CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045254	Pseudomonas sp. DTU12.1 chromosome, complete genome	1 crisprs	DEDDh,DinG,csa3,cas3,WYL,PD-DExK,PrimPol	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045254_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045254_1

1154468-1154552

Orphan

Consensus_repeat	Method
GTGGAGCGGGGGCTTGTTGTGGAGAGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045254_1

>merge|NZ_CP045254|1|1154468-1154552|CRISPRCasFinder
GTGGAGCGGGGGCTTGTTGTGGAGAGGGGGACTTATTGTGAAGGGGAGACTTATTGTGGAGAGAGGGCTTGTTGTGGAGAGGGGG

>NZ_CP045254|1|1|1154468-1154552|CRISPRCasFinder
GTGGAGCGGGGGCTTGTTGTGGAGAGGGGG	ACTTATTGTGAAGGGGAGACTTATT
GTGGAGAGAGGGCTTGTTGTGGAGAGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045254.1\|WP_159906464.1\|1146568_1147852_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP045254.1\|WP_029295795.1\|1156778_1157453_-\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_CP045254.1\|WP_159906467.1\|1151295_1154445_+\|CusA/CzcA-family-heavy-metal-efflux-RND-transporter	unknown	unknown	gnl\|CDD\|129992
NZ_CP045254.1\|WP_159906463.1\|1144589_1144931_+\|DUF86-domain-containing-protein	unknown	unknown	gnl\|CDD\|225236
NZ_CP045254.1\|WP_159906469.1\|1162980_1164381_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP045254.1\|WP_104911585.1\|1158057_1159386_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP045254.1\|WP_029295815.1\|1144302_1144593_+\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224583
NZ_CP045254.1\|WP_092233447.1\|1162001_1162886_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP045254.1\|WP_159906468.1\|1155375_1156782_-\|heavy-metal-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|273593
NZ_CP045254.1\|WP_029295784.1\|1161413_1161929_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP045254.1\|WP_092233417.1\|1142176_1142701_-\|SET-domain-containing-protein-lysine-N-methyltransferase	unknown	unknown	gnl\|CDD\|380949
NZ_CP045254.1\|WP_092233420.1\|1142870_1144040_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045254.1\|WP_159906465.1\|1148872_1150096_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP045254.1\|WP_070996734.1\|1164488_1165298_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367029
NZ_CP045254.1\|WP_029295806.1\|1148015_1148690_-\|heavy-metal-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|130454
NZ_CP045254.1\|WP_070996730.1\|1160080_1161397_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP045254.1\|WP_159906466.1\|1150113_1151277_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273386
NZ_CP045254.1\|WP_029295811.1\|1144968_1146387_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP045254.1\|WP_029295788.1\|1159643_1159976_+\|DUF2790-domain-containing-protein	unknown	unknown	gnl\|CDD\|371321
NZ_CP045254.1\|WP_029295793.1\|1157688_1157883_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182802

Protein	Function_ID	Function_description	E-value
NZ_CP045254.1\|WP_159906464.1\|1146568_1147852_+\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.60641e-77
NZ_CP045254.1\|WP_029295795.1\|1156778_1157453_-\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	4.61946e-124
NZ_CP045254.1\|WP_159906467.1\|1151295_1154445_+\|CusA/CzcA-family-heavy-metal-efflux-RND-transporter	gnl\|CDD\|129992	TIGR00914, Nickel-cobalt-cadmium_resistance_protein_NccA, heavy metal efflux pump, CzcA family. This model represents a family of H+/heavy metal cation antiporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Detoxification, Transport and binding proteins, Cations and iron carrying compounds].	0
NZ_CP045254.1\|WP_159906463.1\|1144589_1144931_+\|DUF86-domain-containing-protein	gnl\|CDD\|225236	COG2361, COG2361, Uncharacterized conserved protein [Function unknown].	2.66326e-38
NZ_CP045254.1\|WP_159906469.1\|1162980_1164381_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.57432e-44
NZ_CP045254.1\|WP_104911585.1\|1158057_1159386_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	0
NZ_CP045254.1\|WP_029295815.1\|1144302_1144593_+\|nucleotidyltransferase-family-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	8.76248e-27
NZ_CP045254.1\|WP_159906468.1\|1155375_1156782_-\|heavy-metal-sensor-histidine-kinase	gnl\|CDD\|273593	TIGR01386, Probable_sensor_protein_PcoS, heavy metal sensor kinase. Members of this family contain a sensor histidine kinase domain (pfam00512) and a domain found in bacterial signal proteins (pfam00672). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc.	4.29213e-125
NZ_CP045254.1\|WP_029295784.1\|1161413_1161929_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.02779e-21
NZ_CP045254.1\|WP_092233417.1\|1142176_1142701_-\|SET-domain-containing-protein-lysine-N-methyltransferase	gnl\|CDD\|380949	cd19172, SET_SETD2, SET domain (including post-SET domain) found in SET domain-containing protein 2 (SETD2) and similar proteins. SETD2 (also termed HIF-1, huntingtin yeast partner B, huntingtin-interacting protein 1 (HIP-1), huntingtin-interacting protein B, lysine N-methyltransferase 3A or protein-lysine N-methyltransferase SETD2) acts as histone-lysine N-methyltransferase that specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using demethylated 'Lys-36' (H3K36me2) as substrate. It has been shown that methylation is a posttranslational modification of dynamic microtubules and that SETD2 methylates alpha-tubulin at lysine 40, the same lysine that is marked by acetylation on microtubules. Methylation of microtubules occurs during mitosis and cytokinesis and can be ablated by SETD2 deletion, which causes mitotic spindle and cytokinesis defects, micronuclei, and polyploidy.	5.97572e-09
NZ_CP045254.1\|WP_092233447.1\|1162001_1162886_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.21873e-77
NZ_CP045254.1\|WP_159906465.1\|1148872_1150096_+\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	6.33813e-38
NZ_CP045254.1\|WP_070996734.1\|1164488_1165298_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|367029	pfam02311, AraC_binding, AraC-like ligand binding domain. This family represents the arabinose-binding and dimerization domain of the bacterial gene regulatory protein AraC. The domain is found in conjunction with the helix-turn-helix (HTH) DNA-binding motif pfam00165. This domain is distantly related to the Cupin domain pfam00190.	2.67745e-23
NZ_CP045254.1\|WP_029295806.1\|1148015_1148690_-\|heavy-metal-response-regulator-transcription-factor	gnl\|CDD\|130454	TIGR01387, Transcriptional_regulatory_protein_PcoR, heavy metal response regulator. Members of this family contain a response regulator receiver domain (pfam00072) and an associated transcriptional regulatory region (pfam00486). This group is separated phylogenetically from related proteins with similar architecture and contains a number of proteins associated with heavy metal resistance efflux systems for copper, silver, cadmium, and/or zinc. Most members encoded by genes adjacent to genes for encoding a member of the heavy metal sensor histidine kinase family (TIGRFAMs:TIGR01386), its partner in the two-component response regulator system. [Regulatory functions, DNA interactions].	3.1864e-115
NZ_CP045254.1\|WP_070996730.1\|1160080_1161397_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	7.29784e-43
NZ_CP045254.1\|WP_159906466.1\|1150113_1151277_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273386	TIGR00999, Nickel-cobalt-cadmium_resistance_protein_NccB, Membrane Fusion Protein cluster 2 (function with RND porters). [Transport and binding proteins, Other].	3.74317e-60
NZ_CP045254.1\|WP_029295811.1\|1144968_1146387_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	2.77624e-168
NZ_CP045254.1\|WP_029295788.1\|1159643_1159976_+\|DUF2790-domain-containing-protein	gnl\|CDD\|371321	pfam10976, DUF2790, Protein of unknown function (DUF2790). This family of proteins with unknown function appear to be restricted to Pseudomonadaceae.	2.2503e-28
NZ_CP045254.1\|WP_029295793.1\|1157688_1157883_-\|hypothetical-protein	gnl\|CDD\|182802	PRK10877, PRK10877, protein disulfide isomerase II DsbC; Provisional.	0.00111666

>NZ_CP045254.1|WP_159906467.1|1151295_1154445_+|CusA/CzcA-family-heavy-metal-efflux-RND-transporter
MFERLIQFAIEQRIIVLLAVLLMAGVGIASYQKLPIDAVPDITNVQVQINSAAPGFSPLETEQRITFPIETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTDLFFARQLVNERLQVAREQLPDGIETAMGPISTGLGEIFLWTVEAEEGARKEDGSAYTPTDLRVIQDWIIKPQLRNVPGVAEINTIGGFAKEYQIAPDPKRLAAYNLTLSDLVTALERNNANVGAGYIERSGEQLLIRAPGQVASIDDIANIVINTVDGTPIRVRNVAQVDIGRELRTGAATENGREVVLGTVFMLIGENSRSVSRAVAKKLEEINRSLPEGVVAVTVYDRTNLVEKAIATVKKNLFEGALLVIVILFLFLGNIRAALITAMVIPLAMLFTFTGMFTNKVSANLMSLGALDFGIIVDGAVVIVENAIRRLAHAQQRHGRLLTRSERLHEVFAAAKEARRALIFGQLIIMVVYLPIFALTGVAGKMFHPMAFTVVMALLGAMILSVTFVPAAIALFVTGKVKEDENWVMRNARRGYAPVLDWVMAHRSWAFGLALLTIVMSGAVASRMGSEFIPSLSEGDFALQALRVPGTSLTQSVQMQQQLEKTLMAQVPEIQRVFARTGTAEIASDPMPPNISDAYLMLKPREQWPDPKKSREALIADIQRASAIVPGSQYELSQPIQLRFNELISGVRSDVAVKVFGDDRDVLNNTAGEIAETLRKLDGASELKVEQTSGLPVLTINIDRDKAARFGLNVGDVQDTIAVAVGGRQAGTMYEGDRRFDMVVRLSETLRTDIEGLSRLLIPIPALAGNTTGQLSFIALSQVASLDLVLGPNQISRENGKRLVIVSANVRGRDIGSFVAEAERVMAEQVKIPAGYWTTWGGQFEQLKEASERLQIVVPVALLLVFGLLFMMFNNLKDGLLVFTGIPFALTGGIMALWLRDIPLSISAGVGFIALSGVAVLNGLVMIAFIRNLREEGRSLSVAINEGALTRLRPVLMTALVASLGFIPMALATGTGAEVQRPLATVVIGGIISSTLLTLLVLPALYHWAHRRDEEPVAS
>NZ_CP045254.1|WP_159906466.1|1150113_1151277_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MNKQQGLALAVAAAIALAAMVFWPATSVAPQAPVASVKAPEAEEEEGVLVLNEQQIQAAGIQLAKAQPRQISTLLSLPGEVRFDEDRTSHIVPRAAGVVESVKVNLGQKVKQGELLAVIASQQISDQRSELAASQRRVELARTTFQRERQLWQDKISAEQDYLLARQSLQEAEIALNNARQKMNALSGSAVLVGGNRYELRAPFAGVVVEKHLGVGEVVSETSAAFTLSDLSQVWVTFGVFPKDLNKVQVGRPVKVSSAEMGTDVMGTVAYVGNLLGEQTRTATVRVSVANPDDSWRPGLFVAVQVATDSYPAPVTVPVEAIQTVEDKPSLFVRTAEGFVTRHVELGVSENGFVEVRQGLEAGAEVATVGSFVLKSELGKASAEHAH
>NZ_CP045254.1|WP_159906465.1|1148872_1150096_+|TolC-family-protein
MPMFSRTIVCSVVGLLAMAQVASAQTLTLESALQSAFAGNPDLAAAQWEIDIAQGGRQQAGLIPNPVASWDAEDTRRSTRTTTVKLSQTLELGGKRGARIEVASRAQEAAAQELEQRRNLLRAEVIDGFYGALWAQERLELAQRSMALAERGLVIANGRVTAGKASPVEATRAQVEVSQIRLERSRAEIGVSDAYRRLAAITGSSTIGFERVEAGAVNTPALPSATQLLARLESTAELRLAQLQIQQRDAGLGLEKAQRIPDLDVSIGSQYDASVRERVNLVGVSMPIPLFNRNQGNVLAASRRADQARDLRNATELRLRTETRQALDLWATANSEVRAFNQVILPAAQSAVDSATRGFEMGKFNFLDVLDAQRTLIAARTQYLAALAQATDAWVRIERIYGDLARI
>NZ_CP045254.1|WP_029295806.1|1148015_1148690_-|heavy-metal-response-regulator-transcription-factor
MRILVIEDELKTAEYLHQGLSESGYVVDCAASGADGVHLARQHAYDLVILDVNLPLMDGWDVLQRIRQTSNTRIMMLTAHGRLADKIKGLELGADDYLVKPFEFPELLARVRTLMRRSVEAAVPDVLRVGDLELDQGRHRAFRGSQRIDLTTKEFALLHLLMRQSGVVLSRTQIISFVWDMNFDCDTNVVEVSIRRLRAKIDDPFERKLIHTLRGVGYVLEERE
>NZ_CP045254.1|WP_159906464.1|1146568_1147852_+|MFS-transporter
MTATAYPQAQRFSRSDYKTLGLAALGGALEIYDFIIFVFFALTLSQLFFPPEMPEWLRLLQSFGIFVTGYLARPLGGILMAHFADHLGRKRVFSLSILMMALPCLLIGIMPTYAQIGYFAPLILLALRVLQGAAVGGEVPSAWVFVAEHAPANHRGYALGFLQAGLTFGYLLGALTATLLAQMFTAEQILDYAWRFPFLLGGVFGVIGVWLRRWLSETPVFLAMQARRQADAELPLRTVLRDHRQALLPAMLLTCVLTSAVVVLVVITPTMMQKTFGMSPSHTFALSALGIVFLNIGCVLAGLLVDRIGAWRAVLVYSLLLPVGIAVLYASLIAGGVWLGAAYAIAGLSCGVVGAVPSVMVSLFPAPVRVSGISFTYNIAYALWASTTPLMLIALMPTSPWICVFYCMAMGAVGVASAVRFANRPVF
>NZ_CP045254.1|WP_029295811.1|1144968_1146387_-|short-chain-fatty-acid-transporter
MADPIEESRYARFALRCSNFAERWFPDSWVFAALAVIIVAVAALGMGAAPTDAAKAFGDGFWSLIPFTMQMAFVVIGGYVVASSPPAVKLIDRLARIPKNGRSAVAWVALISMVASLLNWGLSLVFGGLLVRALARRTDLRMDYRAAGAAAYLGLGAVWALGLSSSAAQLQANPASLPPSILAITGTIPFTDTIFLWQSGVLLLALIVVSLVIAYVTAPGPNSARDAKACGVDPAFNLPKPQPPSRPGEWLEHSPLLTILLALLAAGWLFHEFSTKPAISAISGLNTYNFLFIMVGALLHWRPRSFLDAVARAVPTTTGVLIQFPLYGSIAALMTVVKGGDGQTLAHHISTFFTSIASHDTYALLMGVYSAVLGFFIPSGGGKWIIEAPYVMQVANDLQYHLGWAVQIYNAAEALPNLINPFYMLPLLGVLGLKARDLIGFSFVQLLVHTPLVLFLLWALGTTLKYMPPVMP
>NZ_CP045254.1|WP_159906463.1|1144589_1144931_+|DUF86-domain-containing-protein
MTKRLGDYLGHMRQASSDAIIFVEGLSKSEFFEDKRTQQAVIMSLIIIGEASTKIMDQYPDFTAGQPQVPWRSMRGMRNRIAHGYFEINLEVVWDTVQHALPALLNQLSDTPT
>NZ_CP045254.1|WP_029295815.1|1144302_1144593_+|nucleotidyltransferase-family-protein
MKPSIALDLKRAAVREVVGRFHISNPRVFGSVLLGTDKEGSDLDLLVDAPPGTTLFDLGGLQDELQDLLGVNVDLLTPGDLPLKFRAQVLAEARPV
>NZ_CP045254.1|WP_092233420.1|1142870_1144040_-|hypothetical-protein
MFKLTRLSFTFVALTVSTVVHADVELDLGTVQRVRQLFAYPNNCSVICFRPLTLEQTVEHYLTQSLHRDGYSRARVSVKTQQDQVRAHFTGVPDGYGQPLTALLDTADLAYDGAHRLNHDGKWQFSWYLFLPLGMALENRKSIELMHFPPDYSLTHYQDYLESATTDRWATLLTANGIAAAQTPEYQTIIDIAPIAAPSTAGKDLEGVYGYFTEYQTRIVRELSLHPSGSLPMVAFGAPVRSWIQQQYGQTLGVLGLGQISPAEGSSVAVLGANHPSYIWYAANPDSYDGDEQKADDAGLKVMGQDLSAACWQAGMGQKPASDPNVLLKGCMNTWQVTRKEQTCELFYTSIRELSADHAREKCATATIKTQLKRLKSPLPEASVPAPAL
>NZ_CP045254.1|WP_092233417.1|1142176_1142701_-|SET-domain-containing-protein-lysine-N-methyltransferase
MKTQVMEDAPADAIDCIYPFANLLAKKGYPSPRQFEVVSTRNGRGTGIKTRVAFDSRIRIAKISGYALGERHLHTLQISSRIHLYDPWFSGLLLHSCDPNVFLDISELELWSIQAIRPGTLLTMDYATTEDVLFRQFACRCGAGNCRGWITGAKEPLNPQGQLFMEQWRQRKRY
>NZ_CP045254.1|WP_159906468.1|1155375_1156782_-|heavy-metal-sensor-histidine-kinase
MRTGSLSMRLGLTVSLMGAGLVLLLASLAYLALTHELENLARKGLESKMEQIQHSLLQDLNTRDISARPHSLLDLVMGHDNFYLTIIGPAPANAVLLSVGARPQEPLLLDFAARQTLGFLNWTDGRDNQILSASSLMRLHTGENVRVLLSLDRSDDQALLSAYLQSTVIALPLLLILIGMGAWWLVQRGLAPLQQFSRVAAKVTTQDLSHRLAVDNLPRELNELARGINVMLDRLDAGVQQLSQFSDDLAHELRAPLTNLMGKAQVTLSRARAPDEYKSALESSTEELDRLARIVADMLFLAQVSHPAARASFTAVNLRDEALRVMELFALSAEDKALKLSQAGDAWVLGDRLMIQRAISNLLSNAIRHSPHGSRISLQVDTHHQRVSLTVSNPGTGIEAQHLPHLFERFYRADNSRARTEGGTGLGLAIVRSIMSLHQGQAEANCVPGDVTQFRLIFPTLSATPQVP
>NZ_CP045254.1|WP_029295795.1|1156778_1157453_-|heavy-metal-response-regulator-transcription-factor
MRILVVEDEPKTADYLHQGLSESGYVVDCAASGIDGLHLAGQHRYELVILDVNLPGQDGWQVLQQLRRDNTLRVMMLTARGRLADKIKGLDMGADDYLVKPFEFPELLARVRSLLRRSEPIALPEILRVADLELDPRRHRAYRGTRRIDLTTKEFALLQVLMRQSGEVLTRTQIISLVWDMNFDCDTNVVEVSISRLRAKVDDQSEVKLIHTIRGVGYVLETRQ
>NZ_CP045254.1|WP_029295793.1|1157688_1157883_-|hypothetical-protein
MKPLHILFSVLISAASTAALADDGGDRSRQWLAEFRQQQQQIHGSQAVAEQNPAPSDTSAPTAI
>NZ_CP045254.1|WP_104911585.1|1158057_1159386_-|OprD-family-porin
MRTNRTLSLSIIAALASATPLAGMAAEDKPEGFIEGSTLNVLARNFYFNRDDRKGQSSPTGNGYSEAWAQGLIGKFESGFTQGTVGFGLDAFAMYGLKLDSGTGRSGGRGSFDMLPVDSDNRPEDDYSKLGGAVKMRLLDTVVKVGDVFPQTPVVHYGDSRLLPESFRGVTLENTSLEGLTLQGGRLHAMSQPTQSGMREGFATFYAGNVNAPWVGYFGGDYQANQHWSLSLYSSRLKDAWDQYYFGTAVNYPLTDEVAMFAGFNYYNAQDEGKRLLGELNNNIWSAKLGVKVGAHRLALSHQRNNGNDDFDYLRQSDSIFLDNSIQYSDFNSPKERSWALRYDLDMQTLGIPGLSFMTRYGKGTGADYSNANSVYMRRDALGDPLTDQRRWERDIEAKYVFQGGSLKDLSIRIRQATVRSSAFESDLEELRLIMEYPLAIL
>NZ_CP045254.1|WP_029295788.1|1159643_1159976_+|DUF2790-domain-containing-protein
MKHLTRALGVVVFSLSMGAMAEGGGDRAMAQLMQKNQEAMARYATAQGKPVPEVQAYRYGMKLDIARVVNVTPPVRTCKVVPSRMTYEDSSGQLKTLEYQVLGLCRNNGS
>NZ_CP045254.1|WP_070996730.1|1160080_1161397_+|methyl-accepting-chemotaxis-protein
MFNTRLKQELSALREELSSLQQVKESLESEMLALSLDPEGRIESVNQNFLDEMFYKSSDLLGHAIHGFVPEHVKRDEFQQRFANALSRGEHFAGTVRLLRGNGKEAWLRSIVQPVRSADGRIKRFSVYSSDLTRTIEASREHENLITALVRSTAVIEFDLNGNVLGANERFLQGMGYSLAQIQGKHHRMFCEPQDYNSADYQAFWKRLNSGEFVAGRFKRVDAHGREVWLEASYNPVLDANDRLYKVVKFATVITDQINQERAVAEAANIAYSTSLHTDSSAQRGTAVVTQAVEVMRDLAKHMEQAGEGIEALNAQSQVIGTIVKTISGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRQLASRTSKATEEIVGVVRQNQDMARDAVALMTDGRLQAEQGLSLAAEAGTVIVEIQDGAQKVVSAVGQFANQLST
>NZ_CP045254.1|WP_029295784.1|1161413_1161929_-|GNAT-family-N-acetyltransferase
MNLTLTPPQWDDVNELLAFELANRDFFESWINARPEAYYSVEGVQRAIESALLEASEDRAYQYLIRENGVLVGRINFTQVRRRYYHSASLGYRMGAQFTGRGLARQAVALGLQKAFGEHALKRIEATVRPQNPGSLRVLQRNGFTQYGHSRKAFLLDGQWFDLLLFEVHAP
>NZ_CP045254.1|WP_092233447.1|1162001_1162886_-|LysR-family-transcriptional-regulator
MDLNAVRLLVRVAETRSFTRAAGDLGLTQSGLSRAISRLEAELGVRLLQRNTRSVSLTPDGQMLYERSAPLLAELAETEKLLLDRRSTPSGLLKISTPSLFGRKVVMPVIGELTLRYPELRIEAVMTDRLVDIVDEGFDALLRTGEIQDQRLIARALTPLRWVTVASPAYLARFGTPQTVEELHDHSCLTVRNLRSGRMVDWQFMLDGKVRDVSVEGRLIFDIGDALVDGAVGGFGIAQVMDFAVRDDLAAGRLVPILESFAGRSRAISLVYPPSRQYSPKLIAFADALAQAQW
>NZ_CP045254.1|WP_159906469.1|1162980_1164381_+|MFS-transporter
MPALPSSRPSGWMLMLLATAQLIIALDATIVFVALPQIGSHLGFSAQQLQWVVSAYTVAFGGFLLLGGRATDLLGKRRMYRVGQSMYALSSLAAVLGGSALLLVLARAVQGVGGALLFPATLALINTHYAQGPQRNRAFAVWSAASAAGLALGALLGGVLTQWWGWEAVFLVNVPLAGGCALAARYWIPADGERSRGRSFDVSGALTVTVGGTLLVFALVQGPEWGWAAPATLGCMLLALALLGLFAWIEHRGRDPLMPLRLLGYRELRMAMVLTAVFMSSFGVQYYFLALYYQQVYGYSVLQAGLAFLPATLVCTLGIWLAERALVKIGLRNTLVSGQLAGALGIALVCLALPTGVGFWSLLPGIFILSLGQGMTWTAMWVAAGLGVKPGEQGVAAGMASTTQQIGGALGLAVLVSLANAGGATGAAQAQGIELALWWSAGIALVGALVALRLRSSRPGPVLEVA
>NZ_CP045254.1|WP_070996734.1|1164488_1165298_-|AraC-family-transcriptional-regulator
MGKLTANIDWLHRAPHGSGLERIEAYFSGFGFDPHRHDTYAIGHTLFGVQSFHYRGSQTHSLPGTTMVIHPDEVHDGWAGSDEGFKYRMIYVEPALIQQVLGGKPLPFIHNGLSNDPWLHRACQAFVQQLDCPLDPMQEQDALFDLAHALNNASGISANRKTFDYQAAERAREFIHSALGRSITLDEMAAHCGRDRWALSRDFRLLFGTSPYRYLTMRRLDLVRNLLGQGQSLVDAALIAGFTDQSHMTRQFRSTFGIPPSRWVKMLGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1551821 : 1558011

uncultured_Mediterranean_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_092234024.1\|1551821_1552571_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.1e-65	51.4
WP_017529674.1\|1552570_1553248_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.1e-43	53.1
WP_159906675.1\|1553459_1554293_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	6.3e-06	33.3
WP_025855149.1\|1554398_1555403_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	1.3e-34	36.2
WP_002554837.1\|1555598_1555808_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.2e-16	66.7
WP_003219273.1\|1556200_1556767_+	dCTP deaminase	S5VM63	Pseudomonas_phage	3.3e-75	74.2
WP_029297182.1\|1556874_1557072_+	hypothetical protein	NA	NA	NA	NA
WP_133714113.1\|1557246_1558011_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.6e-16	30.2

DBSCAN-SWA_2

3642778 : 3700868

Pseudomonas_phage(58.7%)

lysis,tRNA,tail,terminase,head,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016964635.1\|3642778_3643258_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_159908057.1\|3643274_3644033_-	TSUP family transporter	NA	NA	NA	NA
WP_159909251.1\|3644037_3645123_-	taurine catabolism dioxygenase TauD	NA	NA	NA	NA
WP_133714816.1\|3645232_3646165_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_133714965.1\|3646266_3646392_-	DUF4113 domain-containing protein	NA	NA	NA	NA
WP_092239221.1\|3646472_3646769_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_159908059.1\|3646915_3647374_-	cupin domain-containing protein	NA	NA	NA	NA
WP_159908061.1\|3647665_3649009_-	MFS transporter	Q6JIH2	Burkholderia_virus	7.1e-60	35.3
WP_092239215.1\|3649180_3649753_+	PAS and helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_092239213.1\|3649963_3650353_-	hypothetical protein	NA	NA	NA	NA
WP_092239211.1\|3650349_3650865_-	hypothetical protein	NA	NA	NA	NA
WP_133714819.1\|3652079_3652379_+	hypothetical protein	NA	NA	NA	NA
WP_159908063.1\|3652639_3652804_-	hypothetical protein	NA	NA	NA	NA
WP_070996066.1\|3653620_3653968_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.5e-33	60.2
WP_070996065.1\|3653990_3655274_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	1.3e-167	72.1
WP_070996064.1\|3655302_3655773_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.9e-53	65.4
WP_070996063.1\|3655782_3656481_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-100	76.6
WP_070996062.1\|3656490_3657036_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	3.7e-55	64.5
WP_070996061.1\|3657422_3658538_-	two-component system response regulator	A0A220YL79	Alteromonas_virus	2.8e-09	29.1
WP_070996060.1\|3658530_3662472_-	response regulator	A0A1V0SGX0	Hokovirus	5.7e-57	25.2
WP_070996059.1\|3662944_3663151_+	hypothetical protein	A0A2D1GNR5	Pseudomonas_phage	1.8e-10	55.2
WP_070996058.1\|3663247_3663595_+	hypothetical protein	NA	NA	NA	NA
WP_070996057.1\|3663617_3664298_+	DUF159 family protein	A0A2H4J991	uncultured_Caudovirales_phage	1.9e-117	87.1
WP_070996056.1\|3664294_3665089_-	DNA adenine methylase	C7BGE1	Burkholderia_phage	1.4e-100	66.8
WP_070996055.1\|3665156_3665675_-\|lysis	lysis protein	A0A2H4IZW4	uncultured_Caudovirales_phage	1.8e-56	73.7
WP_070996054.1\|3665674_3666100_-	cell wall hydrolase	A0A2D1GNI1	Pseudomonas_phage	2.5e-75	92.9
WP_070996053.1\|3666160_3666376_-	hypothetical protein	NA	NA	NA	NA
WP_070996052.1\|3666444_3666699_-	hypothetical protein	C8ZKF3	Pseudomonas_phage	1.7e-15	54.8
WP_070996051.1\|3666695_3666995_-	hypothetical protein	A0A0A0YUD8	Pseudomonas_phage	6.1e-20	49.0
WP_159908066.1\|3666994_3667432_-	hypothetical protein	A0A0S2SY45	Pseudomonas_phage	8.6e-07	38.2
WP_070996050.1\|3667454_3668108_-	hypothetical protein	A0A2D1GNS6	Pseudomonas_phage	2.1e-73	60.1
WP_083335468.1\|3668433_3672999_-	DUF1983 domain-containing protein	A0A2H4J8Z6	uncultured_Caudovirales_phage	0.0e+00	57.0
WP_070996048.1\|3673056_3673635_-\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	1.8e-97	93.8
WP_070996047.1\|3673631_3674387_-	C40 family peptidase	A0A2H4J1J7	uncultured_Caudovirales_phage	7.6e-144	92.0
WP_159908068.1\|3674390_3675140_-\|tail	phage minor tail protein L	A0A2H4J4Q5	uncultured_Caudovirales_phage	3.8e-135	90.8
WP_070996045.1\|3675150_3675489_-\|tail	phage tail protein	A0A2H4JI07	uncultured_Caudovirales_phage	2.3e-60	95.5
WP_070996044.1\|3675491_3678785_-\|tail	phage tail tape measure protein	A0A2H4J9A1	uncultured_Caudovirales_phage	1.1e-133	41.8
WP_070996043.1\|3678837_3679248_-	hypothetical protein	NA	NA	NA	NA
WP_070996042.1\|3679268_3679691_-	hypothetical protein	A0A1B0VMH3	Pseudomonas_phage	1.9e-14	35.2
WP_070996041.1\|3679809_3680088_-	hypothetical protein	A0A0S2SY90	Pseudomonas_phage	1.0e-13	50.0
WP_032877397.1\|3680135_3680516_-	hypothetical protein	A0A2H4J9Y6	uncultured_Caudovirales_phage	5.7e-23	48.0
WP_070996040.1\|3680519_3681176_-\|tail	phage tail protein	A0A1B0VMG2	Pseudomonas_phage	1.0e-99	83.5
WP_070996039.1\|3681248_3681668_-	hypothetical protein	A0A1B0VMI0	Pseudomonas_phage	1.9e-51	72.8
WP_070996038.1\|3681664_3682321_-	hypothetical protein	A0A1B0VMI1	Pseudomonas_phage	7.1e-114	93.6
WP_070996037.1\|3682317_3682686_-	hypothetical protein	A0A1B0VRJ4	Pseudomonas_phage	1.8e-58	91.7
WP_070996036.1\|3682710_3683019_+	hypothetical protein	NA	NA	NA	NA
WP_070996035.1\|3683020_3683524_-	hypothetical protein	A0A1B0VND3	Pseudomonas_phage	2.2e-78	87.3
WP_083335467.1\|3683583_3684189_-	hypothetical protein	A0A1B0VMF7	Pseudomonas_phage	2.0e-62	66.5
WP_070996033.1\|3684215_3685181_-	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	4.7e-162	90.2
WP_029295015.1\|3685193_3685922_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	2.5e-120	93.4
WP_070996032.1\|3686002_3686371_-	hypothetical protein	NA	NA	NA	NA
WP_070996133.1\|3686403_3687495_-\|head	phage head morphogenesis protein	A0A1B0VMF3	Pseudomonas_phage	1.1e-186	93.1
WP_070996031.1\|3687469_3688888_-	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	4.2e-260	92.6
WP_070996030.1\|3688884_3690207_-\|terminase	terminase	A0A1B0VP58	Pseudomonas_phage	2.4e-265	98.9
WP_057959957.1\|3690181_3690658_-	DUF2280 domain-containing protein	A0A1B0VMH2	Pseudomonas_phage	8.9e-82	98.1
WP_154907500.1\|3690689_3691304_-	hypothetical protein	A0A1B0VRJ1	Pseudomonas_phage	3.1e-111	95.2
WP_154907498.1\|3691378_3691816_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_143007571.1\|3692147_3692480_+	hypothetical protein	NA	NA	NA	NA
WP_029294999.1\|3692584_3693031_+	hypothetical protein	NA	NA	NA	NA
WP_029294997.1\|3693083_3693419_-\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	2.0e-40	75.2
WP_070996027.1\|3694215_3695985_+	GGDEF and EAL domain-containing protein	NA	NA	NA	NA
WP_070996026.1\|3696053_3696599_-	hypothetical protein	A0A0H5AWB8	Pseudomonas_phage	3.0e-65	68.3
WP_070996025.1\|3696595_3697228_-	hypothetical protein	A0A0U1VZM0	Pseudomonas_phage	3.2e-63	62.0
WP_070996024.1\|3697224_3697740_-	hypothetical protein	NA	NA	NA	NA
WP_070996023.1\|3697736_3698534_-	hypothetical protein	A0A1B0VMD9	Pseudomonas_phage	3.7e-96	68.8
WP_070996022.1\|3698520_3699501_-	phage replication protein	A0A1B0VME0	Pseudomonas_phage	1.9e-115	74.5
WP_070996021.1\|3699825_3700026_-	hypothetical protein	A0A2K8HL98	Pseudomonas_phage	3.1e-12	57.6
WP_070996020.1\|3700130_3700868_+	peptidase S24	K7P7K3	Enterobacteria_phage	1.3e-50	48.1

DBSCAN-SWA_3

3705387 : 3710910

uncultured_Caudovirales_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070996012.1\|3705387_3705771_+	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	3.6e-25	60.4
WP_070996011.1\|3705846_3706143_-	cupin domain-containing protein	NA	NA	NA	NA
WP_070996010.1\|3706286_3706709_+	hypothetical protein	A0A2H4J9E7	uncultured_Caudovirales_phage	8.6e-36	60.7
WP_070996009.1\|3706705_3706897_+	hypothetical protein	NA	NA	NA	NA
WP_057959986.1\|3706893_3707085_+	hypothetical protein	NA	NA	NA	NA
WP_143007576.1\|3707418_3708024_+	hypothetical protein	A0A1B0VMB2	Pseudomonas_phage	9.1e-39	59.4
WP_070996007.1\|3708020_3709649_+	Heme peroxidase	A0A2H4J6P1	uncultured_Caudovirales_phage	1.5e-205	71.8
WP_070996006.1\|3709645_3709888_+	hypothetical protein	A0A2H4J1H1	uncultured_Caudovirales_phage	6.2e-23	77.5
WP_070996005.1\|3709884_3710355_+	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	1.0e-74	90.1
WP_070996004.1\|3710424_3710910_+	hypothetical protein	A0A1B0VMB5	Pseudomonas_phage	2.1e-70	84.4

DBSCAN-SWA_4

3714745 : 3727890

uncultured_Caudovirales_phage(60.0%)

tRNA,integrase

attL 3710938:3710951|attR 3723064:3723077

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3710938:3710951	attL	NA	NA	NA	NA
WP_159908078.1\|3714745_3715438_-	hypothetical protein	Q858S6	Enterobacteria_phage	8.9e-06	37.0
WP_159908080.1\|3715484_3715637_+	hypothetical protein	Q71TA0	Escherichia_phage	8.7e-07	78.1
WP_159909253.1\|3715666_3716767_+	HNH endonuclease	NA	NA	NA	NA
WP_159908082.1\|3716825_3716984_+	DUF4406 domain-containing protein	A0A068F2J4	Mycobacterium_phage	4.9e-05	50.0
WP_159908084.1\|3717276_3717591_+	hypothetical protein	A0A059VA44	Pseudomonas_phage	9.5e-48	75.0
WP_159908086.1\|3717587_3718298_+	morphogenetic protein	A0A077KCB2	Edwardsiella_phage	5.3e-62	52.0
WP_143007568.1\|3718294_3718561_+	hypothetical protein	NA	NA	NA	NA
WP_070995992.1\|3718955_3719186_+	hypothetical protein	A0A2H4J1L2	uncultured_Caudovirales_phage	4.0e-11	51.5
WP_159908088.1\|3719197_3719434_+	DUF4224 domain-containing protein	A0A2H4JF29	uncultured_Caudovirales_phage	7.4e-29	74.4
WP_159908090.1\|3719438_3720503_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	1.3e-149	77.2
WP_029293588.1\|3720874_3721546_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.9e-110	95.5
WP_133714899.1\|3721633_3722026_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.4e-56	84.6
WP_070995989.1\|3722027_3722378_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	6.2e-40	68.3
WP_092239110.1\|3722377_3722671_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.7e-28	64.6
WP_029293579.1\|3722667_3723003_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	7.2e-46	79.3
WP_104910383.1\|3722999_3724001_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	8.5e-167	86.9
3723064:3723077	attR	NA	NA	NA	NA
WP_159908092.1\|3724089_3725085_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_029293572.1\|3725214_3726609_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_029293570.1\|3726609_3727890_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.4e-97	53.0

DBSCAN-SWA_5

4810035 : 4850859

uncultured_Caudovirales_phage(28.57%)

lysis,tRNA,tail,holin,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029295351.1\|4810035_4811751_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_029295348.1\|4811771_4812725_+	hypothetical protein	NA	NA	NA	NA
WP_159908664.1\|4812753_4813812_-	DNA polymerase IV	NA	NA	NA	NA
WP_029295344.1\|4814806_4817449_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_029295343.1\|4817448_4818729_+	virulence factor family protein	NA	NA	NA	NA
WP_029295342.1\|4818802_4820704_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	4.1e-77	33.9
WP_029295337.1\|4821007_4822348_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_029295335.1\|4822451_4822922_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029295333.1\|4823347_4824058_+	RNA-binding protein S4	NA	NA	NA	NA
WP_029295331.1\|4824124_4824586_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.5e-38	51.3
WP_092237912.1\|4824589_4825285_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_003172178.1\|4825462_4826242_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_071610017.1\|4826307_4827294_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029295326.1\|4827290_4827653_-	diacylglycerol kinase	NA	NA	NA	NA
WP_029295324.1\|4827727_4828378_-	response regulator transcription factor	NA	NA	NA	NA
WP_070994808.1\|4828539_4829250_-	DTW domain-containing protein	NA	NA	NA	NA
WP_070994807.1\|4829443_4829878_+	hypothetical protein	NA	NA	NA	NA
WP_159908666.1\|4830151_4831264_+	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_159908668.1\|4831432_4831900_-	recombination regulator RecX	NA	NA	NA	NA
WP_029295312.1\|4831908_4832967_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.4e-111	62.4
WP_029295310.1\|4833050_4833551_-	CinA family protein	B5TK85	Pseudomonas_phage	3.0e-72	84.9
WP_159908670.1\|4833632_4834139_-\|lysis	lysis protein	B5TK84	Pseudomonas_phage	5.3e-32	50.6
WP_159909295.1\|4834129_4834678_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	1.6e-79	80.1
WP_029295299.1\|4834697_4835708_-	hypothetical protein	A0A2H4JH05	uncultured_Caudovirales_phage	3.1e-100	54.7
WP_070994803.1\|4835717_4835930_-\|tail	phage tail protein	A0A2H4JGD9	uncultured_Caudovirales_phage	3.6e-19	64.3
WP_029295297.1\|4835922_4836306_-\|tail	phage tail protein	B0ZSH2	Halomonas_phage	5.6e-34	56.7
WP_159908672.1\|4836305_4837670_-	hypothetical protein	NA	NA	NA	NA
WP_029295295.1\|4837798_4838365_-\|tail	phage tail assembly protein	B0ZSH0	Halomonas_phage	2.2e-26	36.6
WP_159908674.1\|4838535_4839042_-\|tail	phage tail protein	Q6R4W3	Vibrio_virus	6.5e-22	34.5
WP_029295293.1\|4839041_4840208_-\|tail	tail protein	B0ZSG8	Halomonas_phage	4.2e-125	57.2
WP_029295291.1\|4840210_4840414_-	hypothetical protein	NA	NA	NA	NA
WP_092237938.1\|4840506_4840779_-	hypothetical protein	Q8H9M8	Vibrio_phage	1.7e-13	48.8
WP_159908676.1\|4840778_4841624_-	hypothetical protein	NA	NA	NA	NA
WP_104910822.1\|4841663_4842194_-	hypothetical protein	A2I2X8	Vibrio_virus	7.7e-50	62.7
WP_159908678.1\|4842190_4842829_-\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	3.6e-38	53.8
WP_159908680.1\|4842825_4843821_-\|plate	baseplate J protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.5e-110	62.6
WP_159908682.1\|4843817_4844150_-\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	2.3e-36	68.2
WP_092237950.1\|4844159_4844771_-\|plate	phage baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	8.6e-45	53.1
WP_159908684.1\|4844774_4845287_-	hypothetical protein	NA	NA	NA	NA
WP_029295276.1\|4845308_4845641_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	3.2e-46	85.0
WP_071610020.1\|4846242_4846971_-	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	2.8e-119	87.7
WP_159909297.1\|4847160_4847886_+	Zeta toxin	NA	NA	NA	NA
WP_159908687.1\|4847882_4848053_+	hypothetical protein	NA	NA	NA	NA
WP_159908689.1\|4848267_4850859_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	6.2e-28	23.5

DBSCAN-SWA_6

5614110 : 5664255

Tupanvirus(20.0%)

holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029296952.1\|5614110_5614611_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_159909022.1\|5614786_5615674_+	acyltransferase	NA	NA	NA	NA
WP_029296955.1\|5615670_5616240_-	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_029296957.1\|5616422_5616881_+	hypothetical protein	NA	NA	NA	NA
WP_029296959.1\|5617043_5618243_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	2.5e-11	29.7
WP_159909024.1\|5618442_5619300_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_159909026.1\|5619442_5620075_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_092230973.1\|5620198_5623216_-	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_003194855.1\|5623212_5623515_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_010207084.1\|5623530_5624781_-	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_092230979.1\|5624803_5626057_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	6.6e-100	52.5
WP_159909313.1\|5626293_5627022_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_029296975.1\|5627112_5628153_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_159909028.1\|5628216_5630031_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_029296979.1\|5630295_5631741_+	cytosine permease	NA	NA	NA	NA
WP_159909030.1\|5631737_5632553_+	carbon-nitrogen hydrolase	NA	NA	NA	NA
WP_029296985.1\|5632556_5633657_-	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_092230991.1\|5633938_5635234_+	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_092230994.1\|5636038_5636809_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_092230997.1\|5636824_5638045_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_159909032.1\|5638044_5639988_-	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_029296994.1\|5640143_5642204_-	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_003194877.1\|5642219_5642750_-	hypothetical protein	NA	NA	NA	NA
WP_029296997.1\|5642819_5643797_-	membrane dipeptidase	NA	NA	NA	NA
WP_029296999.1\|5644017_5644419_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_029297002.1\|5644461_5644869_+	DUF3010 family protein	NA	NA	NA	NA
WP_092231006.1\|5645856_5646792_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_092231009.1\|5646985_5647924_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_092231012.1\|5647998_5648886_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_092231014.1\|5649032_5649998_+	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_070993946.1\|5650121_5650595_+	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_092231017.1\|5650950_5651214_+	hypothetical protein	NA	NA	NA	NA
WP_029300670.1\|5651320_5652424_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_029300672.1\|5652922_5654299_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_029300674.1\|5654726_5655674_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029300676.1\|5655741_5656587_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_029300678.1\|5656583_5657762_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-26	37.6
WP_029300680.1\|5657946_5659941_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.5e-18	27.4
WP_010207128.1\|5660262_5660856_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_092231023.1\|5660949_5662422_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_029300684.1\|5662554_5664255_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.7e-50	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage