CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP047325	Bacillus subtilis strain GOT9 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047325_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047325_1

470878-470985

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047325_1

>merge|NZ_CP047325|1|470878-470985|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP047325|1|1|470878-470985|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047325.1\|WP_003242867.1\|481328_481817_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP047325.1\|WP_003246015.1\|464738_466193_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP047325.1\|WP_004398841.1\|466189_467221_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP047325.1\|WP_003229018.1\|467244_468387_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP047325.1\|WP_003229031.1\|458311_459367_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP047325.1\|WP_003229016.1\|468383_470267_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP047325.1\|WP_003243556.1\|486123_486669_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP047325.1\|WP_003229028.1\|459381_460515_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP047325.1\|WP_004399110.1\|462355_464752_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP047325.1\|WP_010886600.1\|460704_461778_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP047325.1\|WP_003228947.1\|485384_485927_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP047325.1\|WP_003228963.1\|478547_479069_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP047325.1\|WP_003243808.1\|480636_481161_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP047325.1\|WP_004399071.1\|457878_458310_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047325.1\|WP_003228960.1\|479086_480616_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP047325.1\|WP_003243430.1\|483713_485186_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP047325.1\|WP_003228953.1\|481822_482401_-\|molybdenum-cofactor-sulfurase	unknown	unknown	gnl\|CDD\|377051
NZ_CP047325.1\|WP_003228966.1\|477927_478506_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP047325.1\|WP_003229024.1\|461857_462325_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP047325.1\|WP_003243227.1\|482488_483697_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481

Protein	Function_ID	Function_description	E-value
NZ_CP047325.1\|WP_003242867.1\|481328_481817_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
NZ_CP047325.1\|WP_003246015.1\|464738_466193_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP047325.1\|WP_003228963.1\|478547_479069_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.15425e-10
NZ_CP047325.1\|WP_003229018.1\|467244_468387_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP047325.1\|WP_003229031.1\|458311_459367_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
NZ_CP047325.1\|WP_003229016.1\|468383_470267_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP047325.1\|WP_003229028.1\|459381_460515_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.47076e-74
NZ_CP047325.1\|WP_004399110.1\|462355_464752_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP047325.1\|WP_010886600.1\|460704_461778_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.3698e-134
NZ_CP047325.1\|WP_003228947.1\|485384_485927_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	4.58408e-72
NZ_CP047325.1\|WP_003243556.1\|486123_486669_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NZ_CP047325.1\|WP_003243808.1\|480636_481161_-\|membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.00016613
NZ_CP047325.1\|WP_003228960.1\|479086_480616_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.12922e-123
NZ_CP047325.1\|WP_003243430.1\|483713_485186_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP047325.1\|WP_004398841.1\|466189_467221_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP047325.1\|WP_003228966.1\|477927_478506_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
NZ_CP047325.1\|WP_003229024.1\|461857_462325_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NZ_CP047325.1\|WP_003228953.1\|481822_482401_-\|molybdenum-cofactor-sulfurase	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	5.86032e-06
NZ_CP047325.1\|WP_003243227.1\|482488_483697_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175

>NZ_CP047325.1|WP_003229016.1|468383_470267_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQNKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGTPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NZ_CP047325.1|WP_003229018.1|467244_468387_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP047325.1|WP_004398841.1|466189_467221_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP047325.1|WP_003246015.1|464738_466193_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAENDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NZ_CP047325.1|WP_004399110.1|462355_464752_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP047325.1|WP_003229024.1|461857_462325_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NZ_CP047325.1|WP_010886600.1|460704_461778_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NZ_CP047325.1|WP_003229028.1|459381_460515_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>NZ_CP047325.1|WP_003229031.1|458311_459367_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP047325.1|WP_004399071.1|457878_458310_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP047325.1|WP_003228966.1|477927_478506_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP047325.1|WP_003228963.1|478547_479069_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NZ_CP047325.1|WP_003228960.1|479086_480616_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>NZ_CP047325.1|WP_003243808.1|480636_481161_-|membrane-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP047325.1|WP_003242867.1|481328_481817_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP047325.1|WP_003228953.1|481822_482401_-|molybdenum-cofactor-sulfurase
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLAPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP047325.1|WP_003243227.1|482488_483697_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP047325.1|WP_003243430.1|483713_485186_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP047325.1|WP_003228947.1|485384_485927_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLSKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
>NZ_CP047325.1|WP_003243556.1|486123_486669_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047325_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047325_2

2433585-2433690

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047325_2

>merge|NZ_CP047325|2|2433585-2433690|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NZ_CP047325|2|2|2433585-2433690|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047325.1\|WP_003244136.1\|2430096_2431080_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP047325.1\|WP_003242872.1\|2427518_2430104_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP047325.1\|WP_003233481.1\|2449012_2449789_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NZ_CP047325.1\|WP_003223285.1\|2440126_2440564_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP047325.1\|WP_003242803.1\|2425045_2425378_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP047325.1\|WP_003243838.1\|2431295_2432405_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP047325.1\|WP_003243363.1\|2424442_2424961_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP047325.1\|WP_003223272.1\|2434370_2434901_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP047325.1\|WP_003243536.1\|2440598_2440952_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP047325.1\|WP_003243727.1\|2441159_2442044_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP047325.1\|WP_159357106.1\|2425364_2426225_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP047325.1\|WP_003233532.1\|2439530_2440004_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP047325.1\|WP_009968853.1\|2433882_2434227_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP047325.1\|WP_003223262.1\|2432718_2433471_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP047325.1\|WP_003243789.1\|2424028_2424298_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP047325.1\|WP_003233535.1\|2438088_2439378_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP047325.1\|WP_009966836.1\|2434988_2436731_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP047325.1\|WP_003233542.1\|2432412_2432637_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047325.1\|WP_003233537.1\|2436807_2437869_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP047325.1\|WP_003244113.1\|2426457_2427447_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030

Protein	Function_ID	Function_description	E-value
NZ_CP047325.1\|WP_003244136.1\|2430096_2431080_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	2.00254e-44
NZ_CP047325.1\|WP_003242872.1\|2427518_2430104_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP047325.1\|WP_003233481.1\|2449012_2449789_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	1.87454e-155
NZ_CP047325.1\|WP_003223285.1\|2440126_2440564_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP047325.1\|WP_003242803.1\|2425045_2425378_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	1.0168e-26
NZ_CP047325.1\|WP_003243838.1\|2431295_2432405_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.10517e-157
NZ_CP047325.1\|WP_003243363.1\|2424442_2424961_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	2.69836e-13
NZ_CP047325.1\|WP_003223272.1\|2434370_2434901_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NZ_CP047325.1\|WP_003243536.1\|2440598_2440952_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	3.8424e-68
NZ_CP047325.1\|WP_003243727.1\|2441159_2442044_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NZ_CP047325.1\|WP_159357106.1\|2425364_2426225_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	6.61844e-38
NZ_CP047325.1\|WP_003233532.1\|2439530_2440004_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NZ_CP047325.1\|WP_009968853.1\|2433882_2434227_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.16495e-28
NZ_CP047325.1\|WP_003223262.1\|2432718_2433471_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP047325.1\|WP_003243789.1\|2424028_2424298_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP047325.1\|WP_003233535.1\|2438088_2439378_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP047325.1\|WP_009966836.1\|2434988_2436731_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP047325.1\|WP_003233537.1\|2436807_2437869_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.49461e-90
NZ_CP047325.1\|WP_003244113.1\|2426457_2427447_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85

>NZ_CP047325.1|WP_003223262.1|2432718_2433471_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP047325.1|WP_003233542.1|2432412_2432637_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP047325.1|WP_003243838.1|2431295_2432405_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAGEAAAISAAP
>NZ_CP047325.1|WP_003244136.1|2430096_2431080_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP047325.1|WP_003242872.1|2427518_2430104_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGETDTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFTLKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFSYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NZ_CP047325.1|WP_003244113.1|2426457_2427447_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP047325.1|WP_159357106.1|2425364_2426225_+|alpha/beta-fold-hydrolase
MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDLYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP047325.1|WP_003242803.1|2425045_2425378_+|SdpC-immunity-protein-SpdL
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NZ_CP047325.1|WP_003243363.1|2424442_2424961_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP047325.1|WP_003243789.1|2424028_2424298_+|hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP047325.1|WP_009968853.1|2433882_2434227_+|hypothetical-protein
MSQRVCFMEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP047325.1|WP_003223272.1|2434370_2434901_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP047325.1|WP_009966836.1|2434988_2436731_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP047325.1|WP_003233537.1|2436807_2437869_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP047325.1|WP_003233535.1|2438088_2439378_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALEKWGSEIAAVLVEPIVGNFGIVEPKEGFLEQVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFSTFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLTAVEDAFKHLKN
>NZ_CP047325.1|WP_003233532.1|2439530_2440004_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP047325.1|WP_003223285.1|2440126_2440564_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP047325.1|WP_003243536.1|2440598_2440952_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP047325.1|WP_003243727.1|2441159_2442044_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP047325.1|WP_003233481.1|2449012_2449789_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP047325_1	1.1\|470902\|60\|NZ_CP047325\|CRISPRCasFinder	470902-470961	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 1.1|470902|60|NZ_CP047325|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

131351 : 184668

uncultured_Mediterranean_phage(12.5%)

tRNA,coat,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229725.1\|131351_132497_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|132523_133552_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003222669.1\|133581_133782_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003229718.1\|133774_134779_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_003229717.1\|134789_135395_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003229715.1\|135533_136046_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_003246197.1\|136093_137401_-	MFS transporter	NA	NA	NA	NA
WP_004398990.1\|137471_138497_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_003246159.1\|138734_139382_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
WP_003229707.1\|139427_139550_-	hypothetical protein	NA	NA	NA	NA
WP_003246047.1\|139634_139925_+	hypothetical protein	NA	NA	NA	NA
WP_004398683.1\|139931_140072_+	hypothetical protein	NA	NA	NA	NA
WP_004398698.1\|140235_141690_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_004398802.1\|141730_142453_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003245996.1\|142555_143152_-	spore germination protein SgpA	NA	NA	NA	NA
WP_003229695.1\|143299_144463_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_003229691.1\|144579_145686_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_003229689.1\|145672_146542_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_003229687.1\|146495_148091_-	L-aspartate oxidase	NA	NA	NA	NA
WP_004398844.1\|148193_149381_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	8.6e-33	27.1
WP_004398582.1\|149340_149883_+	transcription repressor NadR	NA	NA	NA	NA
WP_004398512.1\|149907_150765_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|150781_151225_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_003246161.1\|151285_152572_-	GTPase ObgE	NA	NA	NA	NA
WP_004399131.1\|152605_153184_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|153261_153384_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|153504_153789_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|153801_154140_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|154142_154451_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_004398649.1\|154597_155464_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_004398684.1\|155456_156251_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_004398624.1\|156400_157207_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|157208_157889_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|157941_158460_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_009967915.1\|158456_159329_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|159359_160373_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_003246034.1\|160464_161160_-	JAB domain-containing protein	NA	NA	NA	NA
WP_004398496.1\|161196_161766_-	septum formation protein Maf	NA	NA	NA	NA
WP_004398782.1\|161918_162917_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_010886586.1\|163050_163797_-	prepilin peptidase	NA	NA	NA	NA
WP_003229640.1\|163936_165229_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_004398606.1\|165288_167931_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
WP_003222590.1\|168378_168570_+	hypothetical protein	NA	NA	NA	NA
WP_004399056.1\|168588_169614_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_003246083.1\|169646_171374_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_003229633.1\|171504_172797_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_003229631.1\|172826_173801_-	porphobilinogen synthase	NA	NA	NA	NA
WP_003229629.1\|173797_174586_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_010886587.1\|174575_175520_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|175552_176383_-	protein HemX	NA	NA	NA	NA
WP_004399038.1\|176390_177758_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003229624.1\|177987_178485_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|178506_179094_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003229618.1\|179090_181415_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
WP_003229616.1\|181595_183254_-\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|183405_184668_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_2

758413 : 769609

Organic_Lake_phycodnavirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228374.1\|758413_759094_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_003228372.1\|759110_760031_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228370.1\|760042_760696_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_003228368.1\|760712_761858_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.7
WP_003243347.1\|762141_762675_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_009968174.1\|762895_763372_+	sporulation-delaying system protein SdpA	NA	NA	NA	NA
WP_003228363.1\|763368_764340_+	sporulation-delaying protein SdpB	NA	NA	NA	NA
WP_003243360.1\|764382_764994_+	sporulation delaying protein SdpC	NA	NA	NA	NA
WP_003228357.1\|765040_765664_-	immunity protein SdpI	NA	NA	NA	NA
WP_003243541.1\|765660_765933_-	sporulation delaying system autorepressor SdpR	NA	NA	NA	NA
WP_003244403.1\|766152_766842_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_003228350.1\|766859_767771_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228349.1\|767790_768444_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|768466_769609_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_3

1132378 : 1208992

Bacillus_phage(26.67%)

protease,tRNA,coat,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015250994.1\|1132378_1134049_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003243604.1\|1134045_1134474_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|1134786_1134918_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|1134874_1135027_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_015250993.1\|1135051_1136398_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|1136410_1136572_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_003227564.1\|1136568_1137288_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
WP_003243158.1\|1137280_1138591_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_010886633.1\|1138580_1139741_+	insulinase family protein	NA	NA	NA	NA
WP_003242974.1\|1139745_1141026_+	insulinase family protein	NA	NA	NA	NA
WP_003243391.1\|1141022_1141724_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_003244415.1\|1141729_1143106_-	YncE family protein	NA	NA	NA	NA
WP_003227552.1\|1143144_1144500_-	YncE family protein	NA	NA	NA	NA
WP_009968328.1\|1144496_1144727_-	hypothetical protein	NA	NA	NA	NA
WP_003227549.1\|1144729_1145875_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
WP_009968329.1\|1145858_1145978_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_003227547.1\|1146076_1146550_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_003227545.1\|1146581_1147454_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|1147514_1148345_-	spermidine synthase	NA	NA	NA	NA
WP_003227540.1\|1148546_1150622_+	penicillin-binding protein	NA	NA	NA	NA
WP_003227538.1\|1150914_1151433_-	hypothetical protein	NA	NA	NA	NA
WP_003227536.1\|1151446_1152106_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|1152214_1152403_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_003227535.1\|1152445_1152865_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_032676970.1\|1152984_1154901_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	2.5e-143	43.4
WP_003227528.1\|1155745_1157146_-	MFS transporter	NA	NA	NA	NA
WP_003227526.1\|1157145_1157616_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|1157727_1158228_-	YwgA family protein	NA	NA	NA	NA
WP_014665786.1\|1158263_1159565_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	5.5e-25	28.9
WP_003222050.1\|1159726_1159951_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003227516.1\|1160165_1160942_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_003227514.1\|1161085_1161976_-	DMT family transporter	NA	NA	NA	NA
WP_003227511.1\|1162143_1162989_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_003243173.1\|1163037_1163937_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_003227508.1\|1164082_1165054_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003227507.1\|1165323_1166088_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_003227505.1\|1166220_1167000_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_003227503.1\|1167014_1168214_-	transaminase BacF	NA	NA	NA	NA
WP_003227502.1\|1168214_1169399_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_032722711.1\|1169395_1170814_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_024571623.1\|1170832_1171594_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.7e-21	30.9
WP_003244300.1\|1171596_1172304_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_009968341.1\|1172293_1172908_-	prephenate decarboxylase	NA	NA	NA	NA
WP_032730323.1\|1173059_1174298_-	MFS transporter	NA	NA	NA	NA
WP_032730321.1\|1174507_1175920_-	amino acid permease	NA	NA	NA	NA
WP_032730319.1\|1175919_1177620_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_003243454.1\|1177693_1179241_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003227482.1\|1179467_1180742_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_032730318.1\|1180918_1181383_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_014481242.1\|1181706_1182162_-\|coat	spore coat polysaccharide biosynthesis protein SpsL	NA	NA	NA	NA
WP_003242585.1\|1182154_1183006_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-37	38.5
WP_003244201.1\|1183019_1183967_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_003243368.1\|1183966_1184707_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	2.6e-48	41.9
WP_003244190.1\|1184731_1185751_-\|coat	spore coat polysaccharide biosynthesis protein SpsG	NA	NA	NA	NA
WP_003243421.1\|1185753_1186476_-\|coat	spore coat polysaccharide biosynthesis protein SpsF	NA	NA	NA	NA
WP_003243135.1\|1186468_1187590_-\|coat	spore coat biosynthesis protein SpsE	NA	NA	NA	NA
WP_003243179.1\|1187589_1188459_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003243878.1\|1188459_1189629_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	5.5e-16	26.6
WP_003243510.1\|1189649_1191074_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_003244383.1\|1191078_1191849_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_003227448.1\|1192168_1192714_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003227446.1\|1192757_1193129_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_010886635.1\|1193190_1194513_-	purine permease	NA	NA	NA	NA
WP_003243806.1\|1194532_1194850_-	YwdI family protein	NA	NA	NA	NA
WP_003227441.1\|1195017_1196388_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_003242965.1\|1196412_1197090_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
WP_003242519.1\|1197103_1197910_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_009968358.1\|1197999_1198533_-	hypothetical protein	NA	NA	NA	NA
WP_003227434.1\|1198580_1199216_-	hypothetical protein	NA	NA	NA	NA
WP_003227432.1\|1199208_1199547_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003242645.1\|1199690_1200506_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003243437.1\|1200595_1200844_-	hypothetical protein	NA	NA	NA	NA
WP_003227428.1\|1200937_1202377_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	7.0e-21	26.3
WP_003227426.1\|1202373_1203759_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_003243563.1\|1204060_1204831_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003227423.1\|1204869_1205700_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|1205739_1206042_-	hypothetical protein	NA	NA	NA	NA
WP_003227419.1\|1206571_1208992_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	6.9e-21	36.8

DBSCAN-SWA_4

2193853 : 2202219

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233955.1\|2193853_2195149_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_003233953.1\|2195222_2195948_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
WP_003219409.1\|2195940_2196195_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003243954.1\|2196191_2196875_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003233949.1\|2196858_2199087_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
WP_003233947.1\|2199062_2200493_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_003233945.1\|2200594_2201635_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
WP_003233943.1\|2201631_2202219_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.5

DBSCAN-SWA_5

2703465 : 2747662

Planktothrix_phage(25.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232972.1\|2703465_2703705_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|2703869_2704808_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|2704830_2706072_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003232967.1\|2706147_2706933_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|2707124_2708111_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_003232964.1\|2708107_2709097_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
WP_003245082.1\|2709184_2710816_+	oligopeptide-binding protein AppA	NA	NA	NA	NA
WP_003245828.1\|2710891_2711842_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_003232961.1\|2711858_2712770_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|2712974_2713727_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|2713761_2714754_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003232957.1\|2715497_2717135_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_003245554.1\|2717242_2718178_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|2718181_2719099_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_014906294.1\|2719103_2720180_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|2720181_2721099_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_010886478.1\|2721205_2722423_+	MFS transporter	NA	NA	NA	NA
WP_003244921.1\|2722586_2723165_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014476435.1\|2723345_2723741_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003232944.1\|2723783_2724440_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|2724609_2724750_+	hypothetical protein	NA	NA	NA	NA
WP_003245194.1\|2724716_2725373_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|2725367_2725490_-	hypothetical protein	NA	NA	NA	NA
WP_003245839.1\|2725533_2726685_+	competence protein CoiA	NA	NA	NA	NA
WP_009967010.1\|2726731_2728744_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|2728781_2728949_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|2729262_2730162_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|2730158_2730557_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_010886480.1\|2730811_2731357_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	4.8e-39	60.4
WP_003232924.1\|2731560_2732133_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_003232922.1\|2732257_2732626_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|2732654_2733290_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|2733308_2734109_+	NAD kinase	NA	NA	NA	NA
WP_080010601.1\|2734171_2735023_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003232912.1\|2735035_2735770_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A8E2N0	Enterococcus_phage	7.2e-06	24.8
WP_003232910.1\|2736004_2737849_+	sodium:proton antiporter	NA	NA	NA	NA
WP_003232909.1\|2738097_2738808_+	thiaminase II	NA	NA	NA	NA
WP_003232908.1\|2738782_2739400_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_029726273.1\|2739383_2740493_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_072173897.1\|2740492_2740693_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_003232902.1\|2740689_2741460_+	thiazole synthase	NA	NA	NA	NA
WP_003232900.1\|2741456_2742467_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_003232898.1\|2742485_2743301_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|2743436_2744213_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003232894.1\|2744313_2744997_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_014479464.1\|2745089_2745539_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_014479465.1\|2745666_2746155_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003232886.1\|2746306_2746816_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003232884.1\|2746910_2747234_-	hypothetical protein	NA	NA	NA	NA
WP_032677403.1\|2747275_2747662_-\|coat	spore coat protein CotV	NA	NA	NA	NA

DBSCAN-SWA_6

2775319 : 2845809

Bacillus_phage(27.03%)

terminase,tRNA,portal,plate,holin,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244878.1\|2775319_2775799_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_003232825.1\|2775838_2776033_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_003232822.1\|2776198_2776528_-	YjdJ family protein	NA	NA	NA	NA
WP_010886488.1\|2777147_2778137_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_003245601.1\|2778259_2778508_-\|coat	spore coat protein CotT	NA	NA	NA	NA
WP_003245023.1\|2778761_2780165_+	peptidoglycan-N-acetylmuramic acid deacetylase PdaC	NA	NA	NA	NA
WP_003244679.1\|2780204_2780678_-	YjfA family protein	NA	NA	NA	NA
WP_003232812.1\|2780802_2780970_-	putative motility protein	NA	NA	NA	NA
WP_003244687.1\|2781096_2781996_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_009967034.1\|2782004_2782403_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_003245827.1\|2782503_2783079_-	YjgB family protein	NA	NA	NA	NA
WP_003245240.1\|2783224_2786182_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_003232799.1\|2786174_2786735_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_003244850.1\|2786931_2787573_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_010886490.1\|2787651_2788278_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003232791.1\|2788308_2788587_-	hypothetical protein	NA	NA	NA	NA
WP_003232789.1\|2788977_2790168_+	monooxygenase YjiB	NA	NA	NA	NA
WP_003232783.1\|2790190_2791369_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	5.6e-08	28.3
WP_003232781.1\|2791409_2791598_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
WP_003245334.1\|2791771_2792584_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_003232776.1\|2792629_2793382_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_003232774.1\|2793381_2794134_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
WP_003232772.1\|2794253_2795228_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_003232768.1\|2795359_2795857_+	hypothetical protein	NA	NA	NA	NA
WP_003220510.1\|2796245_2796668_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_003232765.1\|2796707_2797886_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_029317654.1\|2798084_2799506_+	glucuronate isomerase	NA	NA	NA	NA
WP_003232760.1\|2799573_2800953_+	MFS transporter	NA	NA	NA	NA
WP_003232758.1\|2801057_2802071_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_003232756.1\|2802076_2803096_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_029317655.1\|2803121_2804201_+	mannonate dehydratase	NA	NA	NA	NA
WP_003232752.1\|2804197_2805034_+	SDR family oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
WP_003245531.1\|2805081_2806350_+	MFS transporter	NA	NA	NA	NA
WP_029726237.1\|2806437_2807439_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_159357109.1\|2807513_2808956_+	tagaturonate reductase	NA	NA	NA	NA
WP_032730467.1\|2808952_2810446_+	altronate dehydratase	NA	NA	NA	NA
WP_003245643.1\|2810484_2811249_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_032730469.1\|2811473_2811938_-	hypothetical protein	NA	NA	NA	NA
WP_003245490.1\|2812086_2813358_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_015252291.1\|2813502_2814639_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
WP_003245487.1\|2814628_2814763_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_003232731.1\|2814793_2815051_-	YciI family protein	NA	NA	NA	NA
WP_032721375.1\|2815170_2816124_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	8.6e-68	75.3
WP_014476529.1\|2816163_2816541_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	4.7e-17	42.3
WP_015252289.1\|2816645_2817248_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
WP_003245071.1\|2817324_2818161_+	manganese catalase	NA	NA	NA	NA
WP_019712456.1\|2818196_2818793_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|2818955_2819297_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_019712457.1\|2819475_2819655_+	hypothetical protein	NA	NA	NA	NA
WP_019712458.1\|2819641_2820478_+\|portal	phage portal protein	NA	NA	NA	NA
WP_080009791.1\|2820377_2821178_+	ATP-binding protein	A6XMI1	Bacillus_virus	3.8e-61	52.2
WP_003245588.1\|2821177_2821345_+	hypothetical protein	NA	NA	NA	NA
WP_021479479.1\|2821429_2821780_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_014476537.1\|2821776_2821983_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
WP_019712460.1\|2822098_2822608_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	2.9e-22	39.2
WP_019712461.1\|2822722_2823520_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	2.7e-59	51.0
WP_019712462.1\|2823516_2824818_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-153	60.5
WP_019712463.1\|2824821_2826309_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.0e-139	55.7
WP_003232691.1\|2826328_2827156_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
WP_019712464.1\|2827181_2828117_+\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	1.9e-104	63.4
WP_003245011.1\|2828138_2828522_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.9e-13	40.2
WP_009967053.1\|2828518_2828875_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_003245226.1\|2828871_2829357_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_003232680.1\|2829369_2829810_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
WP_003232679.1\|2829813_2830032_+	hypothetical protein	NA	NA	NA	NA
WP_003245369.1\|2830028_2831429_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
WP_003232677.1\|2831430_2831874_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003232676.1\|2831965_2832412_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
WP_003239113.1\|2832441_2832591_+	hypothetical protein	NA	NA	NA	NA
WP_010886493.1\|2832592_2836591_+	phage-like element PBSX protein XkdO	A0A1L2JY60	Aeribacillus_phage	2.1e-43	44.9
WP_003232674.1\|2836583_2837243_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
WP_003245730.1\|2837258_2838236_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|2838235_2838502_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_003232671.1\|2838558_2838984_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
WP_003232669.1\|2838976_2840023_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
WP_003244743.1\|2840006_2840585_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.2
WP_003232665.1\|2840581_2840854_+	hypothetical protein	NA	NA	NA	NA
WP_003244681.1\|2840856_2842920_+	phage-like element PBSX protein XkdV	A0A2H4J4R1	uncultured_Caudovirales_phage	4.8e-31	37.4
WP_003232660.1\|2842931_2843261_+	phage-like element PBSX protein XkdW	A0A2H4JCI0	uncultured_Caudovirales_phage	1.7e-15	41.3
WP_003232658.1\|2843257_2843422_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	3.2e-15	66.0
WP_003245597.1\|2843465_2844305_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_003232655.1\|2844357_2844627_+	hypothetical protein	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
WP_003232653.1\|2844639_2844903_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
WP_029317679.1\|2844915_2845809_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.0e-83	69.7

DBSCAN-SWA_7

3359013 : 3446006

Bacillus_phage(75.51%)

capsid,terminase,tail,tRNA,portal,integrase,protease,plate,holin,coat,head

attL 3377476:3377496|attR 3420395:3420415

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252046.1\|3359013_3360342_-\|protease	serine protease AprX	A0A1B0T6A2	Bacillus_phage	1.9e-28	33.9
WP_014476869.1\|3360566_3360800_+	hypothetical protein	NA	NA	NA	NA
WP_003245758.1\|3361079_3361787_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_003231775.1\|3361856_3362309_+	OsmC family protein	NA	NA	NA	NA
WP_014476870.1\|3362322_3362676_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_015483253.1\|3362689_3363007_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_029317825.1\|3363143_3363419_-	hypothetical protein	NA	NA	NA	NA
WP_003231769.1\|3363507_3363921_+	hypothetical protein	NA	NA	NA	NA
WP_003245569.1\|3364020_3364965_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|3365004_3365226_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_014479841.1\|3365422_3365695_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|3365776_3366007_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|3366250_3366643_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|3366602_3368705_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|3368722_3369712_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|3369761_3370382_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_003244862.1\|3370445_3371213_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	9.1e-52	49.5
WP_003231746.1\|3371836_3372805_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_003245432.1\|3372937_3374200_+	GTPase HflX	NA	NA	NA	NA
WP_003245218.1\|3374217_3375483_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|3375592_3376000_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_003231737.1\|3376058_3377393_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
3377476:3377496	attL	NA	NA	NA	NA
WP_159357114.1\|3377510_3378656_-\|integrase	tyrosine-type recombinase/integrase	A0A0M5M609	Bacillus_phage	1.2e-71	40.7
WP_159357115.1\|3378721_3379177_-	ImmA/IrrE family metallo-endopeptidase	A0A2I7SC21	Paenibacillus_phage	1.2e-46	58.6
WP_159357116.1\|3379184_3379556_-	helix-turn-helix domain-containing protein	A0A0S2SXM8	Bacillus_phage	2.8e-22	63.0
WP_159357117.1\|3379733_3379979_+	XRE family transcriptional regulator	A0A0S2SXX9	Bacillus_phage	2.0e-29	78.2
WP_159357118.1\|3379991_3380261_+	group-specific protein	A0A0S2SXU9	Bacillus_phage	1.2e-19	50.6
WP_159357119.1\|3380510_3380891_-	DUF2513 domain-containing protein	Q9T1Z5	Staphylococcus_phage	5.0e-19	40.5
WP_159357120.1\|3380953_3381229_+	hypothetical protein	Q9ZXC9	Bacillus_phage	1.3e-21	52.9
WP_159357121.1\|3381422_3381977_+	hypothetical protein	Q9ZXC8	Bacillus_phage	1.3e-92	95.7
WP_159357122.1\|3381980_3382919_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	2.4e-163	92.6
WP_019260095.1\|3382908_3383106_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.1e-17	87.5
WP_072692603.1\|3383128_3383569_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	2.1e-77	96.6
WP_159357123.1\|3383629_3386050_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.2
WP_159357124.1\|3386249_3386687_+	hypothetical protein	Q9ZXC3	Bacillus_phage	8.2e-74	92.4
WP_159357125.1\|3386683_3387223_+	nuclease	Q9ZXC2	Bacillus_phage	1.4e-94	96.1
WP_159357126.1\|3387255_3387771_+	hypothetical protein	D6R425	Bacillus_phage	2.8e-89	90.6
WP_159357127.1\|3387785_3388151_+	hypothetical protein	NA	NA	NA	NA
WP_003185369.1\|3388263_3388644_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-48	83.7
WP_159357128.1\|3389166_3390882_+	AAA family ATPase	NA	NA	NA	NA
WP_159357129.1\|3391010_3391520_+	hypothetical protein	NA	NA	NA	NA
WP_159357130.1\|3391628_3392036_+	hypothetical protein	NA	NA	NA	NA
WP_159357131.1\|3392286_3392472_+	hypothetical protein	NA	NA	NA	NA
WP_159357132.1\|3392461_3392827_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	2.3e-29	53.3
WP_019846969.1\|3393054_3393570_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.2e-33	43.4
WP_159357133.1\|3393566_3395276_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.9e-207	62.8
WP_159357134.1\|3395464_3396745_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	6.2e-154	63.5
WP_159357135.1\|3396707_3397334_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	7.6e-81	75.8
WP_159357136.1\|3397372_3398668_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	1.5e-91	48.1
WP_063695026.1\|3398690_3399107_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.9e-11	53.0
WP_159357137.1\|3399124_3399427_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	6.2e-12	45.1
WP_159357138.1\|3399416_3399731_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	4.9e-12	36.4
WP_032725460.1\|3399730_3400129_+	hypothetical protein	NA	NA	NA	NA
WP_159357139.1\|3400125_3400518_+	hypothetical protein	NA	NA	NA	NA
WP_159357140.1\|3400532_3401144_+\|tail	phage tail protein	J7KKC8	Streptococcus_phage	3.6e-11	35.1
WP_159357141.1\|3401209_3401587_+	hypothetical protein	NA	NA	NA	NA
WP_159357142.1\|3401786_3406274_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	4.1e-67	41.8
WP_159357143.1\|3406267_3407107_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.3e-99	60.1
WP_159357144.1\|3407121_3408825_+	alkaline phosphatase	D6R400	Bacillus_phage	1.3e-180	56.5
WP_159357145.1\|3408876_3411444_+	peptidase G2	D6R401	Bacillus_phage	0.0e+00	66.5
WP_159357161.1\|3411459_3412932_+\|plate	BppU family phage baseplate upper protein	D6R402	Bacillus_phage	5.1e-67	64.5
WP_159357146.1\|3412945_3413299_+	hypothetical protein	O64053	Bacillus_phage	4.2e-12	47.1
WP_159357147.1\|3413299_3413443_+	XkdX family protein	NA	NA	NA	NA
WP_159357148.1\|3413461_3414301_+	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	4.3e-31	33.5
WP_159357149.1\|3414341_3414764_+\|holin	holin	D6R405	Bacillus_phage	7.4e-56	84.2
WP_159357150.1\|3414807_3415785_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.0e-64	68.9
WP_159357151.1\|3415834_3416293_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_159357152.1\|3416307_3418077_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.0e-130	56.2
WP_159357153.1\|3418425_3419541_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	7.1e-146	71.9
WP_009967315.1\|3420897_3421188_+	membrane protein	NA	NA	NA	NA
3420395:3420415	attR	NA	NA	NA	NA
WP_003244759.1\|3421433_3421778_+	hypothetical protein	O64021	Bacillus_phage	4.2e-33	83.9
WP_003245594.1\|3421908_3422160_+	hypothetical protein	NA	NA	NA	NA
WP_003245860.1\|3422346_3422781_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_003245212.1\|3422850_3423642_+	hypothetical protein	NA	NA	NA	NA
WP_003245754.1\|3423976_3424489_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003245299.1\|3425048_3425690_+	DUF3885 domain-containing protein	NA	NA	NA	NA
WP_003245740.1\|3425778_3426132_+	hypothetical protein	NA	NA	NA	NA
WP_003245005.1\|3426175_3426451_+	hypothetical protein	NA	NA	NA	NA
WP_003245467.1\|3426563_3426728_+	hypothetical protein	NA	NA	NA	NA
WP_003245403.1\|3426867_3427338_+	hypothetical protein	NA	NA	NA	NA
WP_032730490.1\|3428162_3429554_+	MFS transporter	NA	NA	NA	NA
WP_029726899.1\|3429584_3431186_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_029726900.1\|3431322_3432477_-	ROK family protein	NA	NA	NA	NA
WP_003231664.1\|3432718_3434056_+	xylose isomerase	NA	NA	NA	NA
WP_003231662.1\|3434206_3435706_+	xylulokinase	NA	NA	NA	NA
WP_003231658.1\|3436189_3436825_-	endonuclease YncB	A0A1P8CWK6	Bacillus_phage	2.9e-72	68.1
WP_003231656.1\|3437237_3438653_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_003231653.1\|3438754_3439939_-	alanine racemase	NA	NA	NA	NA
WP_003231652.1\|3440401_3440863_+	DUF2691 family protein	NA	NA	NA	NA
WP_003231650.1\|3440898_3441327_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	1.5e-72	93.0
WP_003231648.1\|3441928_3442189_-\|coat	spore coat protein CotU	NA	NA	NA	NA
WP_003231643.1\|3442590_3442755_+	hypothetical protein	NA	NA	NA	NA
WP_003231641.1\|3443029_3443869_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	2.8e-163	97.8
WP_119123060.1\|3443991_3444279_-	hypothetical protein	NA	NA	NA	NA
WP_023592782.1\|3444321_3445044_-	hypothetical protein	NA	NA	NA	NA
WP_003245181.1\|3445203_3445560_-	membrane protein	NA	NA	NA	NA
WP_003231636.1\|3445805_3446006_-\|coat	spore coat protein CotC	NA	NA	NA	NA

DBSCAN-SWA_8

3600500 : 3606187

Bacillus_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231348.1\|3600500_3600674_-	hypothetical protein	A0A1P8CWY7	Bacillus_phage	5.6e-18	82.5
WP_009967407.1\|3600818_3601043_+	hypothetical protein	A0A1P8CWZ1	Bacillus_phage	8.9e-16	82.0
WP_003231345.1\|3601046_3601502_-	hypothetical protein	NA	NA	NA	NA
WP_010886526.1\|3601626_3601887_+	hypothetical protein	NA	NA	NA	NA
WP_075058859.1\|3602640_3602805_+\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	3.9e-21	92.6
WP_003231340.1\|3602959_3604075_+	response regulator aspartate phosphatase RapK	D6R410	Bacillus_phage	1.5e-95	49.2
WP_004399440.1\|3604071_3604194_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_003231333.1\|3605349_3605643_-	YolD-like family protein	O64030	Bacillus_phage	7.5e-39	86.6
WP_009967409.1\|3605851_3606187_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	7.2e-46	86.5

DBSCAN-SWA_9

3831634 : 3837730

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223904.1\|3831634_3832228_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_003246108.1\|3832217_3832973_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
WP_003230498.1\|3833253_3833778_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|3833791_3834166_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|3834278_3834743_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_003230496.1\|3834775_3835972_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.3e-115	54.9
WP_029317961.1\|3835986_3836634_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
WP_003230491.1\|3836644_3837730_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1

DBSCAN-SWA_10

4067508 : 4109312

uncultured_Caudovirales_phage(32.35%)

terminase,tail,portal,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399034.1\|4067508_4069104_+	type II toxin-antitoxin system toxin ribonuclease YqcG	A0A1P8CWI7	Bacillus_phage	6.9e-78	61.3
WP_009967790.1\|4069118_4069697_+	type II toxin-antitoxin system antitoxin YqcF	NA	NA	NA	NA
WP_009967791.1\|4069814_4069961_+	hypothetical protein	NA	NA	NA	NA
WP_003229947.1\|4069957_4070320_-	hypothetical protein	NA	NA	NA	NA
WP_004399085.1\|4070335_4070815_-	hypothetical protein	NA	NA	NA	NA
WP_003229946.1\|4070979_4071798_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	1.0e-64	74.4
WP_003246208.1\|4071842_4072265_-\|holin	holin family protein	D6R405	Bacillus_phage	3.3e-48	73.7
WP_003246010.1\|4072309_4073203_-	hypothetical protein	NA	NA	NA	NA
WP_003229944.1\|4073290_4073455_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
WP_009967793.1\|4073451_4073787_-\|portal	phage portal protein	NA	NA	NA	NA
WP_003229943.1\|4073796_4074897_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
WP_003229942.1\|4074899_4075172_-	hypothetical protein	NA	NA	NA	NA
WP_003229941.1\|4075168_4075747_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	1.5e-14	33.8
WP_003229940.1\|4075730_4076777_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	8.3e-72	43.5
WP_004398572.1\|4076769_4077195_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.5e-11	36.4
WP_003229938.1\|4077207_4077471_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_004398524.1\|4077467_4078448_-	hypothetical protein	H7BV96	unidentified_phage	2.1e-40	32.0
WP_004398548.1\|4078460_4079120_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	4.8e-25	34.7
WP_003246092.1\|4079112_4083870_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.3e-44	47.2
WP_003229934.1\|4083872_4084010_-	hypothetical protein	NA	NA	NA	NA
WP_003229933.1\|4084051_4084501_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.7e-11	41.1
WP_004398662.1\|4084646_4084826_+	type I toxin-antitoxin system toxin TxpA	NA	NA	NA	NA
WP_075058862.1\|4085205_4085295_+	type I toxin-antitoxin system toxin BsrH	NA	NA	NA	NA
WP_003229930.1\|4085548_4085992_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
WP_003229929.1\|4085994_4087395_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	4.1e-74	39.1
WP_010886574.1\|4087395_4087587_-	hypothetical protein	NA	NA	NA	NA
WP_003229927.1\|4087583_4088021_-	hypothetical protein	NA	NA	NA	NA
WP_003246050.1\|4088033_4088537_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	8.3e-38	46.9
WP_003229925.1\|4088533_4088896_-	YqbH/XkdH family protein	A0A249XXE9	Clostridium_phage	6.9e-10	39.3
WP_004398566.1\|4088892_4089288_-	DUF3199 family protein	NA	NA	NA	NA
WP_003229923.1\|4089291_4089603_-	hypothetical protein	NA	NA	NA	NA
WP_003229922.1\|4089613_4090549_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
WP_003229921.1\|4090567_4091536_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	7.4e-59	57.3
WP_003229920.1\|4091568_4092222_-	hypothetical protein	NA	NA	NA	NA
WP_004398748.1\|4092262_4093180_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.4e-51	39.1
WP_159357157.1\|4093176_4094709_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	8.8e-147	51.7
WP_003229917.1\|4094712_4096008_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-155	63.4
WP_003229916.1\|4096000_4096720_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.7e-55	55.9
WP_004398685.1\|4096787_4097252_-	hypothetical protein	NA	NA	NA	NA
WP_004398775.1\|4097395_4097851_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	2.4e-60	74.8
WP_003229913.1\|4098048_4098978_+	hypothetical protein	NA	NA	NA	NA
WP_003229912.1\|4099051_4099258_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.5e-20	71.6
WP_009967809.1\|4099339_4099768_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	5.6e-43	65.7
WP_003229910.1\|4099863_4100013_-	hypothetical protein	NA	NA	NA	NA
WP_075058863.1\|4100003_4100945_-	ATP-binding protein	A6XMI1	Bacillus_virus	8.0e-58	52.2
WP_116362964.1\|4100826_4101504_-	DnaD domain protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.1e-05	31.8
WP_003229907.1\|4101579_4102434_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	7.1e-122	79.0
WP_004398673.1\|4102436_4103396_-	YqaJ viral recombinase family protein	A0A2H4JA52	uncultured_Caudovirales_phage	2.2e-135	72.9
WP_003229905.1\|4103501_4103696_-	hypothetical protein	NA	NA	NA	NA
WP_119123069.1\|4103655_4103829_-	hypothetical protein	NA	NA	NA	NA
WP_003245994.1\|4103825_4104083_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
WP_004398626.1\|4104079_4104649_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
WP_003229902.1\|4104722_4104863_-	hypothetical protein	NA	NA	NA	NA
WP_004398958.1\|4104892_4105123_-	helix-turn-helix transcriptional regulator	A8ATK0	Listeria_phage	1.1e-08	53.4
WP_004398704.1\|4105299_4105650_+	transcriptional regulator SknR	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-06	30.6
WP_003229900.1\|4105916_4106084_-	hypothetical protein	NA	NA	NA	NA
WP_004399117.1\|4106438_4106975_-	AAA family ATPase	NA	NA	NA	NA
WP_004399097.1\|4107243_4107762_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_010886573.1\|4107809_4109312_-	recombinase family protein	A0A2H4J3Q1	uncultured_Caudovirales_phage	1.8e-19	28.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047325

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection