CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP047393	Pontibacillus sp. HMF3514 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,DinG	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047393_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047393_1

878614-878687

Orphan

Consensus_repeat	Method
AAATAACGGAATGAATGTCCGTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047393_1

>merge|NZ_CP047393|1|878614-878687|CRISPRCasFinder
AAATAACGGAATGAATGTCCGTAAGCTCTTCCACATATTCATTTTAAGGTGAAATAACGGAATAAATGTCCGTA

>NZ_CP047393|1|1|878614-878687|CRISPRCasFinder
AAATAACGGAATGAATGTCCGTA	AGCTCTTCCACATATTCATTTTAAGGTG
AAATAACGGAATAAATGTCCGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047393.1\|WP_160099441.1\|877545_878196_+\|response-regulator	unknown	unknown	gnl\|CDD\|225107
NZ_CP047393.1\|WP_160099426.1\|870143_870884_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP047393.1\|WP_160099432.1\|872911_874087_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|349941
NZ_CP047393.1\|WP_160099459.1\|888810_888939_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NZ_CP047393.1\|WP_160099457.1\|887608_888625_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224525
NZ_CP047393.1\|WP_160099430.1\|872158_872875_+\|EcsC-family-protein	unknown	unknown	gnl\|CDD\|378945
NZ_CP047393.1\|WP_160099461.1\|889086_889818_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NZ_CP047393.1\|WP_160099445.1\|879510_880164_-\|spore-cortex-lytic-enzyme	unknown	unknown	gnl\|CDD\|213747
NZ_CP047393.1\|WP_160099439.1\|876501_877533_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP047393.1\|WP_160099453.1\|884485_885418_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP047393.1\|WP_160099438.1\|875709_876492_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378309
NZ_CP047393.1\|WP_160099428.1\|870880_872098_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|377581
NZ_CP047393.1\|WP_160099451.1\|883418_884456_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP047393.1\|WP_160099455.1\|885421_886825_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP047393.1\|WP_160099434.1\|874354_874789_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|365947
NZ_CP047393.1\|WP_160099436.1\|874905_875565_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP047393.1\|WP_160099447.1\|880314_880809_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NZ_CP047393.1\|WP_160099424.1\|869766_870021_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047393.1\|WP_160099449.1\|880906_883159_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP047393.1\|WP_160099443.1\|879040_879457_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540

Protein	Function_ID	Function_description	E-value
NZ_CP047393.1\|WP_160099441.1\|877545_878196_+\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.17637e-81
NZ_CP047393.1\|WP_160099426.1\|870143_870884_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.11142e-83
NZ_CP047393.1\|WP_160099432.1\|872911_874087_-\|amidohydrolase	gnl\|CDD\|349941	cd08021, M20_Acy1_YhaA-like, M20 Peptidase aminoacylase 1 subfamily, includes Bacillus subtilis YhaA and Staphylococcus aureus amidohydrolase, SACOL0085. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine). This family includes Staphylococcus aureus amidohydrolase, SACOL0085, which contains two manganese ions in the active site, and forms a homotetramer with variations in interdomain orientation which possibly plays a role in the regulation of catalytic activity.	0
NZ_CP047393.1\|WP_160099459.1\|888810_888939_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	6.62037e-12
NZ_CP047393.1\|WP_160099457.1\|887608_888625_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	7.4794e-119
NZ_CP047393.1\|WP_160099430.1\|872158_872875_+\|EcsC-family-protein	gnl\|CDD\|378945	pfam12787, EcsC, EcsC protein family. Proteins in this family are related to EcsC from B. subtilis. This protein is found in an operon with EcsA and EcsB which are components of an ABC transport system. The function of this protein is unknown.	3.21236e-89
NZ_CP047393.1\|WP_160099445.1\|879510_880164_-\|spore-cortex-lytic-enzyme	gnl\|CDD\|213747	TIGR02869, Spore_cortex-lytic_enzyme, spore cortex-lytic enzyme. Members of this protein family are the spore cortex-lytic enzyme SleB from Bacillus subtilis and other Gram-positive, endospore-forming bacterial species. This protein is stored in an inactive form in the spore and activated during germination. [Cellular processes, Sporulation and germination].	1.55155e-77
NZ_CP047393.1\|WP_160099439.1\|876501_877533_+\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	7.21199e-60
NZ_CP047393.1\|WP_160099453.1\|884485_885418_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP047393.1\|WP_160099438.1\|875709_876492_+\|hypothetical-protein	gnl\|CDD\|378309	pfam09922, DUF2154, Cell wall-active antibiotics response 4TMS YvqF.	4.71813e-35
NZ_CP047393.1\|WP_160099428.1\|870880_872098_+\|ABC-transporter-permease	gnl\|CDD\|377581	pfam05975, EcsB, Bacterial ABC transporter protein EcsB. This family consists of several bacterial ABC transporter proteins which are homologous to the EcsB protein of Bacillus subtilis. EcsB is thought to encode a hydrophobic protein with six membrane-spanning helices in a pattern found in other hydrophobic components of ABC transporters.	1.47248e-110
NZ_CP047393.1\|WP_160099451.1\|883418_884456_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP047393.1\|WP_160099455.1\|885421_886825_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP047393.1\|WP_160099434.1\|874354_874789_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|365947	pfam00210, Ferritin, Ferritin-like domain. This family contains ferritins and other ferritin-like proteins such as members of the DPS family and bacterioferritins.	6.64527e-22
NZ_CP047393.1\|WP_160099436.1\|874905_875565_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.22013e-36
NZ_CP047393.1\|WP_160099447.1\|880314_880809_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	7.70439e-22
NZ_CP047393.1\|WP_160099461.1\|889086_889818_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.56501e-79
NZ_CP047393.1\|WP_160099449.1\|880906_883159_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP047393.1\|WP_160099443.1\|879040_879457_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	7.92495e-61

>NZ_CP047393.1|WP_160099441.1|877545_878196_+|response-regulator
MSDSIRVVVIDDHDVVRKGVIAYLMTEPELDIVGEANSGNEGAKVAIKEQPDVVLMDLIMENGTGIEATEKIMKELPDCKIIILTSYYDDEKVFPALEAGAFSYMLKTSSADEIAEAIKKASRGETYIEPKVANKMMTRFRTQEKKPHEDLTERELEVLMCIGDGLTNQEISDKLYIGIKTVKTHVSNILSKLGVYDRTQAAVYAHKNGLIRKQNL
>NZ_CP047393.1|WP_160099439.1|876501_877533_+|sensor-histidine-kinase
MLKKLNSIRYKFIRSHLYGLFLITTILLSIFLGLYVSLEPSWLTSEAIFLFIGTMVVVSFFVSLYVGFQSSGQLKEKLDGLSTLITSLSRGNYNSRIHLTPEDEITRIGDELNGLAEKLKTQVRSLQKMADERSEYAKSAHKAATIEERQRLARDLHDAVSQQLFALTMMSQATLRMFDQDPSKAKSQLEEITSMALQAQTEMRALLLHLRPVHLSGDPLDKGIHNLVEELKQKCQIDFDVQIEEVQDVSDGAEEHLFRIVQEALSNILRHSEATSVKLTLKPLNQEIFLHIGDNGKGFEVNQDKKTSYGLKTMQERTEEIGGTFKIRSRPDEGTYIDIRIPV
>NZ_CP047393.1|WP_160099438.1|875709_876492_+|hypothetical-protein
MRNFSVSKIVVAFVFIAIGVFLILANLDVISLEMNDAFIFIYPLLFVLIGLKLVFDGIRGDGDGWPVGAFLVVFGGLLILDRFDIISFQFGDIWSLWPIILVFIGISMFKPKRKSKHVEITTETDNEDEGEDQPKKNRKKKRNFTVGDHSFNEQNWKVEPMDLWNAIGDYHIDFTKAFIPEKDTSIAISGVIGDVKILMPENVAFRVDARIKTGDIKVLDEKSEGINRKLSYQTPDYDEATRKITLDIDFKIGDIRVDKV
>NZ_CP047393.1|WP_160099436.1|874905_875565_+|phosphatase-PAP2-family-protein
MGEKPTAKTIHVIIFFSTFAIGIASLLTMQVVTETIPSLDIWARELRSGWGNTSLYTFFEDVTVLGSSAFLAPFTLIMAVWLWWRKKDLFASIVLLIGVIGTYAINKGIKFAVQRSRPDWSGAIETDGFSYPSGGAMLSLLCFALVTYFLILHAQKAWSKVILFVITFTAIVLTGFSRYLLGAHYLTDVIAGFSFGFICLSVLIGLYHRFSNQNIASSD
>NZ_CP047393.1|WP_160099434.1|874354_874789_-|ferritin-like-domain-containing-protein
MDAKRKELIDGLNEDLAHEYAASIMYTYNAAVVQGLYYQILKPFFESEIGDEQGHALYLAEKIKTLGGTPTTKPAEVKQLTDVKEMLEEAKRAEEDTIKRYETRKEQAEELGLTELVVKLDDMIADETGHMEEMERLLADPRLQ
>NZ_CP047393.1|WP_160099432.1|872911_874087_-|amidohydrolase
MWEKIYQEIDSYFDEMVHIRRYLHQHPELSFQETETAKYIANQYEELGIPYRANVGGNGVVATLEGGKPGKTIALRADFDALPIQDEKDVPYKSTVPGVMHACGHDGHTAALLCLAKALLPYKDDIPGTIVFLHQHAEEFTPGGAKPMIEDGALEGVDAVFGTHLWISTEVGTIETAPEAFFAGADAFEITIQGKGGHGAIPHQTKDSILIASQLVTSLQQIVSRKIDPLRSAVVTVGTFEAGKAFNVIADTAKITGTVRTFGQDIQETVIKEMENQIKGACTAHEADYDFQYNRGYPPIINHKAEAQLVLDAASQTPGVEKAQFVSPVMTGEDFSYYLLEKPGAYYFTGAQKEGHVYAHHHPKFDFDERALPIAAKTLFSSFLEYQNKHQ
>NZ_CP047393.1|WP_160099430.1|872158_872875_+|EcsC-family-protein
MLETTYNDKALREAKRWVKQMEKRSSLLQRTSKRMQTAVNKKIPDRVHAVVTDSIKRMIELSLTSSHYIYPIEVDPSWSLKEREEAVKERLTQYKRTAALEGAGTGAGGILLGMADFPLLLSIKMKFLFDVGRIYGYDVRKYEERMYLLHLFILAFSSDEKRQSVLKTVLDWEENKEEWREVDWKTLQLEYRDSIDFAKVLQLIPGLGAIVGAVANFHFLEKLGETATNAYRLRILDK
>NZ_CP047393.1|WP_160099428.1|870880_872098_+|ABC-transporter-permease
MINARTLWRDRLQNHAKEMNRYLRLMFNDHFSFAMFFFLVGMAYVYQQWLSSLPEDFPTAWLMAIVFGLVIAYSPVRTLLKEADLVFLLPAESQLGPFFRNGWLYSFFTQVFYLFFIVVAFGPLYFTSFPERSITEYVLFCVVLVVFKAWNLLAHWWEVNSRMRYSGYLDTIFRIVLNTLTFYFIVVGDALLFAAITTVLFFGVMMYDYTLAKKRRGIAWDVLIEKESARMQAFYRIANLFTDVPHLKKTIKKRHWLVRLLKEPISHASGNSYDYLYRITFVRSSDYLGMYLRLLVIAGALVYYVPNIWVKLGFAFLFLYLSGFQMMTLWQHHRHLDWLELYPVPLEQRKSALLKWLFQLLLFKTFVLGVVFLFLWNLLGLAFVWIGGALLSYVLVYKYLSKRLT
>NZ_CP047393.1|WP_160099426.1|870143_870884_+|ATP-binding-cassette-domain-containing-protein
MSALLHIKDLVGGYTHKNVLHGISFDIQPGEIVGLIGLNGAGKSTTIKHVIGLMQQKQGEVLIDGQSFQDNPEAYRGKFSYIPEMPVLYDELTLEEHLRLTAMAYGLSEDVFKQRLQPLLKEFRMEKKLNWFPVHFSKGMRQKVMIMCAFLVEPSLYIVDEPFVGLDPLGIQSYLQLMNDMKAQGAGVLMSTHILATAERYCDRFVIIHEGEVRAKGTLEELRASFQMPDATLDDLYVQLTKEDDQ
>NZ_CP047393.1|WP_160099424.1|869766_870021_+|hypothetical-protein
MVSWEGTVIPRVGDGIARVGDGIARVGDGIARVSDGIARVGDGIAWVSDGIARVGDGIAWVADEKLVLSRIQVFQIRGLKIEDI
>NZ_CP047393.1|WP_160099443.1|879040_879457_+|disulfide-bond-formation-protein-B
MNQKSEVVLFIAWVQAVIAVLGSLYFSEVKDFIPCEMCWFQRILMYPLVLLYGISLIKKDLRYAEAGLYMSGIGILVSAYHYGIQKVPALQHGGGSCGIVPCDGQYINLFGFITIPFLAGTAFIVIFTCHLWLKRKVK
>NZ_CP047393.1|WP_160099445.1|879510_880164_-|spore-cortex-lytic-enzyme
MKKALITLMTIFSVATAVFVVTPATQVKAATPILEQGDQYGHVWGAQNRLKQLGLYKGELDGLFGPLTEQAVIDFQRSRGLTVDGIMGQNTWKALRNETFTQKEIQMIAQIIHGEARGEPFEGKVAVASVVLNRLHHEDFPNSIKGIIFESRAFTAVQDKQYYLTPNNEAYKAAYAAIKGWDPTQNSTFYFNPKTATSDWIWTREQIKQIGKHIFAK
>NZ_CP047393.1|WP_160099447.1|880314_880809_-|antibiotic-biosynthesis-monooxygenase
MRVYMTSGTYEYLKSIQEKHGESTVLLMQGEDKTLAYTEEENIFQEPFVYEVVDQVGDMQEQGFVIMNNIPVTDEGRPLFEDRFKNRAGSVEDSPGFQAIRILRPTQGNTYIVLTQWDSVDSFEKWKNSQSFQKAHQNSGPESKEKPPFVAGPAYLTQYNMVSE
>NZ_CP047393.1|WP_160099449.1|880906_883159_+|PBP1A-family-penicillin-binding-protein
MTIVSFLEYKVYRIIEEIGNIKEVNILKWNLNTLHPKRWGKKTRWAVIALISTILLTIGGYYLLLMGGKSVVDKKLLVLDQASQIETADGEVLTKLYKQNRTVVSIDEIPQHVEDAFIAIEDTRFYEHSGIDLKAIARAIYRDIIAMEKVEGGSTITQQLSKNLFLTNDKTWTRKFKEIMAALYLEQEVSKERILQYYLNTIYFGNGIYGVEEASQYFFNKPIEKLTISEGALLAALPKAPNYYDPVEHPERAKQRRNLVLNRMHETGMVSTEKVVQLQRKTLGIERGNPEKKPWMNSYIDLVIKEATEEYDLSKEELYQGGFRIVVGVDQDIQESSYEAMQNDDYFPGSTKGVEGSFLLMEEKTGRIVAAHGGRNYQRGDLNRIHIKQQPGSVMKPLAVYGPALDLPNYQPYSVLEDKKRSYGEYQPENYDNRYEGQVSLYKALQQSKNAPAVWLLNKMGVDYAKDYLNKMGMNLSENGLSIALGGLKEGVTPMDMVRSYRSFIHGGEMIEPHTILKIYNQNGELVSHHKDETKQIFQPQTAWSMTRMLQSVVKDGTARAGSYSKALAGKTGSTQHPMVSGKTNDAWFVGYTPNYVGAVWMGYDKIDKNHYLNSGSAYPTRLIKDVLSKIDQKRDLQASFVKPEGVEDVPEPIELPVIDDLQGTLSFGSLTLIKGKLTWTPSSDNRVVYRIYRVESGQDAKVGEVTGKGSYQLDRVKLFDEEVYYVVPYNPLTKLEGEPSNRVKVSLDW
>NZ_CP047393.1|WP_160099451.1|883418_884456_+|uroporphyrinogen-decarboxylase
MTNTFNDTILKAFRGEPTDHVPVWFMRQAGRSQPEYRKLKEKYSLFEITHQPELCAYVTRLPVEQYNVDAAILYKDIMSPLPAIGVDVEIKKGIGPVIDNPIRSKADVEKLGEIDPDSDVPYVLDTIRLLTREQLNVPLIGFSGAPFTLASYMIEGGPSKNYNKTKAMMYADSEAWFKLMDKLADMTITYVKAQIRAGAKAIQIFDSWVGALNVQDYRTFIKPVMERIFSELREENVPLIMFGVGAGHLAKDWHDLPLDVVGLDWRTSITEARNMGIQKPVQGNLDPAILLADWDTIETRTKAILDQGMQQPGYIFNLGHGVFPEVNPETLRRLTEFVHNYSKKA
>NZ_CP047393.1|WP_160099453.1|884485_885418_+|ferrochelatase
MAKKKMGLLVMAYGTPYKEEDLERYYTHIRRGRKPSQESLDELRERYQAIGGISPLARITREQAEALESKLNEIQDDIEFNLYLGLKHIDPFIEDAVEQMANDGIEEAVSIVLAPHYSTFSVKSYNGRAQEESEKYGKPTIYSVESWYDEPGFIQYWTEALRKVYEEMSAEEREKAVTIFSAHSLPEKILQNGDPYPEQLQTTADLIARQLQIQNYEIGWQSEGNTPDPWIGPDVQDLTRDLYNEKGYRTFVYAPVGFVSDHLEVLFDNDYECKVVTDELGASYYRPEMPNDHPLFIQTLADVVLKKAQQ
>NZ_CP047393.1|WP_160099455.1|885421_886825_+|protoporphyrinogen-oxidase
MSEVKRIAIVGGGITGLTTAYYLQKKIKEKGLPFEVKLYEASDRLGGMIHTERKDGFTIERGPDSLLARKPSVFRLIEDVGLQDKLVDVAAGKAYVLANEKLHGIPQGSFMGIPTQVTPFALSSLFSPMGKLRAAGDLVKSKSKPQEDQSLGHFFRNRFGDEVVENLIEPLLGGVYSGDLDRLSLMATFPNFYNMEQEHGSLIKGLRKSRGKQPKNKKKPSVFKTLETGLGSLVDAVVEQLDEGTIEQGTSVDHIERKEDGYHLMLGTGEVAQADSIVLTTPHYACQRMLTQYDFMEPLRDMPATSVANVAMAFDQSAIEKDVDGTGFLVSRNSDYRITACTWTHKKWPHTTPDGKALLRAYVGKPNDQEVVDQSDEEIQEIVLNDINKIMNITHPPEFTVITRWRNSRAQYTVGHKERIHNIKQSMRSELPGVFLAGASYEGLGVPDCIDQGEQAVEDVLEFLQQS
>NZ_CP047393.1|WP_160099457.1|887608_888625_+|substrate-binding-domain-containing-protein
MPTIKDVAKYAGLSRTTVSRVINDQPYVSDEKRQCVLKAMEELGYVPNSSARRLRSQKTETLAVLLPSITNPFFSHLIEAMEVKASQWGYQVIICQTHESEQKEQDYLELLRTKQVDGVIMTAVHNDWEVIESYRECGPIIVCNENIEEAQVPFIYVDQEKAAYDATMHLIQQGCKNISFLSGDAESNVSAYRRSGFLKALKESGLPFLPNASYSNAIDVNSGREIFRELRRLNHPIDGVFTGSDEVAAGMIYEAIKEGVRVPEDMSIIGFDNQSISMLMSPSITTVEQPVQEMGEKCVEVLIDQIEHRHRSVREDHVFTHELKVRNSTFQEIALVNS
>NZ_CP047393.1|WP_160099459.1|888810_888939_-|YhfH-family-protein
MMNVLEFFKNLPDKKCSKCGESFEAQADCYGNICESCDDPAR
>NZ_CP047393.1|WP_160099461.1|889086_889818_+|MBL-fold-metallo-hydrolase
MKVTVNGFWGGYPGAYGATSSYIVESNGFTLLVDCGSGALSRLQPKMDVMDIGAVIISHYHFDHIADIGVMQYAWKVQNILRETERQLPIYGHQEDMESFQALTHERTQGYAYDPTKPIQIGPFTIRFMKTDHPVPCYAMRISNGYKDIVYTADSSYKEEFIEFSKGADLLITDSNFYDGMDGSGPGHMTSTECAHIAKEAGVKELWLSHLPHFGTVSDLQEQAEQVFDGTVMLADGGLTWEV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047393_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047393_2

2083412-2083533

Orphan

Consensus_repeat	Method
CCTGTTGATGCTCCAGCTACCTGGCTTCCTGGTCCCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047393_2

>merge|NZ_CP047393|2|2083412-2083533|CRISPRCasFinder
CCTGTTGATGCTCCAGCTACCTGGCTTCCTGGTCCCATTTGACCTGGTCCACCTGGTCCCATCATGCCAGGACCACCCATTGGCCCTGTTGATGCTCCAGCTACTTGGCTTCCTGGTCCCAT

>NZ_CP047393|2|2|2083412-2083533|CRISPRCasFinder
CCTGTTGATGCTCCAGCTACCTGGCTTCCTGGTCCCAT	TTGACCTGGTCCACCTGGTCCCATCATGCCAGGACCACCCATTGGC
CCTGTTGATGCTCCAGCTACTTGGCTTCCTGGTCCCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047393.1\|WP_160101626.1\|2089500_2089812_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237292
NZ_CP047393.1\|WP_160104595.1\|2089071_2089449_-\|DUF1798-family-protein	unknown	unknown	gnl\|CDD\|378052
NZ_CP047393.1\|WP_160101610.1\|2082266_2082605_-\|cell-division-regulator-GpsB	unknown	unknown	gnl\|CDD\|237616
NZ_CP047393.1\|WP_160101624.1\|2088903_2089044_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047393.1\|WP_160101630.1\|2091277_2091871_+\|Holliday-junction-resolvase-RecU	unknown	unknown	gnl\|CDD\|235015
NZ_CP047393.1\|WP_160101602.1\|2075908_2076421_+\|cytochrome-B5	unknown	unknown	gnl\|CDD\|259980
NZ_CP047393.1\|WP_160101614.1\|2083948_2084353_-\|cytidine-deaminase	unknown	unknown	gnl\|CDD\|223372
NZ_CP047393.1\|WP_160101594.1\|2073380_2073833_+\|chemotaxis-protein-CheX	unknown	unknown	gnl\|CDD\|381734
NZ_CP047393.1\|WP_160101596.1\|2073901_2074672_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187605
NZ_CP047393.1\|WP_160101628.1\|2090174_2091137_-\|DUF2515-domain-containing-protein	unknown	unknown	gnl\|CDD\|371209
NZ_CP047393.1\|WP_160101604.1\|2076417_2078076_+\|cytochrome-C	unknown	unknown	gnl\|CDD\|238830
NZ_CP047393.1\|WP_160101612.1\|2082679_2083243_-\|DUF1273-family-protein	unknown	unknown	gnl\|CDD\|237461
NZ_CP047393.1\|WP_160101616.1\|2084536_2087605_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|223911
NZ_CP047393.1\|WP_160101608.1\|2080395_2081532_-\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|223194
NZ_CP047393.1\|WP_160101620.1\|2087961_2088168_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047393.1\|WP_160101600.1\|2075726_2075879_+\|cytochrome-c-oxidase-subunit-2A	unknown	unknown	unknown
NZ_CP047393.1\|WP_160101618.1\|2087651_2087981_-\|heavy-metal-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|376657
NZ_CP047393.1\|WP_160101622.1\|2088213_2088762_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377796
NZ_CP047393.1\|WP_160101598.1\|2074792_2075380_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047393.1\|WP_160101606.1\|2078877_2080380_-\|carboxypeptidase-M32	unknown	unknown	gnl\|CDD\|341054

Protein	Function_ID	Function_description	E-value
NZ_CP047393.1\|WP_160104595.1\|2089071_2089449_-\|DUF1798-family-protein	gnl\|CDD\|378052	pfam08807, DUF1798, Bacterial domain of unknown function (DUF1798). This domain is found in many hypothetical proteins. The structure of one of the proteins in this family has been solved and it adopts an all alpha helical fold.	2.862e-21
NZ_CP047393.1\|WP_160101610.1\|2082266_2082605_-\|cell-division-regulator-GpsB	gnl\|CDD\|237616	PRK14127, PRK14127, cell division regulator GpsB.	2.03897e-40
NZ_CP047393.1\|WP_160101602.1\|2075908_2076421_+\|cytochrome-B5	gnl\|CDD\|259980	cd13913, ba3_CcO_II_C, C-terminal cupredoxin domain of Ba3-like heme-copper oxidase subunit II. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea, which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that archaea acquired heme-copper oxidases through gene transfer from gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead, they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively.	1.25685e-42
NZ_CP047393.1\|WP_160101614.1\|2083948_2084353_-\|cytidine-deaminase	gnl\|CDD\|223372	COG0295, Cdd, Cytidine deaminase [Nucleotide transport and metabolism].	2.67127e-64
NZ_CP047393.1\|WP_160101616.1\|2084536_2087605_+\|MMPL-family-transporter	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP047393.1\|WP_160101596.1\|2073901_2074672_-\|glucose-1-dehydrogenase	gnl\|CDD\|187605	cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs. Ga5DH catalyzes the NADP-dependent conversion of carbon source D-gluconate and 5-keto-D-gluconate. This SDR subgroup has a classical Gly-rich NAD(P)-binding motif and a conserved active site tetrad pattern. However, it has been proposed that Arg104 (Streptococcus suis Ga5DH numbering), as well as an active site Ca2+, play a critical role in catalysis. In addition to Ga5DHs this subgroup contains Erwinia chrysanthemi KduD which is involved in pectin degradation, and is a putative 2,5-diketo-3-deoxygluconate dehydrogenase. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107,15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.91837e-86
NZ_CP047393.1\|WP_160101628.1\|2090174_2091137_-\|DUF2515-domain-containing-protein	gnl\|CDD\|371209	pfam10720, DUF2515, Protein of unknown function (DUF2515). This family is conserved in Firmicutes. Several members are annotated as YppC. The function is not known.	2.15567e-135
NZ_CP047393.1\|WP_160101604.1\|2076417_2078076_+\|cytochrome-C	gnl\|CDD\|238830	cd01660, ba3-like_Oxidase_I, ba3-like heme-copper oxidase subunit I. The ba3 family of heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and some archaea which catalyze the reduction of O2 and simultaneously pump protons across the membrane. It has been proposed that Archaea acquired heme-copper oxidases through gene transfer from Gram-positive bacteria. The ba3 family contains oxidases that lack the conserved residues that form the D- and K-pathways in CcO and ubiquinol oxidase. Instead they contain a potential alternative K-pathway. Additional proton channels have been proposed for this family of oxidases but none have been identified definitively. For general information on the heme-copper oxidase superfamily, please see cd00919.	0
NZ_CP047393.1\|WP_160101612.1\|2082679_2083243_-\|DUF1273-family-protein	gnl\|CDD\|237461	PRK13660, PRK13660, hypothetical protein; Provisional.	1.1142e-81
NZ_CP047393.1\|WP_160101594.1\|2073380_2073833_+\|chemotaxis-protein-CheX	gnl\|CDD\|381734	cd17906, CheX, chemotaxis phosphatase CheX. This family contains CheX CheY-P phosphatase which is very closely related to CheC chemotaxis phosphatase; both dephosphorylate CheY, although CheC requires binding of CheD to achieve the level of activity of CheX. CheX has been shown to be the most powerful CheY-P phosphatase of the CheC-FliY-CheX (CXY) family. Structural and functional data of CheX and its CheY3 substrate in Borrelia burgdorferi (the causative agent of Lyme disease) bound to the phosphoryl analog BeF3(-) and Mg2+ reveal a unique mode of binding, but a catalytic mechanism which is virtually identical to that used by the structurally unrelated CheZ, providing a striking example of convergent evolution. Thus, CheX is quite divergent from the rest of the CXY family; it forms a dimer and some may function outside chemotaxis. The data also suggest a possible CheX regulatory mechanism through dissociation of the CheX homodimer.	5.75429e-32
NZ_CP047393.1\|WP_160101608.1\|2080395_2081532_-\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|223194	COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].	0
NZ_CP047393.1\|WP_160101626.1\|2089500_2089812_-\|hypothetical-protein	gnl\|CDD\|237292	PRK13182, racA, chromosome-anchoring protein RacA.	0.000989562
NZ_CP047393.1\|WP_160101618.1\|2087651_2087981_-\|heavy-metal-binding-domain-containing-protein	gnl\|CDD\|376657	pfam01906, YbjQ_1, Putative heavy-metal-binding. From comparative structural analysis, this family is likely to be a heavy-metal binding domain. The domain oligomerizes as a pentamer. The domain is about 100 amino acids long and is found in prokaryotes.	2.08187e-46
NZ_CP047393.1\|WP_160101622.1\|2088213_2088762_-\|hypothetical-protein	gnl\|CDD\|377796	pfam07238, PilZ, PilZ domain. PilZ is a c-di-GMP binding domain which is found C terminal to pfam07317. Proteins which contain PilZ are known to interact with the flagellar switch-complex proteins FliG and FliM. This interaction results in a reduction of torque generation and induces CCW motor bias. This domain forms a beta barrel structure.	3.22899e-05
NZ_CP047393.1\|WP_160101630.1\|2091277_2091871_+\|Holliday-junction-resolvase-RecU	gnl\|CDD\|235015	PRK02234, recU, Holliday junction-specific endonuclease; Reviewed.	1.95441e-113
NZ_CP047393.1\|WP_160101606.1\|2078877_2080380_-\|carboxypeptidase-M32	gnl\|CDD\|341054	cd06460, M32_Taq, Peptidase family M32, which includes thermostable carboxypeptidases TaqCP, PfuCP and FisCP. Peptidase family M32 is a subclass of metallocarboxypeptidases, distributed mainly in bacteria and archaea, whose members contain a HEXXH motif that participates in coordinating a divalent cation such as Zn2+ or Co2+. It includes the thermostable carboxypeptidases (E.C. 3.4.17.19) from Thermus aquaticus (TaqCP) and Pyrococcus furiosus (PfuCP), which have broad specificities toward a wide range of C-terminal substrates that include basic, aromatic, neutral and polar amino acids. These enzymes have a similar fold to the M3 peptidases such as neurolysin and the M2 angiotensin converting enzyme (ACE). The keratin-degrading extremophilic eubacterium Fervidobacterium islandicum M32 carboxypeptidase (FisCP) plays an important role in cellular metabolism, and significantly enhances the degradation of native chicken feathers. It has been shown to mainly cleave the C-termini of peptides with a basic amino acid sequence. Novel M32 peptidases from some eukaryotes: protozoa Trypanosoma cruzi, a causative agent of Chagas' disease, and Leishmania major, a parasite that causes leishmaniasis, have been identified, thus making these enzymes an attractive potential target for drug development against these organisms.	0

>NZ_CP047393.1|WP_160101612.1|2082679_2083243_-|DUF1273-family-protein
MKIIAVSGYKPMEMGLFQIDDPKIDYVKETIKRRLLPLIEEGLEWVLISGNMGVEIWTGEIILDLKNEYDIKLGVFPPFLNQESRWPEKQQEQYRMLIESADFFKPLYNKEYDGPYQFQARDQWLLEKSDACILLYDEETGGSPAYFLEKAKQYQEKHDYPIYYITPFDIDDTVREMMMEDPNYWSD
>NZ_CP047393.1|WP_160101610.1|2082266_2082605_-|cell-division-regulator-GpsB
MGLERVQYSSKDILEKDFKTAIRGYNQEEVDQFLDDVIQDYDAFQKEIERLKQENEQLKKQNPGAQQQSSSPAPKRTRSATQQPQQGQVNYDVLQRLSNLEKAVFGKKYSDS
>NZ_CP047393.1|WP_160101608.1|2080395_2081532_-|class-I-SAM-dependent-RNA-methyltransferase
MPKKVNLIATSAMGLESVVAKEVKDLGYEDVTVENGRVRYQTDVSGIPRSNLWLRTADRVRLVVGEFQATTFDELFEQTKALPWENFIPEDGSVPVIGKSVKSTLHSVPDCQSIVKKAIVERMKKMYGLASSRIQETGPMYRVEIALHKDTALLTIDTSGSGLHKRGYRTGQGEAPLKETLAAALVQLTNWKPDFPFVDPFCGSGTIPIEAALIGQNIAPGFNREFASEEWDMIPYNLWEDAFNEAEEAANYDQPLDITGFDIDGRLIDIAKENAMEAGLGELITWKQMQVKDFRPQSANGYIVGNPPYGERMGDKEEVEQMYKDFGGIMKDCPSWSVYIITSHPNFEKLYGKEATKKRKLFNGFIKTDYYQYFGKHK
>NZ_CP047393.1|WP_160101606.1|2078877_2080380_-|carboxypeptidase-M32
MGEQWNQTEEQFMNYVKEMSQYGEAISLMAWDLRTYAPKNGVEGRSDVIATLSQKVHQMATSDEMKGYIEALKGHTQDEIIQKSIEECEKEYNKHSKIPSDEYKEYVSLQAKSEAVWEEAKEKNDFEMYRPYLEKMVEYNKRFAEYWGYEKHIYNALLDNFEPGVTVDVLDEVFPAVRKSLTDLLQQIKKSDVNPDPTLLTGHFPKEQQEVFSLEILKRMGYNFEGGRLDETVHPFAIDLNQGDVRVTTKYDEKDFRTAVFGTIHEGGHALYEQNISPKLAYTPLAGGTSMGIHESQSLFWENFVSRTEAFWKNHYELFLSHAPESFQHVKFEDFYRAVNEVKPSFIRIEADELTYCLHIMVRYELEKALINDEIQVKDLPELWNDKMEEYLGIRPKTDQEGVLQDVHWSGGAFGYFPSYALGYMYAAQFHNTMKNDLDVEEIIGKGDFEQIRKWLTENIHQYGKMKKPLEILEGVTNEKLNPTYLVDHLREKYQKIYQF
>NZ_CP047393.1|WP_160101604.1|2076417_2078076_+|cytochrome-C
MIAVETKLGKENAKLTMAHMWVAFISLLIGGLMGLLQTLVRTGQVQLPFGIGYYQILTVHGVILALVLTTFFIIGFQFALMAKTVGMTNGERKWGWIAFWTMVIGTTATATMILLGKASVLYTFYAPLAAHPIFYFGLTLVVVGSWIACFVNFRQLYRWKKQNPGEKSPLLAFMVVINMLIWFIATLGVAATVLIQFIPWSLGLVDEINILVSRTLFWYFGHPLVYFWLLPAYMAWYGIIPKIIGGKIFSDSLARLAFILFLLFSIPVGFHHQLLEPGIDPFWKYIQVVLTFAVAIPSLLTAFSMFATFESAGRAKGEKTLFGWFKTLPWKDVRFLAPMIGMIAFVPAGAGGLVNASNQLNLVVHNTIWVTGHFHLTLATTVILTFFGISYWLIPVLRGRKLDAKTNRLGIIQTIVWTLGMFIMSGSMHIAGLLGAPRRSSYSDYGGTEQAAEWIGYQYAQAIGGSILFIGIILMLYTFIYMTFFAPKGTEEFPIAEEANNAAPTPVIFDNWRLWIGIAVVLIAFAYTIPFIDIIENSPPGSPTFKTLIGNF
>NZ_CP047393.1|WP_160101602.1|2075908_2076421_+|cytochrome-B5
MHMHRLEKLWMFIGGGTLLFFLIVLGIGAFIQGAQPPSCLTVIDPQRVEAHDPFKEENLGLQEVEGGDLDYVVNVVASAFNYDFGKDEEGNVVRKIRIPAGSKVMFQGTTKDVVHGFQVAGTNANMMLEPGYINQVEVTLDKPGVYTVVCNEYCGTGHQFMTAQVEVYEE
>NZ_CP047393.1|WP_160101600.1|2075726_2075879_+|cytochrome-c-oxidase-subunit-2A
MPNTHLEKTETKTKIVQEEPNLKGTFIAVMFVFAFLVGTWFSVWGIFLNR
>NZ_CP047393.1|WP_160101598.1|2074792_2075380_+|hypothetical-protein
MKKQLLIAGLSSLLVIAGCGQSEDSADKNKENENQTQEEATNGDKKKENNKQLQSTLLDTQLELAKQLRPHNVVVQDIQAQIENLTTIKDKQELATAKAEVTTKAVDVQKEVEKAVEKLNSFSIKGELSDENTEKLNATINDLKAYFNEVKTALDKPVEADFTKANEKFSSFEEKLGNLYEEAGLLAPNMKKELS
>NZ_CP047393.1|WP_160101596.1|2073901_2074672_-|glucose-1-dehydrogenase
MYLPSFSLEGKLAAVTGATKGIGYAITMAYAEAGADVIIISRTEEDVLHVKEEVEALGRKAYPIVANVQQYNDIINQINGVIHDDQPIDIWVNNAGMNIRSDAFDVSEEEWDQIIQTNMKSAFFLSQYAANRMKEHQRGKIINITSVAGHVALRTGVVYGMTKSALIQMTKTLSLEWGKHNIHVNAIGPWYFPTSLTEKLLENEEYVKEIVDRTPMGRIGKLEELAGSAVFLGSEASNYITGQTLFVDGGMTVYGF
>NZ_CP047393.1|WP_160101594.1|2073380_2073833_+|chemotaxis-protein-CheX
MTVSQGITEVLNGTIESVKSIIPFDVHIDSPSLIEAPLIQAELGVLIGMTGDMKGRLVIEGNHQSIGSIGEKMFGMPIEGEMLESFTGELANMIAGNLATVVSQREVSIDITPPTVIVGSTKISGFKKAFRVPVELNEEGSLQLILMVED
>NZ_CP047393.1|WP_160101614.1|2083948_2084353_-|cytidine-deaminase
MNTEDLIKRAKTIREKAYVPYSKFPVGAALLTTSGKVYDGCNIENAAYPVTCCAERVAIFKAISEGETSFDTLAVVADTDRPVPPCGSCRQVISEFFDAQSKVHTTNLQGDVKTLTVDQLLPYSFSANDLNDHE
>NZ_CP047393.1|WP_160101616.1|2084536_2087605_+|MMPL-family-transporter
MNWILRYRKIVLVFIFLLVSTGIFTYYQLPKRDLPEINVNIASITTPFPGATPLDVERTITNPIEDKIKDIEGVDTVESISTTGFSSVTVTLEGNVNNKVTYSKIRQSISDIARTFPEEVQDSSVNTDLNMTAVSSYHLKAQNYDTLYKAHDLIINWQKQLSNISGVQSVQVKGLPEEQLLITLDAEKLNNQSLSPLQIIDSLQKELSPGAIGTIEEDEKLYQLRLNKTSDWKELEDISVGLNPQGESITLNDIGAINLTHTEVKDLITYKEQPSLSLTIKAKEGMNISALQDRIDEEIKSLSGNLPDNITVEQFYSQNTLIEEVFTNLLTSFGISLAAVLLIMMIGLPFSSALLVAIAIPISVLIGLIPLPYVGVDLNQISIIGIIIAIGILVDDAIVVNDNIQRRFQLGDSAWKGTIRGIKDVRLSIITSTLMIVFSFFPLTFLSGSNGDFIRALPTTLIATIVASTILSLTLIPTVLYIRKKRKDSKAEQSKSGLLGSFFSKLEMIYADKILPKVTKRPIIIGFSGLIVCALLASLAIKIPFEFFPSADRKEVTISVTAPQGTTLNQTRSQLEEMESFIKQNSEVVEETAIFAGSGMPPLFSSTLQQSGENTGQILIRVNKSQQSASNFINNWEEKLRNKFTKSEIFLETITAGPPPSAPIAVNIQGPKLEQLIQTANDLKKELIKLDSTELITLNMNNEQPYIEYSLDRAKIAENNISIDQISSQLQVANTGIPLRVFDNGVNRYDMKLLLNDGDGSGVNLEALRVTGSSTSKGTPRVFTLDELIEQEKSNQLGSIPHMDGERTVTVKGYGEESSNSFQKEANEVINEFEKTLPAGYSFTNSGELNAQQEFFIEVSKLFVIVLFLIYLVMAIQFNSLTIPLLITSTVFLAVTGAIIGLFVTNEPLSFLAVLGIVSLSGIVVRNSVILVDFIEQNHRESQSIHTAVIEAGRSRLRPIILTSLTSIAALLPIAFSGDVLFRPLAISIVGGLLFSTILTLILLPSFYLILYRIRRGKIKTS
>NZ_CP047393.1|WP_160101618.1|2087651_2087981_-|heavy-metal-binding-domain-containing-protein
MIIVNTDFIPGHEIKELKGFVRGSTVQSKNVGRDILASLKNLVGGELVDYTKMMDEARQQAIGRMKKHAEEKGADAVINVRLETSNVTNAASEIIAYGTAVTINEISNN
>NZ_CP047393.1|WP_160101620.1|2087961_2088168_-|hypothetical-protein
MEVVRVFLVALISILQFLGIALLVLQSWIMGLILIVASYVTLGVIMFLLIKDRLREKKEDEENDYREY
>NZ_CP047393.1|WP_160101622.1|2088213_2088762_-|hypothetical-protein
MRKGQQLVIGQVLDIQGEMMEIIVHDRSKVHVGSLWTCTYEHIEFKSKVLKKDGFHIYLYLPLFLDKFPDNRRKLPRVPCSFSAFLYQVQGGVYSFAGTATVIDINVKGFGLLSSEKFENESIYDIHINDEKLEVKPSIKIKNIADCEAQNRYGCEILTISDEQLLSIREYMLSQQIFSPRK
>NZ_CP047393.1|WP_160101624.1|2088903_2089044_+|hypothetical-protein
MGRGKGYKVKRQNHEHEKPLTAKRFAEEGEQKPKSMHASKGGAIKE
>NZ_CP047393.1|WP_160104595.1|2089071_2089449_-|DUF1798-family-protein
MKSLEETIMEVKKNLDQLKDLFLQSEKPPDRKDRELFEKVKKESKPLFELNEKWADLAEQYTYKVENSVVYPLQIKNTKENFELVILHSYYIDVPKKRYMELYNSIHYVLDQLLDSIEMNKEADS
>NZ_CP047393.1|WP_160101626.1|2089500_2089812_-|hypothetical-protein
MGLAAKKMEMYREGMSKREFEKAWMEMMDRVHVIDEKVSKKADEVVLTMVLSHRQEIEHLQSECIRLNQELRELQKRQRQQVNKQIVEKAEPKKNLLQRLFRR
>NZ_CP047393.1|WP_160101628.1|2090174_2091137_-|DUF2515-domain-containing-protein
MDAREEQILIQHIKEQTSIHNVDNISRTKAYQNLYFSYPEIRWAFLASMVSRNAGWNITDLQMDPFQSMLSKQEKRNLFSTYERANWLIFSDAYPQLLLYALSCEIGQALFHLLSEFRISKFMEKEWIYFWENRDHSRLVTALIINEQNVIQKPVIEQSYYKHEVFEKLPFRSQDLFHLSAVLFPTLRGKVYGAYVHGFFHLSNRIMLGKKLAALLFHKDLYDEFVAFAKYAEPLGSRIEYERYFTTRMPKAPMLRMVYPVITHQDNIRKDWYHSGRSVKKKWWKEEEADLTKDVSNRFYAKRYMLQAWDRLEKTSISKK
>NZ_CP047393.1|WP_160101630.1|2091277_2091871_+|Holliday-junction-resolvase-RecU
MNYPNGKKTNNNAVTNRKPKQKPDFSNRGMTLEEDINQSNQAYLTSGRAVIHKKPTPVQIVNVDYPKRSAAVIKEAYFKQASTTDYNGIYRGKYIDFEAKETRNKTSFPLANIHEHQVEHMKKVCEQDGVCFAILRFSQLEETYFFPAEKLFQHWDRQNNGGRKSIPYQTIQQEGHFIQLQYHIRVDYLSVIDEMYF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP047393_1	1.1\|878637\|28\|NZ_CP047393\|CRISPRCasFinder	878637-878664	28	NZ_CP017256	Clostridium taeniosporum strain 1/k plasmid pCt3, complete sequence	17696-17723	7	0.75
NZ_CP047393_1	1.1\|878637\|28\|NZ_CP047393\|CRISPRCasFinder	878637-878664	28	MH029531	Gokushovirinae environmental samples clone NHS-Seq447, complete sequence	1501-1528	7	0.75

1. spacer 1.1|878637|28|NZ_CP047393|CRISPRCasFinder matches to NZ_CP017256 (Clostridium taeniosporum strain 1/k plasmid pCt3, complete sequence) position: , mismatch: 7, identity: 0.75

agctcttccacatattcattttaaggtg	CRISPR spacer
atttcttccacatattgattttaacaat	Protospacer
* .************* ******* .

2. spacer 1.1|878637|28|NZ_CP047393|CRISPRCasFinder matches to MH029531 (Gokushovirinae environmental samples clone NHS-Seq447, complete sequence) position: , mismatch: 7, identity: 0.75

agctcttccacatattcattttaaggtg	CRISPR spacer
tcctcttccacatattcagattaagaac	Protospacer
  ****************  *****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

305615 : 354934

Bacillus_phage(23.08%)

tRNA,protease,integrase

attL 321326:321346|attR 374639:374659

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160104488.1\|305615_306074_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_160098536.1\|306070_306766_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_160104489.1\|306771_307218_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_160098538.1\|307214_308231_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.6e-66	41.9
WP_160098540.1\|308499_309540_-	ribonucleotide-diphosphate reductase subunit beta	A0A127AVZ3	Bacillus_phage	1.3e-125	64.0
WP_160098542.1\|309555_311793_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0Y0AS84	Bacillus_phage	3.0e-297	66.2
WP_160098544.1\|312272_314204_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	8.1e-57	29.4
WP_160098546.1\|314485_314965_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_160104490.1\|314984_315650_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_160098548.1\|315808_317218_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_160098550.1\|317365_317905_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_160104491.1\|318002_318212_-	DUF4305 domain-containing protein	NA	NA	NA	NA
WP_160098552.1\|318217_318922_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160098554.1\|319294_319579_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	3.9e-16	49.5
WP_160098556.1\|319640_321275_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.4e-155	55.7
321326:321346	attL	NA	NA	NA	NA
WP_027447339.1\|321356_322568_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	1.3e-113	53.2
WP_160098558.1\|323057_330185_+	DNRLRE domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	2.6e-07	33.3
WP_160098560.1\|330200_330599_+	hypothetical protein	NA	NA	NA	NA
WP_160098562.1\|332079_333750_+	hypothetical protein	NA	NA	NA	NA
WP_160098564.1\|333815_334418_+	hypothetical protein	NA	NA	NA	NA
WP_160098566.1\|335071_335986_+	hypothetical protein	NA	NA	NA	NA
WP_027447685.1\|336212_336419_+	hypothetical protein	NA	NA	NA	NA
WP_027447683.1\|337108_337951_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	2.2e-27	30.0
WP_027447682.1\|338073_338535_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_027447681.1\|338552_339059_+	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_027447680.1\|339220_339436_+	hypothetical protein	NA	NA	NA	NA
WP_036843975.1\|339524_340178_+	hypothetical protein	NA	NA	NA	NA
WP_027447694.1\|340442_340919_+	hypothetical protein	NA	NA	NA	NA
WP_027447695.1\|341227_341971_+	hypothetical protein	NA	NA	NA	NA
WP_160098568.1\|342355_342784_+	hypothetical protein	NA	NA	NA	NA
WP_036843669.1\|342984_343407_+	hypothetical protein	NA	NA	NA	NA
WP_027447697.1\|343655_343862_+	hypothetical protein	NA	NA	NA	NA
WP_027447698.1\|344034_345084_-	DUF4030 domain-containing protein	NA	NA	NA	NA
WP_027447699.1\|345073_345604_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_027447700.1\|346028_346481_+	hypothetical protein	NA	NA	NA	NA
WP_027447701.1\|346808_347294_+	HIT domain-containing protein	NA	NA	NA	NA
WP_027447702.1\|347325_347787_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_027447703.1\|347833_348436_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_027447704.1\|348480_349137_+	phosphoribulokinase	L7RCC2	Acanthamoeba_polyphaga_moumouvirus	4.2e-05	26.9
WP_036842025.1\|349355_349628_+	hypothetical protein	NA	NA	NA	NA
WP_027446303.1\|349852_351067_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	2.3e-113	52.7
WP_027446304.1\|351333_351567_-	helix-turn-helix domain-containing protein	A0A0C5AN65	Paenibacillus_phage	1.1e-11	56.2
WP_027446305.1\|352223_353798_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_027446306.1\|353773_354934_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.0e-10	22.8
374639:374659	attR	NA	NA	NA	NA

DBSCAN-SWA_2

449650 : 459668

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160098691.1\|449650_450142_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.3e-23	45.0
WP_160098693.1\|450128_451274_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_160098695.1\|451279_451999_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4R1E8	Synechococcus_phage	5.0e-36	40.4
WP_160098697.1\|451991_452243_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_160098699.1\|452239_452923_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_160098701.1\|452906_455132_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-143	38.6
WP_160098703.1\|455107_456520_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.3e-51	31.6
WP_160098705.1\|456532_457555_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.4e-71	47.9
WP_160098707.1\|457551_458157_+	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_160098709.1\|458129_459668_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.1e-77	52.5

DBSCAN-SWA_3

2107168 : 2157358

Bacillus_phage(22.22%)

coat,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160101655.1\|2107168_2108371_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.7e-44	49.8
WP_160101657.1\|2108383_2109523_-	N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA	NA	NA	NA	NA
WP_160101659.1\|2109527_2109941_-	methylglyoxal synthase	NA	NA	NA	NA
WP_160101661.1\|2109955_2110756_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_160104596.1\|2110748_2111108_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_160101663.1\|2111332_2112217_+	DUF2179 domain-containing protein	M1Q1P6	Streptococcus_phage	3.7e-65	43.7
WP_160101665.1\|2112632_2112791_+	hypothetical protein	NA	NA	NA	NA
WP_160101667.1\|2113185_2113869_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_160101669.1\|2113941_2114736_-	hypothetical protein	NA	NA	NA	NA
WP_160104597.1\|2114802_2115390_-	DUF1405 domain-containing protein	NA	NA	NA	NA
WP_160101671.1\|2115486_2116260_-	c-type cytochrome	NA	NA	NA	NA
WP_160101673.1\|2116294_2116969_-	cytochrome b6	NA	NA	NA	NA
WP_160101675.1\|2116972_2117488_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_160101677.1\|2117621_2118089_-	DUF2487 family protein	NA	NA	NA	NA
WP_081673029.1\|2118218_2118767_-	YpiB family protein	G3MAV7	Bacillus_virus	7.4e-40	48.0
WP_160101679.1\|2118814_2120071_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_160101681.1\|2120083_2120962_-	hypothetical protein	NA	NA	NA	NA
WP_160101683.1\|2121017_2122316_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_160101685.1\|2122345_2123446_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	6.8e-24	28.2
WP_160101687.1\|2123527_2124616_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_160101689.1\|2124615_2125782_-	chorismate synthase	A0A291AU41	Pandoravirus	9.6e-45	35.4
WP_160101691.1\|2125899_2126673_-	methyltransferase	NA	NA	NA	NA
WP_027447430.1\|2126802_2127249_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	6.3e-29	45.8
WP_160101693.1\|2127345_2128323_-	heptaprenyl diphosphate synthase component II	NA	NA	NA	NA
WP_160101695.1\|2128334_2129066_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_160101697.1\|2129069_2129867_-	heptaprenyl diphosphate synthase component 1	NA	NA	NA	NA
WP_027447426.1\|2130188_2130422_-	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_036843149.1\|2130533_2130806_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	2.5e-28	74.4
WP_160101699.1\|2131280_2132759_-	stage IV sporulation protein A	NA	NA	NA	NA
WP_160101701.1\|2133009_2133732_-	hypothetical protein	NA	NA	NA	NA
WP_160101703.1\|2133753_2133951_-	DUF2768 family protein	NA	NA	NA	NA
WP_160101705.1\|2134912_2135167_-	stage VI sporulation protein F	NA	NA	NA	NA
WP_160101707.1\|2135356_2136379_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_160101709.1\|2136394_2137705_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_160101711.1\|2137899_2138502_-	hypothetical protein	NA	NA	NA	NA
WP_160101713.1\|2138610_2138745_+	YpzI family protein	NA	NA	NA	NA
WP_160101715.1\|2138833_2139865_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_160104598.1\|2139880_2141008_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_160101717.1\|2141115_2141697_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_160101719.1\|2141709_2142384_-	(d)CMP kinase	NA	NA	NA	NA
WP_160101721.1\|2142531_2142732_-	hypothetical protein	NA	NA	NA	NA
WP_160101723.1\|2142788_2143454_-	pilus assembly protein PilZ	NA	NA	NA	NA
WP_160101725.1\|2143589_2144927_-	germination protein YpeB	NA	NA	NA	NA
WP_160101727.1\|2144945_2145767_-	spore cortex-lytic enzyme	A0A172JHR8	Bacillus_phage	5.6e-23	44.2
WP_160101729.1\|2146532_2147222_-\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_160101731.1\|2147312_2148281_+	asparaginase	NA	NA	NA	NA
WP_160101733.1\|2148439_2149417_-	YpdA family putative bacillithiol disulfide reductase	NA	NA	NA	NA
WP_160101735.1\|2149516_2150797_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_160101737.1\|2151175_2151757_-	genetic competence negative regulator	NA	NA	NA	NA
WP_160101739.1\|2151870_2152779_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	8.1e-07	39.1
WP_160101741.1\|2152872_2153607_-	metallophosphoesterase	NA	NA	NA	NA
WP_160101743.1\|2153607_2153991_-	hypothetical protein	NA	NA	NA	NA
WP_160101745.1\|2154049_2154682_-	CBS domain-containing protein	NA	NA	NA	NA
WP_160101747.1\|2154848_2155064_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_160101749.1\|2155060_2155324_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_160101752.1\|2155371_2155941_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_160101755.1\|2156109_2156772_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_160101758.1\|2156776_2157358_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

3224680 : 3232676

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081672930.1\|3224680_3225292_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.8e-55	56.4
WP_160104670.1\|3225346_3226120_-	ABC transporter permease	NA	NA	NA	NA
WP_160103627.1\|3226119_3227073_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-18	31.8
WP_160103629.1\|3227388_3227643_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_160103631.1\|3227800_3228748_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	2.3e-52	38.2
WP_160103633.1\|3228801_3229779_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	4.7e-53	35.1
WP_160103635.1\|3229782_3230667_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.3e-06	28.8
WP_160103637.1\|3230681_3231155_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_160103639.1\|3231728_3232676_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	9.7e-88	53.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047393

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection