRRKRVGGLLLSLALTSFLTGVTEPIEFSFIFLAPILYVVHAVLTGLSMVVMDALGVKLGFGFSAGLFDYLMNYGLATRPLMLIPVGLVYFAVYYATFSWCIRRFNLKTPGREDEPAAAAGDVPSMAGARGPAMVAALGGKANVRSVDACTTRLRLVLGDSTIADEARLRALGARGIVRLRDGGFQVVLGPIADQVAAEIRSALAGHDPAPIAGTSDLVALLKGAGVRAVELRGTRLLVRVDRPAAVDAAALRGAGVKAWVLPASADGWLHLILGDQAEPLADALRAA
>NZ_CP047218.1|WP_159366354.1|2106235_2106991_+|SDR-family-NAD(P)-dependent-oxidoreductase
MAALENKVALITGASSGIGEAAALALALEGVNIAVNGRRRDRLDALVARIEAAGGTAIALPGDVSIEADAAAAVADTVARFGRLDILVNSAGVNEAGGIESLTSAQWQRVIDINLMGTIHACRAVFPVMKAQGSGDIVNISSTAGRRSGWRFAAYSTSKFGLTGFTESLRQEGGQAGIRVSIIEPGATATEIASSISDPQWRDMIQQHTHKDGAMAPDDIVAGILLAVSLPRRANVSRILIQPTVDTEPMP
>NZ_CP047218.1|WP_159366355.1|2106987_2107761_+|glucose-1-dehydrogenase
MRLAGKSAVITGAGSGMGKAMAQRFAQEGARVLCADISGAQDEVAAAIGNGAIGLHVDVAEETDVQAMIATARDAFGRVDILVNNAGFGGGIMPLHEQSSDNWDRVHAVNLKGVFLGMKYGVIAMLESGGGAIVNIGSATGMVGWKGHGVYAAAKGGVSQMTKCAALDYAAHNIRVNAVLPGSIWTGLVPMAKDHPEPPLGIFRVPGIPMDRWGLASEIANAALFLASDEASYITGTLLPVDGGYCIGFSGMAAEQG
>NZ_CP047218.1|WP_159366356.1|2107779_2108619_+|TauD/TfdA-family-dioxygenase
MNVIHKSRVTFRPVKPLIGAVVEADREALFDPEVVAQCRDMLEERTVLVMPQVHFTNEEQLAFTDLLGGRLNLTSEATTNKDEDVYQVTLDRKINRAPEYVLGTFFWHMDGMPMEMPPPLATLLSARRLAPKGGQTEFANTFAAYEQMPEAQRAEIEDLRIIHSVAASLRSIADAIPEAEKGKLAIGVEKERPLVQLHKNGRKSLIVGSTADRIVGMELAYGRAYIARLNEWATQPDFVYQHQWQAGDFVIWSNTGALHRVVPYARDSGRMMHRTSIAG
>NZ_CP047218.1|WP_159366357.1|2108623_2109619_-|helix-turn-helix-domain-containing-protein
MDEQRDAFEAINAHMLRFLPELVAELGGEAPDSGDASPSYRQTIALIEDAAHRLACPDFGMRLALRQRGVDLFGPLGDAMRNAPTFGAAIDYVCSHNYAHSLAASVWLRRFPSVRHVFVGHDILLDGVPNRAQAMEHILLVGHLFAMELTGGRARARRVHFRHQPISPARIYRRYFGCPVHFGQNEDGISFSERDMASPVIDRDAAVFAAVTAHIEREFPHRHPPLHAQVRGIVMQWLWTAHCSNDRVAAELGLHPRTLHRRLATEGTSFQKIKDEVRRDILRYYLEQTDIDFAHVSEKLGFSEQSVMTRSCNHWFGASPTRLRARLHAPA
>NZ_CP047218.1|WP_037521522.1|2109704_2110673_-|magnesium-and-cobalt-transport-protein-CorA
MTVIAAYLYRNGQRVREVSINERIDCAEDKSEFVWIGVASPTAEEMRTLQQNYNLHPLAVEDAIKADQLPKVDIYGEQLFVVARTAHVEEKTIAYGETAIFVGHSHIISVRHGSARGHIELRHALEAVPDRLAHGVDYVLHAILDFIVDGYLPIVEGIEEEVLTMEQHTVDNFLGRDEITRIFNLRRQLIRFQRILGPMQEVATKFVKIDLPCIDPETRPYFSDVRDHVRRVQTMVDDLREVLNSVFEFSNLLEQQRTGTITRQLAAWAAILAVPTAIAGIYGMNFEHMPELKTRYGYFVVLAVILLICSILYRRFRKLNWL
>NZ_CP047218.1|WP_159366358.1|2110735_2113177_-|hypothetical-protein
MPQPSAPIQIARLRQPIGLLIGTALGAALLTPGLAAEPAPFELTGPDLKVSVTRGTTSLPISQVPSLRAGDKLLIEPNLPKEQGANFVLMSAFLRGATNPPPKDWIDSAETWKKKDKDRRLALTVPDGARQMVLFLVPETGGGEGTVSDAVRGKPGEFVRATQELNQASLDRSRLDAFMTAIRTQENSHPEFLRSVAPALARSLSMKLNEDCLSKVIELQAACLLENKDQLVLADVHSSSIAETLSGTPTDLALQLASTREAGYGYYSPYIGVVRDLARMFGAFSSPSFEYLPTVSLRRDDNIGLMLNKAPSFAKPKSVMVVGMPSIEADSPPRLRSGAQAPICAALPGTVLPVEGAPLIYSTSYARGMTVQLKAASGQTIEYPLEARADRGGYVIRADGPWPADFRGSIEAHVYGQWGFDRFEGPDYILQRPDDAAWQVKGEAPTLVVGRDNGLTLTGGAPSCVESVTLRQGNAAPQAIGWKVQGRDALNLTLSLADRRAGPVTVDVKYQGVAKPFSVALRAYAPASKLDGLTVHQGDAWGEMTGQRLDQVASVDLGGRSWKPDGLTRDGSVDRLRLTAAGDGTVPAEGASARVQLEDGRIVSVPVTIAPARPRVTLLNKSVTPAAATGLPVTLGGSDVLPNNGRLVFSVQAQDGTKLAMTDAIEVATQDGGASVRLTAGSGLQLQGPQVMVATLDPAALGPAFGPLQFRIVRGREQGDWQPLMPLARLPRIEAVDCAGKEQKDQGCTIKGRDLFLVDAVAGNPAFDQPAPVAQGFTGSTLTVPAPTDGKLYVRLRDAQGAMLVVQAPSPAA
>NZ_CP047218.1|WP_037521519.1|2113336_2113714_+|LysR-family-transcriptional-regulator
MQTGTLKLKIQILCGDEIAMGPGKADLLDAIALHGSISAAGRALGMSYRRSWLLVDTMNRCWNDRLVETVAGGGRDRGARVTEAGRAVLAAYRALEGAALTATEGQAQGQLDALLRPIPLPAPLS
>NZ_CP047218.1|WP_159366359.1|2113708_2114695_-|c-type-cytochrome
MKPARWPLLLATLLLIGAGRPWHWDLPLGEPPPPVPVGNAMSAAKVELGRRLFYDADLSANGTLSCAGCHEQHRGFADGNRTRPGVHGDPGLRNVPGLANVAWSPRLTMADPAITSLEAQVAVPLLGEHPVEMGMKGLETELPRRLGADACYRRMFARAFPDRRGRIDLATVSAALAAFERTLISRDSPYDRDRRGQADALSMSARKGERLFADKGCASCHAGRDFSDGAYHRLEPATATDPGLAEKTGLTSDAGRFRTPPLRNVAVTGPWWHDGSAQTLDAAILRHGQKLTDAERIAITAFLDSLTDRTFLTDPRFAMPAEACGKKL
>NZ_CP047218.1|WP_159366360.1|2114691_2115219_-|hypothetical-protein
MRQPLFLLFPALCAALVPASAFAQMSGMPACTAPADPPADMTSWRAPQPMKAAADAKGAGKVKLKAGQAVALTLLPTPKISYPLRPAKPGGSVSFGGIVHFTVDQPGTWRVALSSGAWVDVVKDGTAATSTAHGHGPDCTGIRKMVDYSLEPGDYILQLAANGDPQMTVLVTRLP
>NZ_CP047218.1|WP_159366361.1|2115294_2117442_+|TonB-dependent-receptor
MRQTMMRILLASACCWTATAQAQGAPDAAGDSDRFSLGQIIVTAPRTSGIEIDGSTLSSDAIYSFNRTSLDDAVNLMTGVSAGNSGGTRNERLVFVRGFDRFQVPLSIDGIRVYLPADNRLDYGRFLTTDIAEVQVAKGYASVLDGPGAMGGAINLVTSKPTKALDIDLRGQVSFDNDMDYAGYTTSAKIGTRHDLWYAQARYARSFTDHWDLPNDFTPRVPTLEDGGARDFSRAEDWRVNAKVGFTPNATDEYALSYTHQEGSKSAPLHISDTVTTARFWDWPSWDITSVYFLSTTALGDRATLKTRAYYNQFDSMLRSFNDRTQTTQSRPYAFDSPYEDKAWGGSAQLDFTATDADTLRLAFHYRHDEHVEFQTSFSTAGVATTEPKQTQSEATYSVALENELALSPTLRFTLGGSYDWRNLERAEEYGAPLGTSGTPSVIYNYPRRDADTWNAQGRLDWQASDALSLHASLSSRARFPTIFERFSQRFNTAIPNPDLKAERATNAEIGGNWSQGSFRLEGALFYSWVRDAIFSVPTPAYPCTASTTPPAVPTTGCALTNLSQSRNVGKGEYYGIELSASATLLPGLDAGINYTGIKRDLTDPSNARFRPTGVPTHKGFAYIDWAPVERLHIVPSVDLASNRWTLFTATPASQPARYYRTGAYVNASLRVDLALTDQIDLGIGGRNLFDDYYTLTDGFPEPGRTVYASARFRY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1938987 : 1947910

Burkholderia_virus(16.67%)

tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159366267.1\|1938987_1940292_-	MFS transporter	Q6JIH2	Burkholderia_virus	9.4e-49	31.0
WP_159366268.1\|1940288_1940948_-\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_159366269.1\|1940947_1941736_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_159366270.1\|1941732_1942521_-	YchF/TatD family DNA exonuclease	NA	NA	NA	NA
WP_159366271.1\|1942524_1944093_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.1e-91	36.8
WP_159366272.1\|1944136_1945108_-	AAA family ATPase	A0A1U9WR94	Streptococcus_virus	2.3e-07	29.9
WP_159366273.1\|1945104_1945731_-	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.3e-16	33.0
WP_159366274.1\|1945727_1946891_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-45	33.5
WP_159366275.1\|1946938_1947910_-	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	4.7e-13	46.4

DBSCAN-SWA_2

2749174 : 2760016

Pseudomonas_phage(33.33%)

tail,head,capsid,protease,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159366685.1\|2749174_2749729_-\|tail	tail tape measure protein	D6PEW0	uncultured_phage	1.5e-08	33.3
WP_159366686.1\|2749753_2749951_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_159366687.1\|2749947_2750262_-	gene transfer agent family protein	NA	NA	NA	NA
WP_004207802.1\|2750258_2750666_-\|tail	TP901-1 family phage major tail protein	NA	NA	NA	NA
WP_159366688.1\|2750722_2751049_+	hypothetical protein	NA	NA	NA	NA
WP_159366689.1\|2751049_2751460_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_159366690.1\|2751456_2751663_-	hypothetical protein	NA	NA	NA	NA
WP_159366691.1\|2751659_2752193_-	hypothetical protein	NA	NA	NA	NA
WP_159366692.1\|2752192_2752471_-	hypothetical protein	NA	NA	NA	NA
WP_159366693.1\|2752624_2754466_-	hypothetical protein	A0A1S5R3Z4	Pseudomonas_phage	1.2e-30	49.7
WP_159366694.1\|2754590_2755709_-\|capsid	phage major capsid protein	A0A2D1GNH4	Pseudomonas_phage	1.4e-77	43.3
WP_159366695.1\|2755906_2756380_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_159366696.1\|2756397_2757066_+	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_155276543.1\|2757104_2757644_-	hypothetical protein	NA	NA	NA	NA
WP_159366697.1\|2757658_2758105_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	6.5e-18	46.0
WP_097384108.1\|2758101_2758422_-	hypothetical protein	K4I011	Acidithiobacillus_phage	2.0e-08	46.1
WP_159366698.1\|2758885_2760016_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	5.3e-48	38.1

DBSCAN-SWA_3

2955686 : 2961310

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_037510479.1\|2955686_2956679_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	6.9e-52	41.6
WP_099234171.1\|2956877_2957855_+	cell wall hydrolase	A0A0S1WEP8	Vibrio_phage	6.0e-08	31.0
WP_004207973.1\|2958226_2958355_+	entericidin A/B family lipoprotein	NA	NA	NA	NA
WP_037510477.1\|2958390_2959182_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.0e-46	42.9
WP_159366813.1\|2959178_2959643_-	translocase	NA	NA	NA	NA
WP_004207976.1\|2959669_2959909_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.0e-06	75.0
WP_159366814.1\|2959937_2960531_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.5e-38	43.4
WP_125998105.1\|2960527_2961310_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.8e-32	31.5

DBSCAN-SWA_4

3112212 : 3147348

Paracoccus_phage(30.0%)

tail,tRNA,head,capsid,protease,integrase,terminase,portal

attL 3105778:3105794|attR 3128852:3128868

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3105778:3105794	attL	NA	NA	NA	NA
WP_159368030.1\|3112212_3113727_+\|tRNA	cysteine--tRNA ligase	A0A0G2Y4Q1	Acanthamoeba_polyphaga_mimivirus	7.3e-29	29.5
WP_159366891.1\|3113790_3116679_+	CHAT domain-containing protein	NA	NA	NA	NA
WP_069335746.1\|3116659_3117673_-	2-hydroxyacid dehydrogenase	M1HBE3	Paramecium_bursaria_Chlorella_virus	1.9e-57	40.2
WP_017502598.1\|3117826_3118192_+	hypothetical protein	NA	NA	NA	NA
WP_004208138.1\|3118319_3119690_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_159366892.1\|3119755_3121084_-	cytochrome P450	NA	NA	NA	NA
WP_159366893.1\|3121223_3123077_+	acyltransferase family protein	W6MVL2	Pseudomonas_phage	9.8e-68	41.8
WP_080726982.1\|3123078_3123969_-	N-formylglutamate amidohydrolase	NA	NA	NA	NA
WP_004208143.1\|3124110_3124488_+	response regulator	NA	NA	NA	NA
WP_004208144.1\|3124480_3125827_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_159366894.1\|3126084_3127404_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_159366895.1\|3127658_3128099_-	hypothetical protein	NA	NA	NA	NA
WP_159366896.1\|3128095_3128308_-	hypothetical protein	NA	NA	NA	NA
WP_159366897.1\|3128304_3128574_-	hypothetical protein	NA	NA	NA	NA
WP_159366898.1\|3128681_3129866_-	ParB N-terminal domain-containing protein	H9A0Q8	Staphylococcus_phage	4.4e-13	30.2
3128852:3128868	attR	NA	NA	NA	NA
WP_159366899.1\|3129901_3130204_-	hypothetical protein	NA	NA	NA	NA
WP_159366900.1\|3130200_3130626_-	hypothetical protein	NA	NA	NA	NA
WP_159366901.1\|3130640_3130973_-	hypothetical protein	NA	NA	NA	NA
WP_159366902.1\|3130969_3131191_-	hypothetical protein	NA	NA	NA	NA
WP_159366903.1\|3131187_3131523_-	hypothetical protein	NA	NA	NA	NA
WP_159366904.1\|3131525_3132212_-	hypothetical protein	NA	NA	NA	NA
WP_159366905.1\|3132213_3132729_-	hypothetical protein	NA	NA	NA	NA
WP_159366906.1\|3132888_3133626_-	hypothetical protein	NA	NA	NA	NA
WP_159366907.1\|3133746_3133905_+	hypothetical protein	NA	NA	NA	NA
WP_159368031.1\|3133910_3134759_+	hypothetical protein	NA	NA	NA	NA
WP_159366908.1\|3134755_3136291_+	AAA family ATPase	NA	NA	NA	NA
WP_159366909.1\|3136512_3136911_+	hypothetical protein	NA	NA	NA	NA
WP_159366910.1\|3136907_3137237_+	hypothetical protein	NA	NA	NA	NA
WP_159366911.1\|3137233_3137404_+	hypothetical protein	NA	NA	NA	NA
WP_159366912.1\|3137400_3137961_+	hypothetical protein	NA	NA	NA	NA
WP_159366913.1\|3138482_3138659_-	hypothetical protein	NA	NA	NA	NA
WP_159366914.1\|3138655_3139249_-	hypothetical protein	NA	NA	NA	NA
WP_159368032.1\|3139280_3139670_+	HNH endonuclease	C7BGG5	Burkholderia_phage	9.7e-10	44.0
WP_159366915.1\|3140191_3140455_+	hypothetical protein	NA	NA	NA	NA
WP_159366916.1\|3140546_3140948_+	hypothetical protein	NA	NA	NA	NA
WP_159366917.1\|3140904_3142779_+\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	5.7e-156	48.4
WP_159366918.1\|3142775_3144053_+\|portal	phage portal protein	A0A0U2BXP2	Paracoccus_phage	3.6e-85	43.4
WP_159366919.1\|3144039_3144708_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.6e-44	47.7
WP_159368033.1\|3144814_3146047_+\|capsid	phage major capsid protein	I7HDH9	Xanthomonas_virus	2.1e-90	55.8
WP_159366920.1\|3146096_3146396_+	hypothetical protein	NA	NA	NA	NA
WP_159366921.1\|3146395_3146995_+	hypothetical protein	I3UM02	Rhodobacter_phage	6.5e-13	30.9
WP_159366922.1\|3146994_3147348_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA

DBSCAN-SWA_5

4161528 : 4201045

Escherichia_phage(33.33%)

transposase,integrase

attL 4164103:4164117|attR 4204078:4204092

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159367933.1\|4161528_4162667_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.2e-19	28.3
WP_125990181.1\|4162807_4163452_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_159367443.1\|4163448_4164534_-	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
4164103:4164117	attL	NA	NA	NA	NA
WP_159367444.1\|4164616_4165072_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_159367445.1\|4165068_4165683_-	glutathione S-transferase	NA	NA	NA	NA
WP_159367446.1\|4165720_4166497_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_159367447.1\|4166653_4167562_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_159367448.1\|4167662_4168055_+	preprotein translocase subunit TatC	NA	NA	NA	NA
WP_159367449.1\|4168085_4168874_-	DUF4019 domain-containing protein	NA	NA	NA	NA
WP_010336197.1\|4168942_4169380_-	c-type cytochrome	NA	NA	NA	NA
WP_159367450.1\|4169429_4171058_-	AMP-binding protein	Q75ZG1	Hepacivirus	2.0e-19	26.2
WP_159367451.1\|4171212_4172712_+	CoA-acylating methylmalonate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_159367452.1\|4172841_4174176_+	4-hydroxybutyrate--acetyl-CoA CoA transferase	NA	NA	NA	NA
WP_159367453.1\|4174176_4174947_-	thioesterase family protein	NA	NA	NA	NA
WP_159367454.1\|4175145_4176231_+	endonuclease	NA	NA	NA	NA
WP_159367455.1\|4176227_4176806_+	hypothetical protein	NA	NA	NA	NA
WP_013054031.1\|4176777_4177542_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_159367456.1\|4177711_4178014_-	hypothetical protein	NA	NA	NA	NA
WP_159367457.1\|4178054_4178669_-	hypothetical protein	NA	NA	NA	NA
WP_159367458.1\|4178680_4179367_-	hypothetical protein	NA	NA	NA	NA
WP_159368082.1\|4179471_4180035_+	recombinase family protein	M9Q1K0	Clostridium_phage	6.7e-12	28.2
WP_159367459.1\|4180061_4180802_+	hypothetical protein	NA	NA	NA	NA
WP_159367460.1\|4181445_4182003_-	recombinase family protein	A0A0C4UR34	Shigella_phage	2.1e-45	55.1
WP_001389365.1\|4182182_4182947_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_013054031.1\|4183596_4184361_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_159367461.1\|4184177_4187003_-	glycosyltransferase	NA	NA	NA	NA
WP_159367462.1\|4187543_4188617_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_159367463.1\|4188707_4192613_-	glycosyltransferase	NA	NA	NA	NA
WP_159367464.1\|4192655_4193606_-	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
WP_159368083.1\|4193648_4194398_-	hypothetical protein	A0A0P0YLT6	Yellowstone_lake_mimivirus	6.6e-15	38.5
WP_159367465.1\|4194430_4196077_-	glycosyltransferase	NA	NA	NA	NA
WP_159367466.1\|4196470_4197994_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_159368084.1\|4197983_4198790_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.2e-32	34.9
WP_008831331.1\|4199684_4200080_+	hypothetical protein	NA	NA	NA	NA
WP_008831330.1\|4200076_4201045_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
4204078:4204092	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4531027 : 4547571

Stenotrophomonas_phage(20.0%)

transposase,integrase

attL 4530238:4530252|attR 4546574:4546588

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4530238:4530252	attL	NA	NA	NA	NA
WP_159368096.1\|4531027_4532254_+\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	8.7e-89	43.1
WP_159367625.1\|4532348_4533242_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159367626.1\|4533360_4534308_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_159367627.1\|4534373_4535306_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_159368097.1\|4535392_4535752_-	thermonuclease family protein	NA	NA	NA	NA
WP_159367628.1\|4536033_4536624_-	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	1.0e-26	55.9
WP_159367629.1\|4536762_4537671_+	virulence protein	A0A2I6UGE7	Salinibacter_virus	1.5e-05	44.8
WP_013039223.1\|4539235_4540606_-\|transposase	IS1380-like element ISSp1 family transposase	NA	NA	NA	NA
WP_009823939.1\|4541659_4542664_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_009823940.1\|4542660_4544016_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_007015824.1\|4544012_4545245_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJ76	Virus_Rctr85	2.1e-05	27.3
WP_001389365.1\|4546806_4547571_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
4546574:4546588	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4719370 : 4749966

Escherichia_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015449415.1\|4719370_4720135_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	3.6e-85	65.2
WP_159368110.1\|4720163_4720313_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_063976428.1\|4720415_4720742_-	pemk protein	NA	NA	NA	NA
WP_063976429.1\|4720738_4720996_-	hypothetical protein	NA	NA	NA	NA
WP_159367693.1\|4721278_4721929_-	hypothetical protein	NA	NA	NA	NA
WP_159368111.1\|4721929_4722460_+	hypothetical protein	NA	NA	NA	NA
WP_159367694.1\|4722507_4722726_+	DUF1491 family protein	NA	NA	NA	NA
WP_159367695.1\|4722789_4723392_-	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_006473457.1\|4723632_4724988_-\|transposase	IS1380-like element IS1247 family transposase	A0A1X9I6F6	Streptococcus_phage	2.2e-45	29.7
WP_081260992.1\|4725129_4725828_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_063976430.1\|4725904_4726147_+	hypothetical protein	NA	NA	NA	NA
WP_063976431.1\|4726197_4726683_+	hypothetical protein	NA	NA	NA	NA
WP_122129195.1\|4726807_4728265_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_122129113.1\|4728363_4729488_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_122129112.1\|4729606_4730044_-	pseudoazurin	NA	NA	NA	NA
WP_159367696.1\|4730138_4731695_-	FAD-binding protein	NA	NA	NA	NA
WP_159367697.1\|4731714_4732053_-	cytochrome c	NA	NA	NA	NA
WP_159367698.1\|4732049_4732388_-	hypothetical protein	NA	NA	NA	NA
WP_159368112.1\|4732751_4734407_+	AAA domain-containing protein	NA	NA	NA	NA
WP_159368113.1\|4734500_4734644_+	killer protein	NA	NA	NA	NA
WP_159367699.1\|4734654_4734939_+	HigA family addiction module antidote protein	A0A2P1MXE5	Escherichia_phage	5.6e-07	37.0
WP_159367700.1\|4735148_4735601_-	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_159367701.1\|4735998_4736352_-\|transposase	transposase	NA	NA	NA	NA
WP_015063481.1\|4736773_4737877_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_015449415.1\|4740314_4741079_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	3.6e-85	65.2
WP_099232206.1\|4741611_4742022_-	hypothetical protein	NA	NA	NA	NA
WP_069336911.1\|4742018_4742456_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_069336921.1\|4742452_4743370_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_159367702.1\|4743470_4744094_+	peroxiredoxin	NA	NA	NA	NA
WP_069336910.1\|4744090_4744465_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_069336909.1\|4744841_4745135_+	integration host factor subunit beta	NA	NA	NA	NA
WP_069336908.1\|4745362_4746439_+	hypothetical protein	NA	NA	NA	NA
WP_069336920.1\|4746590_4746971_+	STAS/SEC14 domain-containing protein	NA	NA	NA	NA
WP_069336907.1\|4747161_4747557_+	group III truncated hemoglobin	NA	NA	NA	NA
WP_159367703.1\|4747584_4748271_+	oxidase	NA	NA	NA	NA
WP_099232202.1\|4748272_4748545_+	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_069336904.1\|4748600_4748807_+	hypothetical protein	NA	NA	NA	NA
WP_159367704.1\|4749019_4749966_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	9.0e-09	24.0

DBSCAN-SWA_8

4821246 : 4919198

101

uncultured_Caudovirales_phage(33.33%)

transposase,integrase

attL 4876027:4876086|attR 4915163:4916043

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099232343.1\|4821246_4822398_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_099232344.1\|4822390_4824139_+	hypothetical protein	NA	NA	NA	NA
WP_099232346.1\|4825980_4826466_+	hypothetical protein	NA	NA	NA	NA
WP_159367735.1\|4828701_4829622_+	hypothetical protein	NA	NA	NA	NA
WP_066667215.1\|4829814_4831680_-	RNA-directed DNA polymerase	A0A0U4J920	Pseudomonas_phage	1.8e-29	38.0
WP_159367736.1\|4832635_4833022_+	DUF3768 domain-containing protein	NA	NA	NA	NA
WP_159367737.1\|4833149_4833407_+	hypothetical protein	NA	NA	NA	NA
WP_159367738.1\|4833409_4834696_+	cell filamentation protein	NA	NA	NA	NA
WP_159367739.1\|4834716_4835505_-	hypothetical protein	NA	NA	NA	NA
WP_159367740.1\|4835541_4835679_-	hypothetical protein	NA	NA	NA	NA
WP_159367741.1\|4836266_4836596_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159367742.1\|4836558_4837524_+	RNA-directed DNA polymerase	E5E3S8	Burkholderia_phage	3.8e-47	40.3
WP_008830456.1\|4838199_4839090_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_037519512.1\|4839110_4839752_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_008830454.1\|4839754_4840384_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_008830453.1\|4840380_4841190_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_037519524.1\|4841189_4841969_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_008830451.1\|4841968_4843201_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008830450.1\|4843197_4843632_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_008830449.1\|4843650_4844076_-	hypothetical protein	NA	NA	NA	NA
WP_037519509.1\|4844075_4844516_-	membrane protein	NA	NA	NA	NA
WP_037519521.1\|4844512_4845430_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_037519507.1\|4845515_4846139_+	peroxiredoxin	NA	NA	NA	NA
WP_086013073.1\|4846135_4846546_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001389365.1\|4846735_4847500_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_159367743.1\|4847539_4847953_-	hypothetical protein	NA	NA	NA	NA
WP_159367744.1\|4848271_4848829_+	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_159367745.1\|4849014_4849404_+	hypothetical protein	NA	NA	NA	NA
WP_159367746.1\|4849467_4849887_+	hypothetical protein	NA	NA	NA	NA
WP_159367747.1\|4850017_4850470_-	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_159367748.1\|4850598_4851156_-	DUF1269 domain-containing protein	NA	NA	NA	NA
WP_159367749.1\|4851329_4852391_-	AI-2E family transporter	NA	NA	NA	NA
WP_159367750.1\|4852920_4854147_-	GTP-binding protein	NA	NA	NA	NA
WP_159367751.1\|4854127_4854610_-	transcriptional repressor	NA	NA	NA	NA
WP_159368117.1\|4854609_4855041_-	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_157085496.1\|4855138_4856501_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_159367752.1\|4856537_4857179_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-77	67.2
WP_159368118.1\|4857144_4858017_-	hypothetical protein	NA	NA	NA	NA
WP_159367753.1\|4857936_4859793_+	methylase	A0A076FMQ0	Aureococcus_anophage	2.4e-13	29.5
WP_159367754.1\|4859944_4860115_+	hypothetical protein	NA	NA	NA	NA
WP_125989582.1\|4860159_4861522_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_069337910.1\|4861642_4861870_+	hypothetical protein	NA	NA	NA	NA
WP_069337911.1\|4861916_4862108_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_069337912.1\|4862104_4864219_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	6.4e-63	27.8
WP_021227175.1\|4864215_4864659_-	FixH family protein	NA	NA	NA	NA
WP_125989584.1\|4864655_4866197_-	4Fe-4S binding protein	NA	NA	NA	NA
WP_081331756.1\|4866180_4867143_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_020820401.1\|4867135_4867291_-	cbb3-type cytochrome c oxidase subunit 3	NA	NA	NA	NA
WP_020820402.1\|4867287_4868025_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_069337915.1\|4868038_4869700_-	cytochrome-c oxidase, cbb3-type subunit I	NA	NA	NA	NA
WP_020820404.1\|4869723_4870023_-	hypothetical protein	NA	NA	NA	NA
WP_069337920.1\|4870580_4871894_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_069337916.1\|4871984_4872674_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_081331757.1\|4872667_4873282_+	hypothetical protein	NA	NA	NA	NA
WP_069337918.1\|4873344_4873743_-	hypothetical protein	NA	NA	NA	NA
WP_125989592.1\|4874059_4875232_+	glycosidase	NA	NA	NA	NA
4876027:4876086	attL	NA	NA	NA	NA
WP_013054031.1\|4876088_4876853_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_159367755.1\|4876824_4877232_-\|transposase	transposase	NA	NA	NA	NA
WP_037521976.1\|4877696_4878026_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_159367756.1\|4878036_4878558_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.3e-27	43.2
WP_159367757.1\|4878554_4878983_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	7.6e-48	66.9
WP_159367758.1\|4878982_4880269_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.2e-167	72.5
WP_120252807.1\|4880268_4881012_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	5.5e-78	68.0
WP_159367759.1\|4881063_4881354_+	hypothetical protein	NA	NA	NA	NA
WP_159367760.1\|4881433_4881817_-	hypothetical protein	NA	NA	NA	NA
WP_159367761.1\|4881843_4883199_-	voltage-gated chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	7.5e-33	32.2
WP_159367762.1\|4883880_4885365_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	2.7e-169	63.6
WP_159367763.1\|4885376_4886228_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.8e-53	42.6
WP_159367764.1\|4886202_4886568_+	hypothetical protein	NA	NA	NA	NA
WP_159367765.1\|4886582_4886786_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_159367766.1\|4886862_4887966_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_159367767.1\|4888028_4889213_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	6.4e-105	61.7
WP_159367768.1\|4889368_4890280_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_159367769.1\|4890708_4891089_-	DUF1971 domain-containing protein	NA	NA	NA	NA
WP_043150706.1\|4891010_4891457_-	hypothetical protein	NA	NA	NA	NA
WP_159367770.1\|4891501_4894261_-	EAL domain-containing protein	NA	NA	NA	NA
WP_013054031.1\|4894518_4895283_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_080572850.1\|4898182_4899559_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010338372.1\|4899567_4900242_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.0e-31	37.4
WP_010338374.1\|4900241_4901570_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_037509342.1\|4901698_4903885_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_037509343.1\|4903887_4904481_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_080572848.1\|4904536_4905340_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_010338379.1\|4905529_4906162_+\|integrase	tyrosine-type recombinase/integrase	A0A0A8WF93	Clostridium_phage	7.8e-09	29.9
WP_080572849.1\|4906543_4906648_-	DUF2474 family protein	NA	NA	NA	NA
WP_010338381.1\|4906647_4907646_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_010338382.1\|4907642_4909037_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_010338383.1\|4909049_4909835_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_029547838.1\|4909838_4911422_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_010338385.1\|4911459_4911870_-	hypothetical protein	NA	NA	NA	NA
WP_010338386.1\|4911866_4912073_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_010338387.1\|4912089_4912539_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_010338389.1\|4912535_4913453_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010338390.1\|4913540_4914164_+	peroxiredoxin	NA	NA	NA	NA
WP_159367771.1\|4914160_4914424_+	ArsR family transcriptional regulator	NA	NA	NA	NA
WP_013054031.1\|4914395_4915160_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.1e-87	66.1
WP_159367772.1\|4915321_4915567_-	hypothetical protein	NA	NA	NA	NA
WP_159368119.1\|4915584_4917216_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-107	45.0
4915163:4916043	attR	NA	NA	NA	NA
WP_019052498.1\|4917320_4917662_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	8.2e-29	52.4
WP_062788688.1\|4917658_4918006_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_159366036.1\|4918118_4919198_-\|transposase	IS630 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP047220

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047220_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047220_1

56914-57003

Orphan

Consensus_repeat	Method
GACTCGACCCCAACACTCACTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047220_1

>merge|NZ_CP047220|1|56914-57003|CRISPRCasFinder
GACTCGACCCCAACACTCACTTTTACCGACCCCAAAACTCACCGAAGGCTACCCTAAAACTCACGCGACTCGACCCTAACACTCACTTTT

>NZ_CP047220|1|1|56914-57003|CRISPRCasFinder
GACTCGACCCCAACACTCACTTTT	ACCGACCCCAAAACTCACCGAAGGCTACCCTAAAACTCACGC
GACTCGACCCTAACACTCACTTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047220.1\|WP_006961816.1\|60836_61703_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP047220.1\|WP_006961814.1\|57784_60694_+\|Tn3-family-transposase	unknown	unknown	gnl\|CDD\|376561
NZ_CP047220.1\|WP_159368294.1\|51417_51699_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	unknown	unknown	gnl\|CDD\|226136
NZ_CP047220.1\|WP_159368298.1\|55886_56798_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP047220.1\|WP_159368292.1\|49420_50572_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP047220.1\|WP_159368291.1\|48291_48657_-\|PilZ-domain-containing-protein	unknown	unknown	unknown
NZ_CP047220.1\|WP_159368296.1\|54887_55523_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP047220.1\|WP_159368299.1\|61829_63500_-\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	unknown	unknown	gnl\|CDD\|226036
NZ_CP047220.1\|WP_159368293.1\|51124_51421_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|226194
NZ_CP047220.1\|WP_159368301.1\|64630_64879_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP047220.1\|WP_159368295.1\|52232_52655_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|372700
NZ_CP047220.1\|WP_159368297.1\|55548_55830_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047220.1\|WP_015063481.1\|52960_54064_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP047220.1\|WP_159368307.1\|64305_64536_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP047220.1\|WP_159368306.1\|52018_52204_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225495
NZ_CP047220.1\|WP_159368300.1\|63502_63766_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP047220.1\|WP_006961816.1\|60836_61703_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	1.26226e-44
NZ_CP047220.1\|WP_006961814.1\|57784_60694_+\|Tn3-family-transposase	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	3.82862e-173
NZ_CP047220.1\|WP_159368294.1\|51417_51699_-\|type-II-toxin-antitoxin-system-ParD-family-antitoxin	gnl\|CDD\|226136	COG3609, COG3609, Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain [Transcription].	3.03008e-11
NZ_CP047220.1\|WP_159368298.1\|55886_56798_-\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.66002e-24
NZ_CP047220.1\|WP_159368292.1\|49420_50572_+\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.81068e-31
NZ_CP047220.1\|WP_159368301.1\|64630_64879_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	7.05466e-09
NZ_CP047220.1\|WP_159368296.1\|54887_55523_+\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	2.66518e-46
NZ_CP047220.1\|WP_159368299.1\|61829_63500_-\|type-IV-secretory-system-conjugative-DNA-transfer-family-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	2.28685e-117
NZ_CP047220.1\|WP_159368293.1\|51124_51421_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|226194	COG3668, ParE, Plasmid stabilization system protein [General function prediction only].	4.2173e-07
NZ_CP047220.1\|WP_159368295.1\|52232_52655_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|372700	pfam13744, HTH_37, Helix-turn-helix domain. Members of this family contains a DNA-binding helix-turn-helix domain.	2.86467e-12
NZ_CP047220.1\|WP_015063481.1\|52960_54064_-\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.76488e-23
NZ_CP047220.1\|WP_159368307.1\|64305_64536_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	6.13845e-14
NZ_CP047220.1\|WP_159368306.1\|52018_52204_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	8.93877e-15

>NZ_CP047220.1|WP_159368298.1|55886_56798_-|RepB-family-plasmid-replication-initiator-protein
MNRTSSPVKSGKAKVARGEDTALTLAQKGRGNPFDPANYGEIVKPGELVDIIELSPLTLADRRIYNLLIANAWERIGEPVIHRIAKTALKGTHQGNERIESSLLRLMGTIAIVTIRKGGKSYKRRVQLLGPSDESLEKDGFLHYRIPEELIEILRNSEVYARLKTQVMYCFESKYALCLYEMIERRIGLEYKQSEEFTIAELRGLLNVPEGKLDRFADFNKYCLKVAQEEINKLCPFWVEFTPIKKGRKVERVSMMWLPKTMSGRRDAQNLIDQHSIVRRAKLRGDIPEMPVLVDFSLPAAQR
>NZ_CP047220.1|WP_159368297.1|55548_55830_+|hypothetical-protein
MAIARKPNSKPKPPIDEAAADAFIAGAAKPEAAPIAADAKDAGQGGEPRKSPVMLRFDRALLAKVDAAAKRRGISRSAWIQFTVSRALDAGEG
>NZ_CP047220.1|WP_159368296.1|54887_55523_+|AAA-family-ATPase
MILAVGNTKGGVGKTTLAVNLAVARALAGRDLLLVDGDEQGTALTFTELRTDRLGEAGYTAVALTGAALRSQVRQLAAKYDDIIIDVGGRDTGSLRAALTVADTLLVPVQPRSFDVWALDQVAALVAEAREINEVLRAVAMLNGADAQGADNEAALEMIGDVEGIEVLPTSIVRRKAFPNAAAEGRAVMEQSPRDTKAIDELAALVSAVFV
>NZ_CP047220.1|WP_015063481.1|52960_54064_-|IS110-family-transposase
MSISKFVGLDVHKETIAVALADDGRTGEIRFYGTIPNTQDSIRRLVARLSSPDVALHFCYEAGGCGYGIHRQLVDLGAECSVIAPSVMPRKPADRIKTDRRDAMTLARLLRSGELTAIWVPDEAHEAIRDLIRGRRQAKHDLVAGRQMLLSFLLRHGRKFAGRSNWTKAHWRWLGEQAFDAPHQQFVFGESIRRIEEAQQRCDRLDAMLVEALPYWSLAPLVQALQALRGVGLIVAATLVAEIGDLGRFDTPKQLMGWLGLVPSEASSGARTRRGAITKTGNREARAMLVEAAWSYRLPAREERRYRARVEGLPDEVKAIAWKAQVRLCQRYRMLAASGKPLPKVITAIARELVGFVWDIGRRMQPA
>NZ_CP047220.1|WP_159368295.1|52232_52655_-|XRE-family-transcriptional-regulator
MSANDMIVETFANVFDAIADTPEEAAELKARADQMLGIREQVKLWEVPLGEAAKRLGLTGPLNDLLRVKFDRFSLDDLMTAATAAGIEPPTPRKSSWDDLRGMVKGNGKRFTIEEIKDNDAIADATAAAGMAGMHDHGRD
>NZ_CP047220.1|WP_159368306.1|52018_52204_-|helix-turn-helix-domain-containing-protein
MEAAEIRRLRRDSGLSQAGFARLLWAHKRTVQSWETGTMRPTGATLALLTLVKRRGIQILT
>NZ_CP047220.1|WP_159368294.1|51417_51699_-|type-II-toxin-antitoxin-system-ParD-family-antitoxin
MATMNVSLPDPMRDFVQNRIDSGQYASVSDYVRDLIRRDQSETEDEQRWLRELDASIELGLEDEKAGRLYDLGEVCAEIRAEIEGMTGEQPLQ
>NZ_CP047220.1|WP_159368293.1|51124_51421_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MKVFLTPGSRHDLRAIGRHIAKDNPPRAVTFVAELEDAAQRLGGMPRAFPLVPRYEHHGIRRRSYHGYGILYAVRSDRIVVYRFLGLGQDHDRALRLN
>NZ_CP047220.1|WP_159368292.1|49420_50572_+|IS110-family-transposase
MTAHLASPLAAIRVDLGAIFVSLELSKSTWLVTSLSPGSEKMSRHSISGGDRPALLACLSGLRDKAEAREGQRYPVIAIQEAGLDGFWIHRALVSEKWITSHVVDAASIAVPRRHRRAKTDRIDGETLVRTLMAWMRGEPRVCSMVRVPAVEEEDQRRIGRERTMLVKERTLHTNRIKGLLFSVGIRGYEPNRRDRRERLEELRTGEGGPLPRHLKGQINRELDRLELVAEQIKSIENERDLCASTSDSSPQAILATLKGIGPEFASVLANEGFFRHFDNRRQVAAYAGLAPSPWRSGSIDREQGVSKSGNPRLRTTMVQAAWLWLRFQPDSALSRWFQERVSLNGGRGKKVAIVALARKLLVAFWKFAMSGVVIEGAITAKA
>NZ_CP047220.1|WP_159368291.1|48291_48657_-|PilZ-domain-containing-protein
MERIVYEARRERRREQRYAADVESILVWEGMHEPVIIQNISTYGALLAGRNFPEINTRVTLIGDGFEVWATVIWLGADLCGLLLSGSVQPLEIIRGRPVRTIERAPSSAITLDRIRPGFYA
>NZ_CP047220.1|WP_006961814.1|57784_60694_+|Tn3-family-transposase
MSLGVSSGDLIGSWSLSFSDIAFVTGKAETARLGLAVQLRFFAGHGFFVPDHASIPSDGVLYLAEQLGLDAKSVNHYDFSGRTARRHCAEILRHLGFRRMTQTDRRALSRWISDDLCAGGQPINAMLEHVFLWCRDRRIYGPSRKELERLVRSQRHLYLEALLARVRDRLAPDAVALLEASLADPDGPTGFNTMKGDAGQATLENILGVTAKLAFIQRLALPRDFLSVTGKAWVDQIVRRVAGEKASEMRRHVPARQLGLYAVYLMAREAQLTDAMVDLLIETVHKIGSRSKRKVVGDIAKDIERVYGKERLLVEIASASIDDPSGRICDVIFPIAGKDKLAAIIKESQAKGALDRRIYKVMRRSWANHYRRMLPSLLSALEFRSNNAVWRPVLAALDWIRSKVDDGCRYVPPHAVPVDEVIPARWRSSVIDEEGRVNRISYELCVLAQLRDRIRSKEIWVVGADRYRNPDDDLPKDFDARREAYYTGLNLTADARAFSSAIREELAQELLLLNANIPRNDKVRLLWRGENRISLTPFKPLPEPRGLASIKTEIGQRWPMTGLLDVLKEAALDTGLLEAFETSASRVALPKTALDQRLLLCLYGLGTNAGLKRIAGATPDVSYEELLHVHRRFVHAAALKEACARVANATLAIRNAAVWGDAGTACASDSTKFGAWDRNLMTEWHARYGGRGVMIYWHVERRATCVYSQLKRCSSSEVASMIEGVLRHCTDMEIQRQYVDSHGQSAVGFAFCRLLGFELAPRLKAIARQKLALPDVGMRTRLPHLQPILSSPINWDEIEQQYDEMVKYAAAMQTKTADPEAILRRFSRSEVMHPTYKALSELGRAVKTIFLCRYLREESFRREIHEGLNVVENWNSANGFVFFGKGGEIATNRIDEQQLSVLALHLLQASLVYVNTRMLQSVLVEPKWTGRMTPDDYRGLTPLIYSHVNPYGRFDLDLNSRIDFGRLAA
>NZ_CP047220.1|WP_006961816.1|60836_61703_+|recombinase-family-protein
MTRVGYARVSTIDQDLDIQVARLKAAGCEILRSETGSGASRTGRTELETIMQFLRADDELVVLRLDRLGRSTRDVLNLVHELDQKGASLRVLEPEVTTAGSMGRMVITILGMVADMELTFIKDRQRAGIEAARAEGVYKGRKKNIDDDEIRRRITAGASKASVARDLKISRMTVYRALDVIPSRIGLPEKPPSVTIALHLTIENFNKHGRGRKPARERIEAMLERDYQMQKTGNCDYTLTVAYDQGADGVSLDDEIASLQTEMFNIAESYRCSIETDVYEIGGQERAW
>NZ_CP047220.1|WP_159368299.1|61829_63500_-|type-IV-secretory-system-conjugative-DNA-transfer-family-protein
MKWLRQLGRATRNLARISGQNPIWAITAFTLSPIRLIRHLLGVLFLFLATAIVLGLGMQFIFRTLIGLAHDSNLYQTIMMLTGLVVILITLRALFQPLILAYGGPDGDDTHGSARFATDRETRPLAQNGDGLIIGRDRKSGKLLRYAGPAHLLTIAPTRTGKGVGTIIPNLLDYPGPVVCIDPKGENARITARQRGTFGPVHVLDPFGVTGLPSAAFNPLDRIDPVGLDLADDCMTLADALVYDAPGEAGEAHWNEEAKALIAGIILSIATSEPPATRTLGTLRDRLTLAPAIFPTMLEAMQAQGGLAARAANRHLGKSDREAAGVLSAAQRHTHFLDSPRMTAVLGHSDFTFADVKARTTSVYLVLPPDRLATYARWLRLMLAQGLADLTRAPASPGRSVLFLLDEFAALGRLEPVERAMSLMAGYGIQFWPILQDVHQLRALYERRAGTFLSNAGVLQVFGVNDHDSAKLVSDLLGQETVVFETMSRALDAEETGISFGTQHVARLLLTPDEVRAMPANLELLFLAGQRPIIATKLAYYADREFAGNFDPVKRV
>NZ_CP047220.1|WP_159368300.1|63502_63766_-|hypothetical-protein
MTDRVPRSWQLLMVGSGVHRISPDLCNRLVRLLDLSPQTRLIEIETDQGGVSVSRDWPGDRMEEVSAIEAEIESSPGIIRMTMFQAA
>NZ_CP047220.1|WP_159368307.1|64305_64536_-|conjugal-transfer-protein-TraD
MARRERTRHLIELGGLVQKAGLVELADDDRATLYGALLDLAAKAREDGNALALWKRRGKRAFDADAEGNKEQFGDG
>NZ_CP047220.1|WP_159368301.1|64630_64879_-|conjugal-transfer-protein-TraD
MRKVRDYDAELKALGDKARALKVKKVQQLGELVTSTGADVLDLDTLAGALLAAVESADAEEREAWRAKGSTFFQRRGKKARR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP047220	Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence	56938-56979	0	1.0
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_AP017658	Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence	34773-34814	1	0.976
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP053024	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-C-Sy, complete sequence	10482-10523	1	0.976
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP005192	Sphingobium sp. MI1205 plasmid pMI3, complete sequence	31147-31188	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP005087	Sphingobium sp. TKS plasmid pTK3, complete sequence	20315-20356	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NC_020562	Sphingomonas sp. MM-1 plasmid pISP1, complete sequence	159529-159570	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NC_019376	Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence	34847-34888	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP005193	Sphingobium sp. MI1205 plasmid pMI4, complete sequence	18238-18279	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NC_020563	Sphingomonas sp. MM-1 plasmid pISP4, complete sequence	33102-33143	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP005088	Sphingobium sp. TKS plasmid pTK4, complete sequence	56281-56322	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP041020	Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence	43053-43094	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	5424-5465	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP041021	Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence	24899-24940	2	0.952
NZ_CP047220_1	1.1\|56938\|42\|NZ_CP047220\|CRISPRCasFinder	56938-56979	42	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	169570-169611	2	0.952

1. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP047220 (Sphingobium yanoikuyae strain YC-JY1 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccctaaaactcacgc	Protospacer
******************************************

2. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_AP017658 (Sphingobium cloacae strain JCM 10874 plasmid pSCLO_4, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaaaactcacgc	Protospacer
******************************.***********

3. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP053024 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-C-Sy, complete sequence) position: , mismatch: 1, identity: 0.976

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccaaaggctaccctaaaactcacgc	Protospacer
*******************.**********************

4. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP005192 (Sphingobium sp. MI1205 plasmid pMI3, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

5. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP005087 (Sphingobium sp. TKS plasmid pTK3, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

6. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NC_020562 (Sphingomonas sp. MM-1 plasmid pISP1, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

7. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NC_019376 (Sphingobium fuliginis ATCC 27551 plasmid pPDL2, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

8. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP005193 (Sphingobium sp. MI1205 plasmid pMI4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

9. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NC_020563 (Sphingomonas sp. MM-1 plasmid pISP4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

10. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP005088 (Sphingobium sp. TKS plasmid pTK4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaaactcaccgaaggctaccccaacactcacgc	Protospacer
******************************.** ********

11. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP041020 (Sphingobium fuliginis ATCC 27551 plasmid pSF3, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

12. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

13. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP041021 (Sphingobium fuliginis ATCC 27551 plasmid pSF4, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

14. spacer 1.1|56938|42|NZ_CP047220|CRISPRCasFinder matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 2, identity: 0.952

accgaccccaaaactcaccgaaggctaccctaaaactcacgc	CRISPR spacer
accgaccccaaagctcaccgaaggctacccgaaaactcacgc	Protospacer
************.***************** ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

24677 : 60694

Megavirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_159368272.1\|24677_25624_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	6.9e-09	23.6
WP_159368273.1\|25764_26814_+	hypothetical protein	NA	NA	NA	NA
WP_159368274.1\|27298_28381_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	3.7e-14	24.9
WP_159368305.1\|28481_29564_-\|transposase	IS5 family transposase	E5E3P6	Burkholderia_phage	5.6e-15	27.5
WP_159368275.1\|29591_29819_+	hypothetical protein	NA	NA	NA	NA
WP_159368276.1\|29946_31353_-	acyltransferase family protein	A0A2H4J4A1	uncultured_Caudovirales_phage	6.2e-06	23.4
WP_159368277.1\|31634_32915_-	hypothetical protein	NA	NA	NA	NA
WP_159368278.1\|33437_34501_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_159368279.1\|34677_35973_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_159368280.1\|35988_36918_-	hypothetical protein	NA	NA	NA	NA
WP_159368281.1\|37141_38296_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SJE0	Klosneuvirus	3.7e-97	45.7
WP_159368282.1\|38324_39437_-	capsule biosynthesis protein CapF	NA	NA	NA	NA
WP_159368283.1\|39433_40468_-	polysaccharide biosynthesis protein	K7Y9E1	Megavirus	3.8e-37	34.1
WP_159368284.1\|40515_42438_-	polysaccharide biosynthesis protein	K7Y9E1	Megavirus	1.0e-19	27.9
WP_159368285.1\|42547_44371_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	7.6e-113	40.5
WP_159368286.1\|44435_44747_-	hypothetical protein	NA	NA	NA	NA
WP_159368287.1\|45366_45618_-	hypothetical protein	NA	NA	NA	NA
WP_159368288.1\|45709_46507_-	serine/threonine protein phosphatase	K4JTY8	Caulobacter_virus	8.6e-29	36.3
WP_159368289.1\|46578_47601_+	peptidase M48 family protein	NA	NA	NA	NA
WP_159368290.1\|47636_47900_-	hypothetical protein	NA	NA	NA	NA
WP_159368291.1\|48291_48657_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_159368292.1\|49420_50572_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_159368293.1\|51124_51421_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_159368294.1\|51417_51699_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_159368306.1\|52018_52204_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_159368295.1\|52232_52655_-	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	2.9e-07	38.6
WP_015063481.1\|52960_54064_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_159368296.1\|54887_55523_+	AAA family ATPase	A4JWV7	Burkholderia_virus	5.2e-45	52.6
WP_159368297.1\|55548_55830_+	hypothetical protein	NA	NA	NA	NA
WP_159368298.1\|55886_56798_-	RepB family plasmid replication initiator protein	A0A1V0E006	Clostridioides_phage	4.0e-06	32.3
WP_006961814.1\|57784_60694_+\|transposase	Tn3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047218

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP047220

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection