CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP031980	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4d, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	1 crisprs	NA	0	1	0	0
NZ_CP031979	Acinetobacter haemolyticus strain AN4 chromosome, complete genome	4 crisprs	cas3,WYL,DEDDh,csa3	5	3	20	1
NZ_CP031983	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4a, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP031982	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4b, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7660 : 62124

Vibrio_phage(29.41%)

integrase,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160132290.1\|7660_8365_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.7e-117	84.1
WP_004281883.1\|8535_9594_-	2,3-butanediol dehydrogenase	NA	NA	NA	NA
WP_160132291.1\|9861_11481_-	oleate hydratase	NA	NA	NA	NA
WP_160124366.1\|12579_13512_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.6e-58	41.7
WP_160124368.1\|13618_16096_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.0e-92	34.4
WP_004281879.1\|16274_16469_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|17038_17971_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.5e-61	42.6
WP_087486619.1\|18647_19867_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_039908973.1\|19942_20338_+	hypothetical protein	NA	NA	NA	NA
WP_001067783.1\|21598_22303_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-118	84.5
WP_020899627.1\|23579_24905_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_087486619.1\|25341_26560_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_160124374.1\|28120_29083_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.5e-32	33.0
WP_004762874.1\|29275_29497_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004762875.1\|29692_29944_+	hypothetical protein	NA	NA	NA	NA
WP_160124379.1\|30140_30362_-	antitoxin HicB	NA	NA	NA	NA
WP_004762878.1\|30389_31589_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	1.4e-38	28.6
WP_085947552.1\|33335_34500_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.6e-140	86.3
WP_009389225.1\|34994_35852_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_151742879.1\|35848_36856_-	hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	3.5e-27	29.9
WP_004757464.1\|36897_37695_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_160132292.1\|37713_38574_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_160132293.1\|38641_39373_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-24	36.4
WP_079378066.1\|39990_40182_+	hypothetical protein	NA	NA	NA	NA
WP_004777687.1\|40533_41457_-	replication initiation protein	Q2A086	Sodalis_phage	1.7e-07	25.3
WP_155756493.1\|42510_42774_+	hypothetical protein	NA	NA	NA	NA
WP_160132294.1\|42830_43295_+	hypothetical protein	NA	NA	NA	NA
WP_160132295.1\|43483_43789_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_020846310.1\|44072_45005_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.5e-61	42.6
WP_004984984.1\|46568_46838_-	hypothetical protein	NA	NA	NA	NA
WP_004984985.1\|46931_47159_-	hypothetical protein	NA	NA	NA	NA
WP_005274609.1\|47649_48579_-\|transposase	IS5-like element ISAba10 family transposase	A0A1V0E8E1	Vibrio_phage	1.1e-59	41.3
WP_160132296.1\|48753_50016_+	exodeoxyribonuclease VII large subunit	NA	NA	NA	NA
WP_004986572.1\|50008_50203_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_004986570.1\|50266_50968_+\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	1.6e-34	53.6
WP_004986561.1\|51508_52360_+	trehalose-phosphatase	NA	NA	NA	NA
WP_004986558.1\|52347_53784_+	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_004986555.1\|53847_55038_-	MFS transporter	NA	NA	NA	NA
WP_048766483.1\|55421_56066_-	glycosyltransferase	NA	NA	NA	NA
WP_005005841.1\|56062_56662_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_005005846.1\|56654_57431_-	PIG-L family deacetylase	NA	NA	NA	NA
WP_104794984.1\|57418_58432_-	acyl-CoA/acyl-ACP dehydrogenase	NA	NA	NA	NA
WP_004986545.1\|58697_58931_+	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_004986541.1\|59132_60539_-	iron-containing redox enzyme family protein	NA	NA	NA	NA
WP_020846310.1\|61191_62124_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.5e-61	42.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP031979

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031979_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031979_1

639416-639509

Orphan

Consensus_repeat	Method
ATAATGAAGCGCAAATCCGTGCAGATGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031979_1

>merge|NZ_CP031979|1|639416-639509|CRISPRCasFinder
ATAATGAAGCGCAAATCCGTGCAGATGCAGATGCCGCGGAAACAGCAGCACGAACAGCAGCTATTAATAATGAAGCTCAAATCCGTGCAGATGC

>NZ_CP031979|1|1|639416-639509|CRISPRCasFinder
ATAATGAAGCGCAAATCCGTGCAGATGC	AGATGCCGCGGAAACAGCAGCACGAACAGCAGCTATTA
ATAATGAAGCTCAAATCCGTGCAGATGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031979.1\|WP_008942212.1\|645715_646612_+\|DUF3298-domain-containing-protein	unknown	unknown	gnl\|CDD\|378702
NZ_CP031979.1\|WP_004637901.1\|636901_637726_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_005092264.1\|651732_652524_+\|tRNA-threonylcarbamoyladenosine-dehydratase	unknown	unknown	gnl\|CDD\|224100
NZ_CP031979.1\|WP_008942209.1\|640082_641687_+\|YadA-like-family-protein	unknown	unknown	gnl\|CDD\|240612
NZ_CP031979.1\|WP_005092261.1\|647614_650371_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP031979.1\|WP_008942211.1\|644790_645609_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_004637913.1\|652546_653002_-\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377495
NZ_CP031979.1\|WP_160124045.1\|638086_638215_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_004637906.1\|643124_644717_+\|peptide-chain-release-factor-3	unknown	unknown	gnl\|CDD\|179105
NZ_CP031979.1\|WP_008942208.1\|637730_638081_-\|transposase	unknown	unknown	unknown
NZ_CP031979.1\|WP_008942205.1\|629466_630174_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_008942207.1\|632139_632535_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|131478
NZ_CP031979.1\|WP_017396682.1\|641975_642848_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_079398519.1\|634364_634661_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP031979.1\|WP_005080957.1\|632706_634290_-\|IS66-like-element-ISAba25-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP031979.1\|WP_001055585.1\|634696_635080_-\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
NZ_CP031979.1\|WP_115736368.1\|635490_636423_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP031979.1\|WP_008942206.1\|630468_631980_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_008942213.1\|646673_647489_+\|TatD-family-hydrolase	unknown	unknown	gnl\|CDD\|238635
NZ_CP031979.1\|WP_005092262.1\|650476_651670_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341042

Protein	Function_ID	Function_description	E-value
NZ_CP031979.1\|WP_008942212.1\|645715_646612_+\|DUF3298-domain-containing-protein	gnl\|CDD\|378702	pfam11738, DUF3298, Protein of unknown function (DUF3298). This family of bacterial protein C-terminal regions is highly conserved but the function is not known. Several members are annotated as being endo-1,4-beta-xylanase-like, but this could not be confirmed, and the structure can be defined as a heat-shock cognate 70kd protein 44kd ATPase.	1.20469e-10
NZ_CP031979.1\|WP_008942209.1\|640082_641687_+\|YadA-like-family-protein	gnl\|CDD\|240612	cd12820, LbR_YadA-like, YadA-like, left-handed beta-roll. This group contains the collagen-binding domain virulence factor YadA an adhesion proteins of several Yersinia species, and related cell surface proteins, including Moraxella catarrhalis UspA-like proteins. The collagen-binding portion is found in the hydrophobic N-terminal region. YadA forms a matrix on the bacterial outer membrane, which mediates binding to collagen and epithelial cells. YadA inhibits the complement-activating pathway with the coating of the cell surface with factor H, which impedes C3b molecules. These domains form a left handed beta roll made up of a series of short repeated elements. UspA1 and UspA2 are part of a class of pathogenicity factors that act as cell surface adhesion molecules, in which N-terminal head and neck domains extend from the bacterial outer membrane. The UspA1 head domain of Moraxella catarrhalis, is formed from trimeric left-handed parallel beta-helices of 14-16 amino acid repeats. The UspA1 head domain connects to a neck region of large extended, charged loops that maybe be ligand binding, which is in turn connected to an extended coiled coil domain that tethers the head and neck region to the cell surface via a transmembrane region.	2.6198e-21
NZ_CP031979.1\|WP_005092262.1\|650476_651670_+\|MFS-transporter	gnl\|CDD\|341042	cd17489, MFS_YfcJ_like, Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.85109e-09
NZ_CP031979.1\|WP_004637913.1\|652546_653002_-\|CHAP-domain-containing-protein	gnl\|CDD\|377495	pfam05257, CHAP, CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.	0.00333293
NZ_CP031979.1\|WP_004637906.1\|643124_644717_+\|peptide-chain-release-factor-3	gnl\|CDD\|179105	PRK00741, prfC, peptide chain release factor 3; Provisional.	0
NZ_CP031979.1\|WP_008942207.1\|632139_632535_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	3.58255e-40
NZ_CP031979.1\|WP_005092261.1\|647614_650371_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP031979.1\|WP_079398519.1\|634364_634661_-\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	5.02931e-32
NZ_CP031979.1\|WP_005080957.1\|632706_634290_-\|IS66-like-element-ISAba25-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	5.17052e-127
NZ_CP031979.1\|WP_001055585.1\|634696_635080_-\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.2938e-10
NZ_CP031979.1\|WP_115736368.1\|635490_636423_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.38925e-48
NZ_CP031979.1\|WP_005092264.1\|651732_652524_+\|tRNA-threonylcarbamoyladenosine-dehydratase	gnl\|CDD\|224100	COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism].	4.18578e-105
NZ_CP031979.1\|WP_008942213.1\|646673_647489_+\|TatD-family-hydrolase	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	7.8258e-82

>NZ_CP031979.1|WP_160124045.1|638086_638215_-|hypothetical-protein
MLHFAKNLEQTSWQKQDRSSFHRSLNRMLTGSTYLYYHRNYK
>NZ_CP031979.1|WP_008942208.1|637730_638081_-|transposase
MRAYSLDLRKKVMAAYRQTNHKSNVCKQFNIARSTLDNWILLEKTTQNLIPIPAVRNGRAFTIKNLESFKAFVETTPFTQISDLLEPFEEKFGYRISYSILWRGLEKIGKVKKQRK
>NZ_CP031979.1|WP_004637901.1|636901_637726_+|hypothetical-protein
MSKDTSTLVVSEDTMLSHDTETTLEHVVSIMPQLIHWLIKSGIGYNEFSTALKALFYNEAIKELDAIKQKKTDSAISLLSGLNRRDVRSFCQSYGEYQLVNQFDLQLPISVPARVIGMWINQKLPQQIPFQGDQYSFENLVKQVSSEKHPKSILLELKRLGIVIEEEDNIVLQNSSFTPDPQADESKQLFTQNISDHLSAGISNLTKNSNFLEQAIFADELSQESVEKLNQLSVDLWNLMSKAIISAAIDYCKLDENDPEAKKRFRLGVYQYDE
>NZ_CP031979.1|WP_115736368.1|635490_636423_-|IS5-family-transposase
MKKPTHKIYRTTNWPAYNRALMSRGNIAIWFDPATQWYAPSKGKQGRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFVQSLIKLCGLNWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLIDSTGMKFLGEGEWKRKKHGPEYRRQWRKLHIGIDAETLQIRAIQLTTNNVSDSQVLGDLLDQIPQDEQIDSVYTDGAYDTKQCRQVIADRQAHAVIPPRKNAKPWKDTKISSLERNELLRTVKRLGRRLWKKWSGYHRRSLVETKMHCIKLLGDKLIARSFPSQVNEIHARVAVLNRFTELGRPLTQVTP
>NZ_CP031979.1|WP_001055585.1|634696_635080_-|IS66-family-insertion-sequence-hypothetical-protein
MNMDIYSATPPVAKKRRKYSKEFKLSIVNACKNPNTSIASVALQHSINANLVSRWIRIFSHHEGAVQDPTHVNPAFIALPYTAAISQPIDERITLCITVPHTNNDIQLKWQTSEIPALAELLKALAT
>NZ_CP031979.1|WP_079398519.1|634364_634661_-|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MDMRAGMDTTMAQVVRAFGYIKPHCAYLFCNKRGHRMKVLVHDGLGIWLCARRLEQGKFHWAQVHQGETVALSPEQLQALIQGLPWQRIGRQQVVTML
>NZ_CP031979.1|WP_005080957.1|632706_634290_-|IS66-like-element-ISAba25-family-transposase
MNTLPDLSQLTHEQLLEFTRQLALQHQSLAQSNQQLDAKVQHLSILNQKYEHELALFKKHKFAQKNEHLTAKQIHLWDEAVEEDIAAVDLELERLNADKTNAATQKAKTNKPKRRPLPDHLHTIRIEHEPASTQCACGCQLRRIGEDVSEKLHFRPAQFYKEQHVRGKWVCDQCDTLTQQAMPAYVIDKGIASPELLSHVLVSKYADHLPLYRQRLIYQRAGIDLSRSTLSDWIGRCGVELEPLANALKEVVLQQRVLHADETPVTIMRMGENNKKPKKGYVWAYATTQYNPVQAVIYDFQDSRSGQHAEEFLKGWQGYLVCDDYSGYKARFKSGQVIEVGCMAHARRKFHELHVTGKSQVAEQALVLIQKLYAIEAELRKKTDGTAEDRREYRQQHSQPVMQQLYEWLNQHHLTVPSSSPTAKAINYTLKRWPALSRYLDDGNLPICNNWVENQMRPWALGRKNWLFAGSLRSGQRAANIMTLIQSAKLNGLDPYAYLSDVLKRLPTHKVTQIEELLPHCWKPKSN
>NZ_CP031979.1|WP_008942207.1|632139_632535_-|carboxymuconolactone-decarboxylase-family-protein
MSQQDYENGLKVRTEVMGESFVKRAQDNTVPFTEPLQSWINEHAWGSTWQREGVLPRKYRSLVTIAFLTALKSPTELKGHIRGALNNGASVEEIQEVLLHSLPYCGAPATQEAFRAALEVINEYQPESTHK
>NZ_CP031979.1|WP_008942206.1|630468_631980_-|hypothetical-protein
MSKKIQSNRDGIQFPIPSGRKVPSTTQTAKQILKSALQSVDSPYASKLIAEKNWRKNYPVYFQELVKAGIESVDHPIRIAQSGLEAAKASFNFNRAEQNDALSHAMANIKDQPFERFILKGTGSSTIEPWFIPYHGKKLQGEALLQQIDLWEQQQVIEPSHAKALRLLNQHPEWFDLSKRTMVLFGAGSEAGPLSWLAKWRANIVAIDLPNPAIWEKITKVIETGNATLIAPQISTTKDGQQLGANLLTQTPEIANWLNTFSETLDLAGIAYLDGEKHVRVSIAMISIMEQVSQHKPDSSIMFMLTPTDIYAIPKAVVHSIQNKIKQRPIVEKLLTKSIHNISLSNFFKPNLKQLIQSDNGQQYGISDCMVIEQGPNYALAKRLQQWFAISARARGQKTVINIAPSTTTHSVVKNPILKAAFSGADLFKVETFSPETTNAIMAALWVHDLNNPESATNPEKVLDHPLELIMENANHGGLWHVPYLARTALPFAAAYGWVREKL
>NZ_CP031979.1|WP_008942205.1|629466_630174_-|hypothetical-protein
MFKLKSQLLKLVLSFTALSISMQLFAGRPMHVDDASVVDAKSCQLEMWMQKHADDREYWSIPACNFGSNFELALGMGRTDTDQADPQNYAVLQAKTLLKALETNSWGIGLVTGSQFNVNDSTDQIWYTSVPVSLSIMDDAFIVHANLGWSHEKQDHRNFFTWGVGSETQVAPRLALTTELYGNDRKESFVQTGFRYMLRKDRIQLDTSYGKQLQRSKQSDFFSLGLVLYSSALLP
>NZ_CP031979.1|WP_008942209.1|640082_641687_+|YadA-like-family-protein
MKKTFQLSIITVALLASHTYAAPVWEGPAGTGTGFSNAMGGETNFANVDPSATGIILGQAIDVSQTSIGIGYNSNAMGNDSFSAGSANNANGDSSVAVGRIANANGDNSIALGATVAAGGTDSIAVGNSQTVNGDNATAVGRGSLVNGSQASSLGHVAWTGGDGATAIGSETWANAENATVLGFNAETGGKNALNIGHDAHGGGLNAIHIGHKTTGSAENTIVIGSNDPTKPGQPWADDKNSVAIGYNADTHNGGGGSTENTVSFGGFFTGAVRTISQVADGINDHDAINVSQLNNAIASLTSGAELIAHADDHLAVEKNQRIAADTDLQAALDNEAQIRADADAAQTAARIAAVDNEAQIRAAADAAEKAARIAGDEALAEARIAGDAAEAAARTAAINTEAQARIAGDAEQRAERIKQVNRLDGRINAEAAERTAEVARLDGRIDHASRRLDDIEKTAYRGVAIALAAQQAVPNIRSGQVALFAGVGHFEGETAGSVGVVTSFISNRVSLSGAVGFAGGNEVGGRVGLSYSF
>NZ_CP031979.1|WP_017396682.1|641975_642848_+|hypothetical-protein
MKSTQYKLSLVLLGAFFFTGCKDENGNFNVGVSLGGTGTGGLSVGTESPVPKPQPDVKPDRMEEDGLLYAVAYPNPITQNCNGIERKIQFVRHYFPHTPMIMGDRVDLYGMKDSSPTRFKLQVIVKNTTSSPIYEYINSCKAAFQLTGTKTAKITQTDYCLNDETVNVYQPDESRTYFYTFNLPNILQNWTANYQAQYSKKFYAETQGSMYDNESIKERTQCDPLSTILLLDEYPSTKDGAPPSSNTGNGNNSGSNNNPPTNTDNPPPIFGGFDLDEDDAEPPIFAGFGL
>NZ_CP031979.1|WP_004637906.1|643124_644717_+|peptide-chain-release-factor-3
MSFKDELAAQVAQRRTFAIISHPDAGKTTMTEKLLLWGKAIQVAGMVKSRKSDRAATSDWMEMEKERGISITTSVMQFPYKKHTINLLDTPGHEDFSEDTYRTLTAVDSALMVIDGAKGVEERTIKLMEVCRMRDTPIISFVNKMDREIREPLELLDEIENVLNIRCVPITWPLGMGRDFAGVYNLIDNKFYVYKAGFGSTITDIEVRDGYDHADIREKVGELAWASFEESLELVQMANEPLDRELFLQGKQTPVLFGTALGNFAVDHVLDAFINWAPEPKAHPTQERTVDANEEGFSGFVFKIQANMDPKHRDRIAFMRICSGKYEKGLKMNHVRLGKDVRISDALTFLAGEREHLEEAWPGDIIGLHNHGTIQIGDTFTSGEKLHFTGIPHFAPEMFRRVRLKDPLKSKQLQKGLKELSEEGATQVFMPQINNDLIVGAVGVLQFDVVAYRLKEEYKVDCIYEPVNVHTVRWIHCDDEKILNEFKKKAHDQLSVDGGGHLTYLAPSRVNLQLMQERWPDIEFRNTREH
>NZ_CP031979.1|WP_008942211.1|644790_645609_+|hypothetical-protein
MNILKPLATISLMMGIMALTACDRPDKSEADSTIQQTSKIEKAEVLPYLNIQEAKAKYALPFCEKKNCIDIAIQTVNTQDHWLNSWIEQQQSNVIQHQIELKQNMSLQQAINAYVKKSDEWQDKYSQNKAYELQMSTRIASQRNQYVLLQIGVDSKQEDVSIKDRYYFFVADRKLLKSLTVLDVIQKNQQTAMHNLIQAHYQTWREQQSAEVNKQLPKTLYWGQADWFFDGEGIGIHYRANEISKDAPQLDIYFTTEQTKQMLQPEIYQKMF
>NZ_CP031979.1|WP_008942212.1|645715_646612_+|DUF3298-domain-containing-protein
MKTFYKYSVLACAILLAACQPKSEPKESQEQTKDPVVEQQTETTLRGETVKVELTLPECKGNACPEFVVERLQSNFPFIDQFLDQQILDQLSKMLDVVDTDTAVSTVQAAEQEQKIGPQVQQYANAFIKVDEELKALSVSHQISLMVKPKILQTEGSLATIVLNSSSYMGGAHGSTAQQYFNFDLVQQKQVQLKDLLLPKQQAVLKKLTHDAFKTWIVDTKLANNPEEYEQAWPFQMTENFLFGEQGLILQYGEYEIGPYAVGLPRLVIPYDQLQGVIKPEYLPKVDAPAASTPVTSS
>NZ_CP031979.1|WP_008942213.1|646673_647489_+|TatD-family-hydrolase
MQLFDTHTHFDVADFDQDRQQLAVQAKQVGVEALILIGFIESRFGTLIQTHQQLQGWDNVPKSYLAPGLHPFYIQQHHEAHLQQLERILQQHDCVAVGEIGLDTFLKQHKQPELFAKQQYYFNAQLELANQYNKPVLLHIRKAHAESIAILKAQKFKLGGIAHAFSGGIEEAKALVKLGFKIGITGQITNPNAKKLHQVVQAIGIEHLVIETDCPDMTPLCCQTSTEHRTRNTPVNLPYVLEYLAAMLEQSQEVLAQQIWQNSLSTLNIKF
>NZ_CP031979.1|WP_005092261.1|647614_650371_+|aconitate-hydratase-AcnA
MARYSKINSFNALQTLTVGSKSYQIYSLARAAEQLGNIDKLPKSLKVLLENLLRFEDQKSVKVEDIQALVDWQKDKRSDQEIQYRPARVLMQDFTGVPAVVDLAAMRAAMAKAGGDPNRINPLSPVDLVIDHSVMVDHFANQNAFDVNVRIEMERNGERYQFLRWGQSAFDNFSVVPPGTGICHQVNLEYLAQAVWLGEDEGQTFAFPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTGRLNEGITATDLVLTITQMLRQKGVVGKFVEFYGDGLADLPLADRATIANMAPEYGATCGFFPIDEVTLSYLALTGRQQQRIDLVEAYSKAQGLWRNTGDEPVFTDTLSLDMSTVQASLAGPKRPQDRVLLADVAKTFNTLMELTLKPVDEMKEQLENEGGGGTAVAAKQANLPHESPACTIDGQIYPLNHGDVVISAITSCTNTSNPSVMLAAGLLAKKAIEKGLQRKPWVKSSLAPGSKVVTDYLAAAGLTPYLDQLGYNLVGYGCTTCIGNSGPLPDPVEEAIQCHDLNVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYGLAGNIRTDLTSQPIGQGKDGQDIYLKDIWPTQAEIDQMLQKVNTEMFHKEYAAVFDGDETWQAIQIPQSQTYTWQDDSTYIRHPPFFDEIDQPPRSIENIEQARILAVLGDSVTTDHISPAGNIKKDSPAGRYLQEQGVDPKDFNSYGSRRGNHEVMMRGTFANIRIKNEMLGGEEGGNTIHIPSGDKLSIYDASMRYQQQKTPLVIVAGKEYGTGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQFIDEQSRQSLNLTGREVLSIHGLSDDIQPHQTLDVSVLREDGQQDQFKVLCRIDTLNEVEYFKAGGILHYVLRNLIAA
>NZ_CP031979.1|WP_005092262.1|650476_651670_+|MFS-transporter
MVLNQLPRYVYYLLVAQAFNLIAAVLSVTVSAIVGLKLAPTQTLATVPYGLQFLAMLLTTFIFSFLMKKLGRHLVFQFGCICLFLAGVFGYLALQSEQFYLLCLSHFSLGLFISTANFYRFAASDRLDSDLIPKATAMVISGGVVAAIIAPVLAIQFQQVQGLPDFTAIYLIFSVLALLLSPILYIWNQKFKLLQAQQVVTQSLQRAKLPINMIVVAVISGAFAYYVMNVMMIMSSLHLKEHHSFHYASISIQLHVLAMFVPSFFVSKLIQRWGTHRTIYIGFILLMLSSLIPIFGQEGIYINIALIILGVGWNFAYSGASTLLAGLNDQQKHRVQGMNETTIALFATLGAFLPAPILTKLGWMNANLLALSISVVIFIILMILSGRHRSAIKVSST
>NZ_CP031979.1|WP_005092264.1|651732_652524_+|tRNA-threonylcarbamoyladenosine-dehydratase
MTDLPVNDEYDRRFAGVAKIYGESSFSHYENSHVMVIGVGGVGSWAVEALARTGIGELTIVDMDVVAASNINRQLPAMTSTLGQEKIEVMAERCRQINPRMTVNIIDDYLTPENVKEILNPTPDIILDCIDDVKAKLALMLHCRFNKIPLIVSGGAGGKLDPLKIRVADLSKTEQDPMLAKLRAQLRSKGICKKPKEKFGITCVYSIDNPFSNTEACSTSEDTAFNPSAGLRCGGYGSAVVVTSSFAMVAVAEVLKKLDTKKG
>NZ_CP031979.1|WP_004637913.1|652546_653002_-|CHAP-domain-containing-protein
MIYDAPSVDHSMVHTPPHQLIVTTPKQPAIDVMTFAQKLTRRASYRSSSQCARFVRIALQAAGANIVNHPVAASDWGRTLQDIGYKKISPAFDNPQKGDIYIIHRTAKHRYGHIAGFSGTQWISDFKQRSHDIYKDKNVTYSYYRLSSNYI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031979_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031979_2

1503481-1503688

Orphan

I-F

Consensus_repeat	Method
TTTCTAAGCTGCCTATGCGGCAGTGAAC	CRISPRCasFinder
TTTCTAAGCTGCCTATGCGGCAGTGAAC	CRT
TTTCTAAGCTGCCTATGCGGCAGTGAAC	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP031979_2

>merge|NZ_CP031979|2|1503481-1503688|CRISPRCasFinder,CRT,PILER-CR
ATTATGAGCTGCCTATGCGTCAGTGAACCAACAATGGCTACAGATACAGCTACAAAGTTATTTCTAAGCTGCCTATGCGGCAGTGAACCCGATAATGTGATCGTGTGTTGTTCGGGTACTTTTCTAAGCTGCCTATGCGGCAGTGAACAATTAAAAGTAATTCTTGATGAGTATGTGTTGTTTCTAAGCTGCCTATGCGGCAGTGAAC

>NZ_CP031979|2|2|1503481-1503688|CRISPRCasFinder
ATTATGAGCTGCCTATGCGTCAGTGAAC	CAACAATGGCTACAGATACAGCTACAAAGTTA
TTTCTAAGCTGCCTATGCGGCAGTGAAC	CCGATAATGTGATCGTGTGTTGTTCGGGTACT
TTTCTAAGCTGCCTATGCGGCAGTGAAC	AATTAAAAGTAATTCTTGATGAGTATGTGTTG
TTTCTAAGCTGCCTATGCGGCAGTGAAC

>NZ_CP031979|2|1|1503481-1503688|CRT
ATTATGAGCTGCCTATGCGTCAGTGAAC	CAACAATGGCTACAGATACAGCTACAAAGTTA
TTTCTAAGCTGCCTATGCGGCAGTGAAC	CCGATAATGTGATCGTGTGTTGTTCGGGTACT
TTTCTAAGCTGCCTATGCGGCAGTGAAC	AATTAAAAGTAATTCTTGATGAGTATGTGTTG
TTTCTAAGCTGCCTATGCGGCAGTGAAC

>NZ_CP031979|2|1|1503541-1503688|PILER-CR
TTTCTAAGCTGCCTATGCGGCAGTGAAC	CCGATAATGTGATCGTGTGTTGTTCGGGTACT
TTTCTAAGCTGCCTATGCGGCAGTGAAC	AATTAAAAGTAATTCTTGATGAGTATGTGTTG
TTTCTAAGCTGCCTATGCGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031979.1\|WP_004638623.1\|1493736_1494990_+\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
NZ_CP031979.1\|WP_005081120.1\|1509697_1512403_+\|outer-membrane-protein-assembly-factor	unknown	unknown	gnl\|CDD\|223801
NZ_CP031979.1\|WP_125316772.1\|1512449_1516958_+\|translocation/assembly-module-TamB-domain-containing-protein	unknown	unknown	gnl\|CDD\|225463
NZ_CP031979.1\|WP_005081122.1\|1508211_1509534_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|235865
NZ_CP031979.1\|WP_004638628.1\|1498506_1499565_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP031979.1\|WP_004638639.1\|1506505_1506940_+\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|376515
NZ_CP031979.1\|WP_005081149.1\|1492833_1493535_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_004638638.1\|1506168_1506549_+\|dihydroneopterin-aldolase	unknown	unknown	gnl\|CDD\|376737
NZ_CP031979.1\|WP_004638641.1\|1507572_1508208_-\|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase	unknown	unknown	gnl\|CDD\|153101
NZ_CP031979.1\|WP_004638645.1\|1517124_1517511_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_026057242.1\|1503933_1504719_+\|HesA/MoeB/ThiF-family-protein	unknown	unknown	gnl\|CDD\|238386
NZ_CP031979.1\|WP_010326927.1\|1500840_1501866_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031979.1\|WP_004638640.1\|1506979_1507531_+\|DUF2799-domain-containing-protein	unknown	unknown	gnl\|CDD\|378521
NZ_CP031979.1\|WP_004638625.1\|1495951_1497040_+\|peptide-chain-release-factor-1	unknown	unknown	gnl\|CDD\|234801
NZ_CP031979.1\|WP_005081141.1\|1497857_1498490_-\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225366
NZ_CP031979.1\|WP_005081147.1\|1495139_1495571_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_005081125.1\|1504764_1506063_+\|AarF/ABC1/UbiB-kinase-family-protein	unknown	unknown	gnl\|CDD\|223733
NZ_CP031979.1\|WP_020846310.1\|1502226_1503159_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP031979.1\|WP_005081145.1\|1497039_1497861_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
NZ_CP031979.1\|WP_004638629.1\|1499707_1500478_+\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|187629

Protein	Function_ID	Function_description	E-value
NZ_CP031979.1\|WP_004638623.1\|1493736_1494990_+\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
NZ_CP031979.1\|WP_005081120.1\|1509697_1512403_+\|outer-membrane-protein-assembly-factor	gnl\|CDD\|223801	COG0729, COG0729, Outer membrane protein [Cell envelope biogenesis, outer membrane].	1.99622e-63
NZ_CP031979.1\|WP_125316772.1\|1512449_1516958_+\|translocation/assembly-module-TamB-domain-containing-protein	gnl\|CDD\|225463	COG2911, COG2911, Uncharacterized protein conserved in bacteria [Function unknown].	1.5362e-113
NZ_CP031979.1\|WP_005081122.1\|1508211_1509534_-\|MFS-transporter	gnl\|CDD\|235865	PRK06814, PRK06814, acyl-[ACP]--phospholipid O-acyltransferase.	6.35634e-138
NZ_CP031979.1\|WP_004638628.1\|1498506_1499565_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.00308e-29
NZ_CP031979.1\|WP_004638639.1\|1506505_1506940_+\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|376515	pfam01288, HPPK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK).	1.67007e-12
NZ_CP031979.1\|WP_004638638.1\|1506168_1506549_+\|dihydroneopterin-aldolase	gnl\|CDD\|376737	pfam02152, FolB, Dihydroneopterin aldolase. This enzyme EC:4.1.2.25 catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin in the biosynthetic pathway of tetrahydrofolate.	2.14425e-34
NZ_CP031979.1\|WP_004638641.1\|1507572_1508208_-\|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase	gnl\|CDD\|153101	cd01042, DMQH, Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain. Demethoxyubiquinone hydroxylases (DMQH) are members of the ferritin-like, diiron-carboxylate family which are present in eukaryotes (the CLK-1/CAT5 family) and prokaryotes (the Coq7 family). DMQH participates in one of the last steps of ubiquinone biosysnthesis and is responsible for DMQ hydroxylation, resulting in the formation of hydroxyubiquinone, a precursor of ubiquinone. CLK-1 is a mitochondrial inner membrane protein and Coq7 is a proposed interfacial integral membrane protein. Mutations in the Caenorhabditis elegans gene clk-1 affect biological timing and extend longevity. The conserved residues of a diiron center are present in this domain.	1.0496e-74
NZ_CP031979.1\|WP_026057242.1\|1503933_1504719_+\|HesA/MoeB/ThiF-family-protein	gnl\|CDD\|238386	cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). .	2.25895e-97
NZ_CP031979.1\|WP_010326927.1\|1500840_1501866_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.97342e-93
NZ_CP031979.1\|WP_004638625.1\|1495951_1497040_+\|peptide-chain-release-factor-1	gnl\|CDD\|234801	PRK00591, prfA, peptide chain release factor 1; Validated.	0
NZ_CP031979.1\|WP_005081141.1\|1497857_1498490_-\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|225366	COG2808, PaiB, Transcriptional regulator [Transcription].	5.34499e-77
NZ_CP031979.1\|WP_004638640.1\|1506979_1507531_+\|DUF2799-domain-containing-protein	gnl\|CDD\|378521	pfam10973, DUF2799, Protein of unknown function (DUF2799). Some members in this family of proteins are annotated as yfiL which has no known function.	4.63083e-21
NZ_CP031979.1\|WP_005081125.1\|1504764_1506063_+\|AarF/ABC1/UbiB-kinase-family-protein	gnl\|CDD\|223733	COG0661, AarF, Predicted unusual protein kinase [General function prediction only].	8.80366e-91
NZ_CP031979.1\|WP_020846310.1\|1502226_1503159_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.3328e-48
NZ_CP031979.1\|WP_005081145.1\|1497039_1497861_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	9.53773e-119
NZ_CP031979.1\|WP_004638629.1\|1499707_1500478_+\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	8.24748e-126

>NZ_CP031979.1|WP_020846310.1|1502226_1503159_-|IS5-family-transposase
MKKPTHKIYRTTNWPAYNRALMSRGNIAIWFDPATQWYAPSKGKQGRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFVQSLIKLCGLNWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLIDSTGMKFLGEGEWKRKKHGPEYRRQWRKLHIGIDAETLQIRAIQLTTNNVSDSQVLGDLLDQIPQDEQIDSVYTDGAYDTKQCRQVIADRQAHAVIPPRKNAKPWKDTKISSLERNELLRTVKRLGRRLWKKWSGYHRRSLVETKMHCIKLLGDKLMARSFPSQVNEIHARVAVLNRFTELGRPLTQVTP
>NZ_CP031979.1|WP_010326927.1|1500840_1501866_-|IS30-family-transposase
MEYIKLSYHHLNFEDRTALMLESRKEGFSARKFAELIKRHPSTIYRELKRNSINDVYQARYASDNTFARRRRGHRKLKIDSILWKFIVEAIRCLWSPQQIAKRLKTFPDLDQTMNVSHTTIYSTIRALPKGELKKDLLSCLRHENKKRKANGEPKKDSILQDIKTIHERPAEVQERKIPGHWEADLIKGKDNKSSIATLIERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTYDRGREMAEHKILEEDLGIDVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAMSLNTRPRKALDWLTPLEKFAQLVDYHKTFQTVAPHV
>NZ_CP031979.1|WP_004638629.1|1499707_1500478_+|3-hydroxyacyl-CoA-dehydrogenase
MKIQGKHFVITGGGSGLGAATAEYLVEKGASVTLVDMNAEVGEQQAKAIGDQAEFVKLDVTDEQAAEQFFKEVVEKHGSLHGLINCAGVGPSAKVVGKDGVHDLAMFSKVLHINVTGTFNMLRYAADAMSKNSVEEGDEDRGVIVNTASVAAFDGQIGQAAYSASKGAVVAMTLPIARELARHSIRIMTIAPGIMETPMLKGLPQNVQDALGQMVPYPSRLGRPEEFARLVAHIAENAYLNGEVIRLDGAIRMAAK
>NZ_CP031979.1|WP_004638628.1|1498506_1499565_-|AraC-family-transcriptional-regulator
MSKNPPLDLNSAKDTISNALIREALSVAASRGLNIVNIANRAGISAELLTSAKARIPVTQCAQLWVELAESMNDEFLGMDSHPMRRGSYKLLAKLAFEADTLEQAIREILKFLSLVLDDIHGELVQNGSKAYLILHDRDQPKRMFTYSTFLMLVHSLMCWLSDQRIVFLKMSFKCHQPVEIQDYRIRFCENIQFHATQNCIEFDAHYLKHKIKKDKQALNDFLRHTPYNLIVRFKNENSLSLQIRRQLLLQPPSEWAELKDIAQQLNMSTATIQRRLKHEGVSYQQLKNDIRCDIAIERLSKTNDSIQSISDDLNFHDPSAFHRAFKKWSGVSPGSYRKSAPNKQNRLHHLG
>NZ_CP031979.1|WP_005081141.1|1497857_1498490_-|FMN-binding-negative-transcriptional-regulator
MYIPQIFKETRQDVLHDLIRQYPFATLITQNNAGLDAMHLPIELLVNDEQNATLVAHIAKNNPLHTQIDNGAEVLVIFQGQQGYISPNWYPSKQQHHQHVPTWNYQVVHVKGKIYFSQDEKVLRGILARLTRTHEAKQDKPWKMSDAPSEYIAEELRHIVAVEIQVSEMVGQFKMSQNRDPIDAIGIVEGLEQQGNTELAQVVKHSTQSN
>NZ_CP031979.1|WP_005081145.1|1497039_1497861_+|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MNIAQALEIKGEIDSYERQEAAWLLEHILGVNSLELKLRLEQELTEIQEQAYLDGLARIEQGEPLAYVTGSQPFWTLDLKVTHDTLVPRPDTEILVETVLKLSLDPQANIVDLGTGTGAIALALASERPQWSVTATDIYQPTLDVAQENALKHGFSQVKFACGAWFQALVEQQQFDLIVSNPPYIDPDDVHMQKLKSEPERALIAANHGLADIEIIIAQGKAWLKAKGWIVLEHGYDQGRAVREIFELHGFVQIQTIKDYGGNDRVSLAQKAD
>NZ_CP031979.1|WP_004638625.1|1495951_1497040_+|peptide-chain-release-factor-1
MKASLRLRLDQLCDRHEELTALLADVEVISDNKRFRKLSREHNDLTEITEVWGKYRQAEEDIETAEMMKSDPDFKDMAEEEIKENKARLVELEDQLNVLMIPKDPNDANAAYLEIRAGTGGDEAAIFSGDLFRMYSKYAETQGWRIEVLSENEGEHGGYKEVICRIDGEGVYGRLKFESGAHRVQRVPATESQGRVHTSACTVAILPEVDVDTTVEINPADLRIDTYRASGAGGQHINKTDSAVRITHIPSGVVVECQEERSQHKNKAKAMALLVSRLENAKRAAADAATSEMRRDLVGSGDRSERIRTYNYPQGRMTDHRINLTLYKLDAIMEGDLTELLDSLHREYQADQLAMLAQENGG
>NZ_CP031979.1|WP_005081147.1|1495139_1495571_-|hypothetical-protein
MKANILLLGAILASSTIATTTYADNATRVAATSALGSVVGTAIGKEIGGHNGALIGSAVGGAGGAAAASSKRTRTEAAIGGGLGGVGGYAVGKNVGGTTGGYIGAAAGAAGGAALGRQVGQDRYYDSRQNQKKKWKKKKHRRH
>NZ_CP031979.1|WP_004638623.1|1493736_1494990_+|serine-hydroxymethyltransferase
MFANISIAEFDPKLAQAIASEGERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEYVDVIEQLAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAIQYGLNPETGEIDYEEVERLALEHKPRMIVAGFSAYSQVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSEEFKTYQQQVVKNAQAMAEVLMARGYDVVSGGTENHLFLLSLIKQDVTGKDADAWLGAAHITVNKNAVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADIIDSKGDEKVIAEVKAKVEAVCAKFPVYAN
>NZ_CP031979.1|WP_005081149.1|1492833_1493535_-|hypothetical-protein
MIRINGKIQHLEIYDFYCVRNRKYETQIEQEQAALAQTLIANLFDVDARVLAYRINKTYKIYSFQIAHHTVMGITEHIFFQEGDELYVVIDPNSFTDISLAYAIYHPEQNLIYSLPQHGFTIEGLRKRQKTIGLSFFILSFLINIFFLVKWESYEEIFIESALAILVSLSLALIAYFSAGLLYKQAVQESMQIYKTFGFNNVEKIDFKSEVYVHKPTRIICSDIAYLKVKIQE
>NZ_CP031979.1|WP_026057242.1|1503933_1504719_+|HesA/MoeB/ThiF-family-protein
MSDHLEHTFELTDDEMHLYSRQILLDGWDIEAQEKLKLANVLIVGAGGIGCTSAELLARAGVGKITIVDADTIEVSNLQRQIAFTSNDLGQYKAETLAKHLQEINPHIQVSYQNKRFDETNADELVQHQDVVLDGCDNFTTRYLVNAVCKTHQVPLISASAIGFEGQMFMVESDSACYECLFPKENQTNEGLRCAESGVLATTPVMVASLQAHHTLLFLGLGLTPLKQKLLLWNGLNLTQRILQFEKDVNCPVCQASASVN
>NZ_CP031979.1|WP_005081125.1|1504764_1506063_+|AarF/ABC1/UbiB-kinase-family-protein
MKRNILVDGLRSVARIGETVIVAAQAGVKYATEKPSNAKLMRETFESLGSTYIKLGQFIASTPSLFPREYVQEFQGCLDQTPTLPFSYIQQVLAEEFEGKDLNSIFSFIDENPLASASIAQVHAAKLVTGEDVVLKVQKPGVETILYTDLNVVHWATKLLEKAVPKIKFASLSEIVDEIKTRMVREVDFIEEAQNLDDFVQYLNISGNQAATAPKVYHQFSTRRVLTMQRLYGVPLTDFDVVKQYAKDPTQVLITAMNTWFGSLMLCKSFHADLHAGNLMLLEDGRVGFIDFGIVGQLNPEVWTACMAFMDALQHTNYIAMAENMLKMGMTNQKIDTQVLAADLERLFSGVLLADPQEILSSNPADLNDIMMDMVAVGERHGIKFPRDFALLFKQMLYFDRFMRVLAPYTDIYADQRLKMVHNIEPASLLKH
>NZ_CP031979.1|WP_004638638.1|1506168_1506549_+|dihydroneopterin-aldolase
MDAIIIEGLKVDTVIGCFNWERQIIQPLMLDLTIHNDLSQAARSDELEDTLNYAQICEIAAQVIQDAKPKLIEHAAQLVLEVLFNTFPSIDSISITIRKPAIIAQANAVGIRLDRNRNDFCARAGE
>NZ_CP031979.1|WP_004638639.1|1506505_1506940_+|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MIATETIFALALASNVQQLENFNFAYAQIMSLGTVEFSSIYEIPCRDGVGADYWNSACLLKSHLSVDEIVDILKKLEQQSGRVRPSHHISLDIDVIAWGESLDQMQFNPKKLPLALDVKIPLYELWPNQILQYDQNRKYPIITL
>NZ_CP031979.1|WP_004638640.1|1506979_1507531_+|DUF2799-domain-containing-protein
MKTLVSISIMAVLLSGCAAMSVEQCKTANWLSVGEKDGSAGYESRLDKYYSSCQKANVVPNQALYEKGYQKGLGYYCRPESIFNEALEGRGDYRVCSIEKRETLRPYYQVAHEYYQANSEFNRSQSDVSHYLRELERKDLSAKDRDEYKKRLSDLRSNRNRVQFRYQDAVRNLERFKAEHGLP
>NZ_CP031979.1|WP_004638641.1|1507572_1508208_-|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase
MRHYTGLDQLINSFDQALRSLVPGATTSQRSNPANDEASQLCVSDARHVAGLMRVNHSGEVCAQALYHGQALTAKLPHVREEMQQAAVEEQDHLAWCEDRLKELDSHTSVLNPIWYGLSYGMGAIAGIAGDKYSLGFVAETERQVSQHLQEHLQQLPEQDQRSRKILEQMNEDELHHRDTALKAGGVDLPVPVRITMTAISKLMTKTSYYI
>NZ_CP031979.1|WP_005081122.1|1508211_1509534_-|MFS-transporter
MMKQDEQLMTSRRFAPMFFTQFFGALNDNVYKQALLLVITYGWIQQQSAAVSTLNNLAALLFILPYFFFSATAGQVADKYERSQLVRFLKLLEIVIMMIGTAGFLLGNLWLLLFALFLMGTHSTCFGPIKYAILPEILKPQELMSGNALFQSGTSIAILFGMILGGAVIASSAGNLLWISITVLIIACLGYLASRFILPQKVAAPDLKIDWNFFRTSFQTIKYAKSIPIVFTVLLGNSWYWFYGATYLTQIPQLTQQNLHASENVVSLLLTFFSVGIGIGSLLCRRIGGSEINIKMVPYGAIGLTVFAFYLAASLTFVPERTGELLSLGDVFSEGAVYYHVMLAVTLLGISGGFYIVPLYAMMQAYSPRSHRARVVAANNILNAVFMVSSAIFSILILSILKIDIKILFSITAVLSAIFSFWLLTRLKPLLKNAPTTLED
>NZ_CP031979.1|WP_005081120.1|1509697_1512403_+|outer-membrane-protein-assembly-factor
MPSKSKFKQSTLVHSMHLIFKMQSFPKLICSGFLISYCISVAYADEEAVVVAENSTIERMKDQVKSIPSPEIPYETFNLSSEYYNPAQDSVAALKQQEEAPSQIDTLKPIQLDENLEHLPVIAVDQNMANEIFQIAEEAKNDALAYRENVAKNPELVVNEATQSELTEISNPPVNIDRLMQEIQADSQIIVEANESGRTLADLQSKTEQVEEKAGFFKRIVNRFRPENLLGAERVPRISADVSGAPPALATNIKAKLSSFTQEAFEDFNVALPQLRSLTNQAAQAVGYYDARFSFEKLSDSRVKVTVEPNEPVKIDKQNIEFTGEGENAPQFQVIRLIPEQDEGDIFNHGKYEATKTKITNAASDNGYFDAYWRLHDVKISQPEKTAEINLKYDTGERYKLKAVEYKMSDPSKPLPLTQKVLDSLAPWKDGDDYAFWRVNVLANNLTNTRYFNYTLVDTIKPDAIQPPLDLPPDLQALVDQQRVEQSQLFSAQQKADIARQQVVSAEEVTQDVVDESQFSGSEPTPAYSLARSMPNIQNDETERQALEEQARLEKKIPVVVTLNADRLNTIETGVGYGTDTGARIRSQYRRAFVNKHGHSFDANIEVSEIRQSIDGRYSIPYKHPLNDYFNLVGGYERETRDNIGPNVELLVESAVVGGERVIKNPLGDWQHTFGLRYRLDRLTGKGDVDVSELPDAFRAAGTNSEQESLLLGYEISKTNSNTRLNPTKGFKQTYKVELGTESILSDANMAILTAGWRFIYSLGENDNHQFVGRGDASYIFTDDFDKVPYNLRFFTGGDQSLRGFDYKSLSPEEDGYKIGGQALGVGSLEYNYQFKDGWRAAVFSDFGNAFDKQFSNPTEYSVGVGIRWRSPIGPIRLDVASGISNDNRPIRLHFFIGPQL
>NZ_CP031979.1|WP_125316772.1|1512449_1516958_+|translocation/assembly-module-TamB-domain-containing-protein
MTEEVEQQQTPSTGPKRERRILRSILLMVLIILLLLVSSLLVMMSTDKGSRFLLDRVLQTQKIIHYEYESGNLLRGIILKNVLVQLEAVDVSLDRADVSLGWRAILKKEIHLSHADVANLKIINKKPPSGEPFGFDPIKLPFILRIDEASLDHLEIQTATAKINFDDIYLKDALWSETKLKFKDSRMDMGYLAVKDATGQIDFSGKYPLNAKADLIIPALNSIDIETIKVVATGSLDTLRAGVATLTPDLLTGWAVLHPVRDQVPMQGELFFRNYHLPILKEQKLFAKDGIARFKGNIEKLVLSLDTDLKGEQIPEGKYNALMETDLTDQLNIQDFNGQLMGGSVSLKGLVNWKDHVSWDLKGRLDRLNAKDETLPQIAQDFLPPSLDANISSTGMLKNGMSVNAQLAFDKYETWQVKLNQSEQKNNQPEPMLLDVAWQGIDRAVPYIGWLSSAEGHTNITLKDDQQDIYVATTVRPHEQGLLPAGKYDAHIDLKGSLLNVENFSYVAEKGRLDGQAKVKLPTDKQQLAWQAQLKAKDFNPQTVALAAPVNLLNGEILASGFAKPNQQIIQFERIDLQGQLAQANQKETVVLQGKATTALMFDDVQAGGGFKSFAVDYDGSLNALNQGNGLLKINIAGTPTNIKINELKHDGVAGKLFATGTVDLQDKIGWNIETSLVRFKPQYFVSSLKGEVSGHVKTQGVWSDKVKRIDIRQLNAAGFLNNRPVRGRGNLSLLLDSNQTGFLPQQFEANDLFFAYGQNQLQATGNAQSLRFKVNAPALYELYPGLRGRAYGSLNVQSQPRLSATANLVVDGFAFNDLASVKSLRIQGQLPTSETTPTKLTATIDQLRSGKRELENATLNLTGTRRAHLLKLETKNARTNFYVQLAGGFNQNNDWLGQIQKGKFSSRRVSLVQNQNTPVIYTTARTELYVGQHCWQSAESQLCLDQPARISPEKGNFSFVTKDLDLKDFAAFMPEGIAVTGQLNGYAKASWAKGTRPKLDSRLVTRKGEIGLAAEDPQDPATTVTYDELSLIAKSISDGLLFRVDMKTPDIGTGYANVVIDPFQTGMPMRGEIAFDDVQLKVFKPFIKDVRSMAGTLALAGKINGTLTQPQFTAEMRLKNGAISMISLPVNLTNMQLYSSIRQDTASIDGAFNSGQGVGRIKGRFDWKDNPHLSLTLKGDNLLVRQAPMITAIVQPDLSLDVYPFDQRLSLRGTIDVPRARISMPESSATVVNVSPDVRVVHQGQDLLATLRAAKPWDIRADMTVTLGNQVIFQGFESNIPLVGRLHLSQRGLETAMRANGAIGVSQKVKIEAYGQSLDLNRAIARFNGPLANPTLDIDANKSVQGSMVGVRVAGTATVPNVQIYNDAGLSEQEALNALLTGRINEGGSGLSNTEGFKSDVNNTIAAAGISMGLGGTRALTNQIGRTFGLSGLALDAQGTGDDTQVSLTGYITPDLFIRYGVGVFTPVNKLTLRYQMNRRLYLEASQSLERAIDVFYNWRF
>NZ_CP031979.1|WP_004638645.1|1517124_1517511_+|hypothetical-protein
MHQINRSMMMKKVLLIAIGLVLVGCADKKPLTPEEKWHGFCVSVGNAARSITLDRQNAIEKQQAIEHAGKIEDKTIHKFILQIIDEVYEIPVDQLKSDPSAIRDEMKQKFTEQCLATPHDELPNYKSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031979_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031979_3

2755597-2755694

Orphan

Consensus_repeat	Method
AGCGTTGCTTTTCTTAACTCGCCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031979_3

>merge|NZ_CP031979|3|2755597-2755694|CRISPRCasFinder
AGCGTTGCTTTTCTTAACTCGCCACTCACAGCATAGCTGCTCGTCTTGCGCATGAGGAATATATTCCGCAAGAGCTTTGCTTTTCTTAACTCGCCACT

>NZ_CP031979|3|3|2755597-2755694|CRISPRCasFinder
AGCGTTGCTTTTCTTAACTCGCCACT	CACAGCATAGCTGCTCGTCTTGCGCATGAGGAATATATTCCGCAAG
AGCTTTGCTTTTCTTAACTCGCCACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031979.1\|WP_017396355.1\|2759102_2764184_-\|Hpt-domain-containing-protein	unknown	unknown	gnl\|CDD\|223716
NZ_CP031979.1\|WP_008941666.1\|2757448_2758582_+\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
NZ_CP031979.1\|WP_004640614.1\|2757179_2757323_+\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|137533
NZ_CP031979.1\|WP_004640626.1\|2767055_2767418_-\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP031979.1\|WP_008941652.1\|2739989_2741465_-\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP031979.1\|WP_008941660.1\|2749922_2752460_+\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|99797
NZ_CP031979.1\|WP_004640619.1\|2758630_2759086_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_004640629.1\|2767439_2767823_-\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP031979.1\|WP_008941664.1\|2755740_2756106_-\|YbaN-family-protein	unknown	unknown	gnl\|CDD\|377291
NZ_CP031979.1\|WP_008941668.1\|2764341_2766423_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP031979.1\|WP_017396358.1\|2746853_2749034_+\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP031979.1\|WP_008941656.1\|2744742_2745450_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP031979.1\|WP_004640625.1\|2766470_2767007_-\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
NZ_CP031979.1\|WP_008941659.1\|2749166_2749751_+\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP031979.1\|WP_008941653.1\|2741561_2742797_-\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|223857
NZ_CP031979.1\|WP_004640609.1\|2754923_2755454_-\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_CP031979.1\|WP_017396360.1\|2742977_2744318_-\|porin	unknown	unknown	unknown
NZ_CP031979.1\|WP_017396357.1\|2752583_2753369_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP031979.1\|WP_008941665.1\|2756206_2757070_+\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
NZ_CP031979.1\|WP_008941657.1\|2745499_2746711_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878

Protein	Function_ID	Function_description	E-value
NZ_CP031979.1\|WP_017396355.1\|2759102_2764184_-\|Hpt-domain-containing-protein	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	1.31483e-113
NZ_CP031979.1\|WP_008941666.1\|2757448_2758582_+\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP031979.1\|WP_004640614.1\|2757179_2757323_+\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|137533	PRK09810, PRK09810, lipoprotein antitoxin entericidin A.	2.2414e-07
NZ_CP031979.1\|WP_004640626.1\|2767055_2767418_-\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	6.47572e-38
NZ_CP031979.1\|WP_008941652.1\|2739989_2741465_-\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP031979.1\|WP_008941660.1\|2749922_2752460_+\|PepSY-domain-containing-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.17836e-120
NZ_CP031979.1\|WP_004640629.1\|2767439_2767823_-\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.09057e-35
NZ_CP031979.1\|WP_008941664.1\|2755740_2756106_-\|YbaN-family-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	5.11216e-36
NZ_CP031979.1\|WP_017396358.1\|2746853_2749034_+\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP031979.1\|WP_008941656.1\|2744742_2745450_+\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.6836e-35
NZ_CP031979.1\|WP_004640625.1\|2766470_2767007_-\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	4.24257e-29
NZ_CP031979.1\|WP_008941659.1\|2749166_2749751_+\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	0.00230079
NZ_CP031979.1\|WP_008941653.1\|2741561_2742797_-\|sodium/glutamate-symporter	gnl\|CDD\|223857	COG0786, GltS, Na+/glutamate symporter [Amino acid transport and metabolism].	9.51412e-159
NZ_CP031979.1\|WP_008941665.1\|2756206_2757070_+\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	1.66104e-39
NZ_CP031979.1\|WP_008941668.1\|2764341_2766423_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.25788e-69
NZ_CP031979.1\|WP_017396357.1\|2752583_2753369_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.34354e-41
NZ_CP031979.1\|WP_004640609.1\|2754923_2755454_-\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	2.26559e-25
NZ_CP031979.1\|WP_008941657.1\|2745499_2746711_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.99194e-94

>NZ_CP031979.1|WP_004640609.1|2754923_2755454_-|L,D-transpeptidase
MPYALEQADILIDLAQQTLYLPKHNKFYVISSGKNGIGEQENTGKTPRGWHRIAQKIGDDAPKNSVFIARQATGEIYDQDLAQQFPERDWILSRILWLDGLQAGFNQGDGCDTFKRYIYIHGTPETEPMGIPMSHGCIRMKNDEVIELFELISEQALVYISEHALDESMIKSERSV
>NZ_CP031979.1|WP_017396357.1|2752583_2753369_+|YdcF-family-protein
MQISSWLRIFFAVIGFILLIDGAVLITLKKIHIGTVLPLLLGLFFCLYSFFYYHLERFFFYHFRLHSIWRFGWLCFWVWLISLGYFFNYLNKNNSQVEVPTSVAAIIVLGSGIENGQPSATLAKRLDRAAPIALTQPNAKLLLTGGVDFGETESEAIVMSRYLQQQHHIPATQIILEDKSTSTELNLKNSHPLLQAHKISLQQPIAIVTSDFHTLRAAAIAKKQGYSNITTIGSTTPLQTRYNAWLREYFAYVSGWLLNEY
>NZ_CP031979.1|WP_008941660.1|2749922_2752460_+|PepSY-domain-containing-protein
MFKKVFFQIHWFLGITAGLILSLMGITGAIYSYDQQILKWINQESYVVEVVNTPKLTPAQLYQHFNQQQPEIEINSITIAANPAASSTVNIKKEGARRGYNMMVNPYTAEILPEVKGREFFQFIQRLHRNLTAGEYGAQITGASTLMLIFFVLSGLYLRFPKKHSLKQWLFIKPKLKGRNFIWDLHAVVGTWVVAFYLLFACTGLYWSYDWWRAGMFKVMGVEQPQRHQQNHDQNKKEQPDLSNQQVNTILTQAWTGVNANIGREYSSLTLNIPKLADQKIEVTFIDPTPQHERARNQAIYNYQSHQFEKLDLYEDKKLNEKIMSSMLPVHRGSFFGSTYQFIAMLASLTMPLFFVTGWMLYLKRRKQKKLTQSARQTLINQQIDPNATPWLISYASQTGVAEQLAWRTATSLQEAQQPTTVKPIQQLTEQDLQQAQQVLFVVSTYGTGEAPDLATSFSKKLMQQSLDLAHLKYAVLALGSKEYPDSYCRFGYVVDAWLKQCKAQALFDLVEVDNANNEDIQRWNQALSVVTQHELHAMNIEKVFDQWTLTERKLLNPNSLGNAAYNIELRAPYDITWHAGDIAEIQPANSLIEIQNFLIKYQIPAQAEIKSLNLTIEQALWNKNLRIEIDQIDDLETLVAQLPTLPTREYSIASIPSQQLLRLVVRQKYDANGELGLGSGWLTEFAQLKQTIALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLQQRNRQNYTANWLIFGERQHQCDFFYEETIQAWLNMGSLQRLDLAFSRDQEQRRYVQDVLREHADELKNWIEQGAVIYVCGSIEGMATGVDQALNDILGEEAVDELRQTQRYRRDVY
>NZ_CP031979.1|WP_008941659.1|2749166_2749751_+|YcxB-family-protein
MTAKTPYAYTLQPVPYEVSEVEQRQAQLMIWRSSNKFSRKAWIIMISLVVLSLVAAGLIKYYSTYSTVICWVVIIGVAFYYLTKKFGLEWYVKRKMKEFPVQEIKGIRLGVQPHGLVMRQKVGLQDGTATISWKDIYEWYASPDFILVNFKVKTPKGDEQQGAYILPKRMDSKNFSFKTIRRHLTETVGAPKSI
>NZ_CP031979.1|WP_017396358.1|2746853_2749034_+|TIGR01666-family-membrane-protein
MNSGLKRLKQATYNTTFMYNVRMLIAFTGTAFVPYLLDHQLATIPLTLGVVAAAISDIDDRFSVRLMNLIYTYIGFFITAASVQLLFPYPIAFAVGLIASCIGWILLGSLGRRYATIAYGCLVISVYTMLGVHLFEEWYQQPALLVVGAAWYGLLSTISFLLFPVRQLQDQLAASYNALGGFLYAKSNLFDVDMTPPSYQQSMIDLSMENSKLIGLFNNLRVALLTRLKGDRGQKDTRRSLQYYFVAQDIHERADSAHIDYQKLTKVFQHSDILFRFQRILSIQGKACQDLAQSILSRTRYTHNKRFKHSFENLRLSLEKLRKDGLYDQVRINALFALYQNLKSIDAQLQNLETERNLVLDNAQQPEHQLKDDDLKGMKDIVVRIKQNLTPESVLFRHAIRLSIVLFIGYVFIQMTNIAYGYWILLTALFVCQPNFNATKRRLYLRIIGTLVGIIVGLAIIYFIPSLEGQLVMLVLSGILFFELRSKQYAQATAFITILALINFNLDGSAFAAGFPRFIDTIIGCALAWFGVSFIWPDWKFRRLPRSIQRALQAQCQYLAEVVTQYHQGRNNALNYRVVRRAAHNTDAEVASLISTLATEPNIDSTQKAQAFEFLCLSHTFLSYIAALGAHREQIQDQEVLDLLDQALDDIQGALLRDEVPDLSAQNMLQTIRQRLTQKESNENDQKSLIILQQLSLMLSILTRLSMLKQSLGHEPSEDGTEFASL
>NZ_CP031979.1|WP_008941657.1|2745499_2746711_-|multidrug-effflux-MFS-transporter
MQVEQTNQRQYSTTWIMLLALLTALGPLSIDMYLPALPQMADEFGVSTQMVANTLPAYFLGLAIGQLFYGPVSDRIGRKTPLYFGLTLYVIASLACVLVTNEWALIIARIFQALGGCVGVVIARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPIFGAWILIFFPWQSIFVCLAMIGVICGLCVHFFFKESLPVERRLKLSTYQVTTLYAAIFKDQSFRLPMLAGCLTGAALFCYISSASAVFMGQYGLSQQHFSYAFAFNAAGIMLMSSLNKHLNTRMGVFPRLVFGGSIQCFGAVCVVSAGLMVNAPLWFLMSGLFLVVSGIGLTGPNAMALAMSEQGARAGTASAIMGSMQFACGLLGGVILNFLVWKASLNMGLMMLMFTSLGLLMIFKVGRQQRASV
>NZ_CP031979.1|WP_008941656.1|2744742_2745450_+|nitroreductase
MNMEQVRYVDEAIRSRHSVRAFLDRPVEQQIIKDILDVACRAPSGTNTQPWKVYVITGKKRTEMIDRVCTAQVESFQNPALASQYKETFAYYPETWISPFIDRRRENGWGLYGLLGIQKGEKEKMAAQQLRNFQLFDAPVGLYFTVNKIMGIGAKMDISMMIQNVMVAAKARGLDTCPQAAWNHFHPIVLDVLGAPNDEELVCAIALGYADPEHIVNTFITPREPVENFTVFLDE
>NZ_CP031979.1|WP_017396360.1|2742977_2744318_-|porin
MSLTLIRKPFVMQSLAIIVATLMMNTAHATSEQEQIQQLRAEVSELRALLEQYVSQPKQENVDSQVVAQPASVTTHNQNIKVVNTEPAKKSPLAIQTASGAQVKLYGFLRGDASYQAKGGDGIFNRINKVDLEGAEKNSDRFYSTATVTRLGLDFKSPVEGTEVGGKLEVDFRGGSNNDTIRIRHAYLTMNDWLFGQTTSTFLATDLQPEMLDFNSPLGIGTYRTPMVRYSNKLNPDISYAIALEKGNDDNRLPALSSKLKYDFAEGKGTTSVRALLTEARSKVAFNKDNMQISRNDSDLGWGVAVGAKYKLTDALQAMVDYSHVKGDSKFLLYTNNAFNVNPNNMGLNLNEFDALTVGTSYQITPKLRSTLAYGAMFADDSNDFAKQAVTDETQNKTLQQGWWNVMYSPVTPITFGLEYIYGERKTFDGQKGKDSRVGAMARYNF
>NZ_CP031979.1|WP_008941653.1|2741561_2742797_-|sodium/glutamate-symporter
MEFTFNGFYTLISAVIVLLLGRFLVNKIDFLRRYNIPEPVAGGLVAAVLSLLIHSFFGYSVVFSSELQTSFMLIFFASIGLSANFMKLKEGGIGLVIFLVCVASFIVVQNAVGMSLATLLGIDPLIGLIAGSITLTGGHGTAGAWGEILESQHGIQGALALGMASATFGLIIGGIIGGPLAKLLINRHGLARAKTPAQIEDRDTHPDPHPEDLAPFENPHQVRLITADNAITTLGMFAACLAFAEFMTGYSKGTWFELPTFVWALGGGVILRNILESVLKVDIFDRAIDVFGNASLSLYLAMALLSLKLWQLADLAGPLVVILGAQTLTMALYAAFITFRVMGKNYDAAVLAAGHCGFGMGATPTAVANMQAITNMYGPSHKAFLIVPLCGAFFVDLINATVIQIILKFFA
>NZ_CP031979.1|WP_008941652.1|2739989_2741465_-|alanine:cation-symporter-family-protein
MNEQLNTTLMSWVQFLNDPLWSFLIVLLILVGVFFTLITGFVQLRLLCHSLWVMKSSRKESKDDHGITPFQAFVTGLASRVGVGNVAGVAIAIAIGGPGAVFWMWFVAFLGMSSAFVESSLAQLFKIRDNQNKQFRGGPAYYITQGLKQKWLGVVFALTLILAYGFVFNAVQSNSIISATSQAWGWDKANFVLALGGFNLEVSWVGLVLVILTALIIFGGIKRIAKVAESFVPFMAILYLIVALYIAAINYTIIPDIFALIFTKAFAFDAAAGGFFGSMISMAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCSCTAIIILASGLYHDAGFEGVALTQRALESQIGSWGSSFLALILFLFAFSSIIGNYAYAESNVQFINNHPKILFVFRILVLVMVYLGAIMSVPLVWSMADLSMGLMATINLIAILLLTPILLVLLKDYTSQLKNGVKEPEFKIDQYPELKKKVDSDIW
>NZ_CP031979.1|WP_008941664.1|2755740_2756106_-|YbaN-family-protein
MKILFWRSLVILFVTLGIIGAILPGMPTTVFLIIAAWAASKGWPQMDAWLLNHPKYGTTLRNWRENGTVPRRAKWFASIMMLISGIIMLFTTAPFGVKVFTNTTMLIVAIWLWFRPEPERG
>NZ_CP031979.1|WP_008941665.1|2756206_2757070_+|DUF1853-family-protein
MSSVVDSPCFFEPWLKFKNPIVRQLAFAIASPNILSEVPSELIIKNKFCLHDNATWQVLYQNYEKRLYQLDQQPQPLHDFVARLKSTRLGLRFENLLWFWLLDDAYHPYQLLGHSIQKIAGAITLGEIDFLVLNQQTQEIEHWEVALKYYLGEGHLNLARWFGLNREDTLYRKLKHFTDRQFQFSEANGYNIQRKFAVMKGQLYLPAQQLQTLPLPVWINTSRQLGNWGTRIPQQPYYRLQRHEWLCPNQLASSSNAIWWTDGLYHTTEGEPSFYMFRQPALLFNRT
>NZ_CP031979.1|WP_004640614.1|2757179_2757323_+|entericidin-A/B-family-lipoprotein
MMKKVLVASIMTAFVLTGCNTFKGFGQDVSKAGDKVTQTAEKTQNKM
>NZ_CP031979.1|WP_008941666.1|2757448_2758582_+|succinyl-diaminopimelate-desuccinylase
MNHSDTLELSLQLLRQPSVTPVDHDCQNIMADRLSKIGFNIEKLRFEDVDNLWARRGTENPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVAKHPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNGRRGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDKGNEYFPATSFQISNIQAGTGATNVIPGHLKVTFNFRYSTEVTAEILQQRVLEILDKHKLNYDISWTFSGLPFLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVNVDDLEPLAEIYEQILVQLLT
>NZ_CP031979.1|WP_004640619.1|2758630_2759086_-|hypothetical-protein
MVKKSTNTALGQIDQQELQHLITVSTGFIDAYIIECHQKVPMLLPQNIVLSAMDTPTNVEHIEWHDLKLPVLALHDPMQKQGVALVVEGEDVSQRFALICNEMPESIRLRISEIVDEDGDVEDPKVFKYVKMGEKRYFVPNLQNIETQLGL
>NZ_CP031979.1|WP_017396355.1|2759102_2764184_-|Hpt-domain-containing-protein
MKEILKTLVETMTLPEDSYLEQDAEILEIFIEELDEIFVELDPLLVQWIEQPNLQNVLTDIRRHFHTLKGSGRMVGAKSSGELGWTVEDTLNRVLAGTIPLTTEIQRYVQAIFNIYRFKLIHDFKAVRAHLIDLRPLVLLGQQLQQQSVEPALSDLLMLADHLVSEDISTGLELVEEALFVDHLTQTEQLALDNADKVLAEDELLAKETLAIFLEEAEEHLATIDQFLQNDHPTNEHYNHLIRALHTLRGSSAMAHIDQIFDASSKVENLFKTLLHDELDSNSNETALLTHYAQFVRDYLYSLRQLETAQRTDEIHATFNTAWDSYDFQLEDSHGENLRPQGLVSQLLELNIQDLLDVESDFDQRARTEFPQYIQQLSQQAEILLQHTHHHATIGMYQYTSLLRSSYQDLIYKPSLLNLEYGFELYDQVHQQFIQLFDTLAAGQRVTLTKEHEQMLNELSTFTQQNIELLEAELIETNLDQAAPLSEAEVVQDSIVDTSDLAARFALDKQQLSTSESNRDFDPDLLDIFLEEADELLVGIDEDLNTWVADLQNVNALKNLMRYLHTLKGGSNMIHAGHIGLIAHELETIYEKLINQQIQATPSLISVIRSVQDDIADRIQTIRDQQVDYPSTHVLDVLTNLMKSTATTAIKIDKFVVSEDEDIEKAVDLDGTTEIEISTHSDVAEPSIDVTSFAAQLALDKQQLQSEQSNRDFDPDLLDIFLEEADELMVGIDADLNTWTTDRHNVNALKNLMRYLHTLKGGSNMIQARHIGLIAHELETIYEKLINQQIQASPQLVAIIRLVQDDIADRIQTIRDQQTDYPSTHVIQLLQHADQDIDVERYATETEIEQTSAELVNADLEVVAASIDNVESESISAETQLDFVETESLLQIVEADSDKDDVTSSLMQDVVEDDTEEDDVRSLVEQTFLEEAEELLGQAQHLLEQWFEQRGNRSLLLQLQRNAHSLKGGARMAEMDAIAIIAYHLENAFEQFGLHHFSSNVYDNLLNTALAWLNDAIFKRQYANFDGLKQSLENMEFVDVAAQLPQKLSARDIFTPEYTMEFVQGDGTEPPSMLGEWESTERIEQNNEMIRVSAEVIEKMIDLSGENAINRSRIEMDLGQLGGTLTEMELAIKRLADQLRRMEGELESQIIARHGGEDARYADFDPLEMDQYSSLNQLSKSLAESASDLVDFKTTLSEKIRDTEGLLLQQSRIQAEIQESLMRTRLVPFSRLLPRLQRIVRQTASTLNRPTELVVNNTEGELDRSILERLVAPFEHMLRNAIDHGIEDREQRLQAKKPETGHIVLNIGRQGTDVVVTFSDDGKGIDVNRIKEKAIQTGLMTKDQKLDQDEILQFIFHPGFSTAAQVTQISGRGVGLDVVQSDIKALGGHVSVGSILGKGTTFTIRVPTTVAVSDALMVKAGDQQFAFPLAQIDRIVRISPMALEQYFESQDDYFKIDQEDYRLRYLSEFVAGQPIPRLTGIVHSLPVLLIKGAQGQMTALLVDQLIGSRGQIVVKPVGQQFSSIGVIAGATILGDGQVCLILDGQNLARQAQSTARSKQADETYTKQRYDERRLIMIVDDSVTVRKVTSRLLERQGYDVVTAKDGVDAMEQLETVKPDLMLLDIEMPRMDGFEVTNLVRHHEIHRDLPIIMITSRTGEKHRERALSLGVSQYMGKPFQEETLLENIESLLAVR
>NZ_CP031979.1|WP_008941668.1|2764341_2766423_-|methyl-accepting-chemotaxis-protein
MGFKLKKKNGSDGAGSKKGEAFLGKIRTQLDQFSRLFGETEKSKPIIYRALIALVLAVILLIYLFVSLPRSNQLTRSLGELRLLSQMISRQATEATASGTSETMNNLVASEKRFAENLEVVEDVYGKSSDEYKKVNELWTNVSKNIDLIASQQAIINQLYDTNISISETIPEIQAEYNLMVDQMVRENMPSSQVIITKNQVFIAERILRSINSVLVGTDNSNASANDFGADIDTFGIYLNAQLNGSSELGVDRISSPDLRESVDSIKSDYDAVLKLAAETVLKNANQIVHVRQASSEIFTQSDALLSSLNALSDKAEGGWGNVLAGIALILALGVLVFSALQLLALRSNTDKERVIRLQDEYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRITDTSQEVARYTQDTQSITNQLAEASEHQAQEIAGASAAMNEMALSIDQVSANASESAEVAKRSVQIATNGAQVVNRSIEGMDHIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILALNAAIQASMAGEAGRGFAVVADEVQRLAERSASATKQIESLVKTIQTDTNEAVISMEQTTSEVVRGANLAKDAGIALDEIQTVSGDLAKLIASISDAAKLQSASASHIATTMNVVQEITSQTTTATFDTARSVSELANMAESLRESVTDFKLPE
>NZ_CP031979.1|WP_004640625.1|2766470_2767007_-|purine-binding-chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKQYTATQNEVSRWSGIAFEMLGQYFVAPLGEISEVIYPPKYTPVPNTQAWVRGLANIRGRLLSVTDLSHFISDQRSQFSPTQKVICISHQDHYVGLVVDQVLGIQHFNKKSFFSQSNELDSKLKDYCQGYFHQHNQQWHVFLLSRLLKNPQYMNASIKFIN
>NZ_CP031979.1|WP_004640626.1|2767055_2767418_-|response-regulator
MARILIVDDSPTETFRFREILTKHGYEVLEATNGADGVTMAQAELPDLVLMDVVMPGMNGFQATRQISKAKDTQHIPVVIVSTKDQATDRVWGKRQGASDYLTKPVDEQQLIDVIKQLLS
>NZ_CP031979.1|WP_004640629.1|2767439_2767823_-|response-regulator
MEDKFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALSKIAEANPDIVFVDIMMPRLDGYQTCALIKNSLNYQNIPVIMLSSKDGLFDQAKGRVVGSDEYLTKPFSKDELLSAIRNHVSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031979_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031979_4

2999078-2999398

Orphan

Consensus_repeat	Method
NNNGGNNNCNNNGGTGGTGGTGACGGCGGTTTATTAAGT	CRT

5 spacers

The CRISPR arrays of NZ_CP031979_4

>merge|NZ_CP031979|4|2999078-2999398|CRT
GGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGTCCAATCACTGGCATCATTGGTGGCATCGGTGGCGGTGGTGACGGTGGTGACGGTGGTTTATTAAGCCCAATCACTGGCATTATTGGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGTCCAATCACTGGCATTATTGGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGTCCAATCACTGGCATCATTGGTGGTATCGGTGGTGGTGACGGCGGTTTATTAAATCCAATCACTGGCATTATTGGTGGCATCGGTGGTGGTGGTGACGGCGGTTTATTAAGC

>NZ_CP031979|4|2|2999078-2999398|CRT
GGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGT	CCAATCACTGGCATCATT
GGTGGCATCGGTGGCGGTGGTGACGGTGGTGACGGT	GGTTTATTAAGCCCAATCACTGGCATTATT
GGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGT	CCAATCACTGGCATTATT
GGTGGCATCGGTGGTGGTGACGGCGGTTTATTAAGT	CCAATCACTGGCATCATT
GGTGGTATCGGTGGTGGTGACGGCGGTTTATTAAAT	CCAATCACTGGCATTATTGGT
GGCATCGGTGGTGGTGGTGACGGCGGTTTATTAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031979.1\|WP_005086792.1\|2989021_2989918_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200583
NZ_CP031979.1\|WP_004637744.1\|3015713_3016358_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293823
NZ_CP031979.1\|WP_008941225.1\|2989988_2990630_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP031979.1\|WP_005086812.1\|3008128_3009625_+\|tripartite-tricarboxylate-transporter-permease	unknown	unknown	gnl\|CDD\|225870
NZ_CP031979.1\|WP_008941219.1\|3011334_3013773_+\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NZ_CP031979.1\|WP_004640968.1\|2985926_2987177_+\|YihY-family-inner-membrane-protein	unknown	unknown	gnl\|CDD\|179313
NZ_CP031979.1\|WP_001055585.1\|3001933_3002317_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|225511
NZ_CP031979.1\|WP_004640980.1\|2990671_2991169_-\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP031979.1\|WP_004640964.1\|2984372_2985185_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|183527
NZ_CP031979.1\|WP_020846310.1\|3014602_3015535_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP031979.1\|WP_004640966.1\|2985220_2985811_-\|NAD(P)H:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|179647
NZ_CP031979.1\|WP_008941221.1\|3009690_3010755_+\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377472
NZ_CP031979.1\|WP_008941224.1\|2991324_2992620_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031979.1\|WP_005086790.1\|2988220_2989030_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP031979.1\|WP_100833423.1\|3004811_3005941_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP031979.1\|WP_100833423.1\|2993363_2994493_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP031979.1\|WP_005080957.1\|3002723_3004307_+\|IS66-like-element-ISAba25-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP031979.1\|WP_079398519.1\|3002352_3002649_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP031979.1\|WP_008941226.1\|2987204_2988113_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP031979.1\|WP_008941222.1\|3007670_3008114_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815

Protein	Function_ID	Function_description	E-value
NZ_CP031979.1\|WP_005086792.1\|2989021_2989918_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200583	cd10960, CE4_NodB_like_1, Catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases. This family includes many uncharacterized bacterial polysaccharide deacetylases. Although their biological function still remains unknown, members in this family show high sequence homology to the catalytic NodB homology domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily.	3.62507e-73
NZ_CP031979.1\|WP_004637744.1\|3015713_3016358_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293823	cd07737, YcbL-like_MBL-fold, Salmonella enterica serovar typhimurium YcbL and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes Salmonella enterica serovar typhimurium YcbL which has type II hydroxyacylglutathione hydrolase (EC 3.1.2.6, also known as glyoxalase II) activity, and has a single metal ion binding site, and Thermus thermophilus TTHA1623 which does not have GLX2 activity and has two metal ion binding sites with a glyoxalase II-type metal coordination. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	6.35103e-115
NZ_CP031979.1\|WP_008941225.1\|2989988_2990630_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	3.05294e-71
NZ_CP031979.1\|WP_005086812.1\|3008128_3009625_+\|tripartite-tricarboxylate-transporter-permease	gnl\|CDD\|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP031979.1\|WP_008941219.1\|3011334_3013773_+\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NZ_CP031979.1\|WP_004640968.1\|2985926_2987177_+\|YihY-family-inner-membrane-protein	gnl\|CDD\|179313	PRK01637, PRK01637, virulence factor BrkB family protein.	3.29727e-73
NZ_CP031979.1\|WP_001055585.1\|3001933_3002317_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.2938e-10
NZ_CP031979.1\|WP_004640980.1\|2990671_2991169_-\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	9.76229e-06
NZ_CP031979.1\|WP_004640966.1\|2985220_2985811_-\|NAD(P)H:quinone-oxidoreductase	gnl\|CDD\|179647	PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional.	1.16417e-59
NZ_CP031979.1\|WP_020846310.1\|3014602_3015535_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.3328e-48
NZ_CP031979.1\|WP_008941222.1\|3007670_3008114_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	4.55106e-07
NZ_CP031979.1\|WP_008941221.1\|3009690_3010755_+\|AbrB-family-transcriptional-regulator	gnl\|CDD\|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	1.0979e-68
NZ_CP031979.1\|WP_100833423.1\|3004811_3005941_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.28572e-46
NZ_CP031979.1\|WP_005086790.1\|2988220_2989030_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.49359e-22
NZ_CP031979.1\|WP_100833423.1\|2993363_2994493_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.28572e-46
NZ_CP031979.1\|WP_005080957.1\|3002723_3004307_+\|IS66-like-element-ISAba25-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	5.17052e-127
NZ_CP031979.1\|WP_079398519.1\|3002352_3002649_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	5.02931e-32
NZ_CP031979.1\|WP_004640964.1\|2984372_2985185_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	7.61158e-125
NZ_CP031979.1\|WP_008941226.1\|2987204_2988113_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	1.03589e-11

>NZ_CP031979.1|WP_100833423.1|2993363_2994493_+|IS3-family-transposase
MTRRKRRNHSAEFKVKVALAAIKGDHTLAELSTQFDLHQNQIIDWKNQLLEQSVNIFSRPTAQQEPEIDLKALHAKIGHQALQIGFFRRCAQKNRATERQKMIDKTHQLSVRQQSQLIQINRSTLYYKPKEISSTDLSLMRLIDEIHLDYPFMGSRMIRDMLQRQGHQIGRRKVRRLMRLMGIHALYPKPNTSKPNLAHRIFPYLLKNMVIDHSNQVWCTDITYIPMAKGFVYLCAVIDWHSRKVLAHRVSISMETDFCIDALQEAIVKYGCPEVFNTDQGSQFTSEAFLNELKLRNIRISMDGKGRWMDNVMIERLWRSVKHEEVYLKAYDTVKQAKQSIAEYLDFYNMIRPHSSLNKATPDEFYDQHLLKVMAA
>NZ_CP031979.1|WP_008941224.1|2991324_2992620_+|hypothetical-protein
MSRFITLFTIFLYCSIQYSFAQLITWSDNIPSAIQPFQNQPKTLASYTQNDIFIYGHPAVKTSVPTLKNNPQPTANFTTAAMIVPVNAQQVEKTLTDFHQYVGLFPTLKSAKTLAQSGNITQMKYRVSIPTPIPVLNFNENIIMQHQLTENSISTLVIDAPIPYGVGKFEWFALDENRTLITLTQWGDLNQPQGFLVKKILAAIPEVKLGIPSSGSAFILESLRTRFNTLTPIALPAGQTPSPQLTPAQLVKIAQLSQAAQQPVSFLHSPTTIAYTHGRESMRFTTTYQFYKQSPQQLQKWLAPVTYKELFPRQIKKVSTTPIQNQSQDADIQVNVSLGVINIPFAFKLQFNYPQTTENNFHANGGDLRYIKGRMQINTVNQGSLFKMTTAMKIDEKAPFLLRAMRSLPYHDTLPAVGGNTVFVQKIRTKL
>NZ_CP031979.1|WP_004640980.1|2990671_2991169_-|YcxB-family-protein
MSEQRPTISARFYLNLEESQDGFALVTFGKKPITRFLTPAISIAIILWGIYLGFTGVGRYYVALGVFFLIMQAIMRFWLLPLLFKRQFVRYQFGKSEQGIDLYQDYFELYAAGKKQKAQYSEVQSFVIGKLTYMLELKNQTVVIVPKRVFTNPADQNKFENSFKK
>NZ_CP031979.1|WP_008941225.1|2989988_2990630_-|fumarylacetoacetate-hydrolase-family-protein
MNTQPSKIVCVGRNYAEHAKELGNAVPDRPILFMKPPSSLATLAQGVAWNQALGECHYECEICLQIAHPLSQEIDKNKALEAIGAITLGLDLTLRDLQSELKNKGQPWERAKAFDGACILADWIEADEIGDLQELELVLMINGEQRQHGFSRDMLFDIGALLVEINQSFSLQAGDVIMTGTPAGVGALNPNDQLTMKLITQSGEYDWDTFVKA
>NZ_CP031979.1|WP_005086792.1|2989021_2989918_-|polysaccharide-deacetylase-family-protein
MKIGLYLTLFLITSFVHAKQLALSFDDGVNPDLNVQALTINQHILEQLHQHRIKSIIYPSVIKIGDYAGVQLVAEWGKQGHQIGNHSEFHLNLNKDSISSQQYIDGIRRAEQVFQPLQGWVARYRYPFLKEGNTQEKRDAVVGYLKQHDYQSGAVSIDASDWFYNQKYLSYQKHHQSDQLEKLKQAYIYHLLDRADYYDQLAIDTIGYSPKHVLLLHVNAINAAFLDDVVLAFQQQGWQWIDSEKAYTDPLYQLSSTVLPAGESIIWSLAKQQGHADLRYPAEDAPYEQENLKRYGLL
>NZ_CP031979.1|WP_005086790.1|2988220_2989030_+|helix-turn-helix-transcriptional-regulator
MKKSAHRIQDFQELPACDDIPASLWLRIRDAPAETFYPKHAHAWGEFIYTFDGVLEVSIDQIHYLTPPPYGIWLPPHLQHSGINRHEVTHCILYVHENLCQNMPQQAGILLTAPLVPALLEHIRKHPFSEQDPEYLRLLQVLLDALTHAELVGSYLPTTQHPALSKILSHLHAYPADNSTLQQLAEMINMTERTLARYSQKELGMSLHEWRQRLKVMKAMSMLNQGKTIENIALDLGYASSSAFIYMFKRWMHFTPDQFRKLYQGSSLQ
>NZ_CP031979.1|WP_008941226.1|2987204_2988113_-|DMT-family-transporter
MDERKTLDARASGLMIGLCMIWGLQQVILKMAAPDISPLMQIALRSGLAAILLLPLLYLDKAAELFNRQNLQAGALVAFLFSLEFFLLAQALQWTSASHAVVLLYTAPIFVALGLHWKLPAERLSWLQWSGIALAFIGIVVTFIREQSGTASAIEQQMLWGDLLALAAGIAWAATTITVRLSSLAQAAVTQTLFYQLAGSFILLFGLAVFLGQASIHFTPLVIGSLAFHTLVVSFASFLAWFWLLRNYLASRLGVFSFLTPLFGIIFGVWLLDERIEPNFVLGSILVLAGIVVVSLQGWLRK
>NZ_CP031979.1|WP_004640968.1|2985926_2987177_+|YihY-family-inner-membrane-protein
MILNRYLKKLNFLEKTWFQFIVFVLRRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIISSIKALEPARQQLQQLIYSNFLPKSTIAFDKALSAFTDKSSNLTIIGILFLFVTTVLMLSSIENVFNRIWRVKETRTGLVGFMRYWTIISLGPILLGSAFVLSSTVASMNILSNNFAGYQLNGAFLLWLISFLLTIIGFFILYWTIPNRNVPIYSAMIAACFSATVFEVLKRLFGWIMSNFTSYEIVYGAFAAVPIFLLWIFLSWNIILLGVEISYALTAFHSGKEQKRHPIMMLLDILELFYKKQQVGNSVSEHELLDIVGRGELGRLPSYILQLEAQNLIKRTDNDEYVLVRNLAQVDFWSFFTALPYPLPLRDDVANVHADDEWMEKIGPALIESNDYLAAKLSIPLSTIFEQK
>NZ_CP031979.1|WP_004640966.1|2985220_2985811_-|NAD(P)H:quinone-oxidoreductase
MQPYVLVLYYSKYGSTRQMAHLIADGIESAGVNARIRTVPNLATVVTEAQPSIPADGDIYCSLDDLAHCSGLALGSPTRFGNMASEMKYFWDQTTSLWLNGALHNKPACVFTSSGSMHGGQESTLLTMLPPLFHHGMMILGLPNSIPALSNTKTGGTPYGASHVSGPRHDQSLSQDEKILCEAQGKRLGELVKKLI
>NZ_CP031979.1|WP_004640964.1|2984372_2985185_+|prolipoprotein-diacylglyceryl-transferase
MLTYPNIDPVALSLGPVQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTGDMVSDLVFYGALGVVLGGRVGYVLFYEFGKFLENPLWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWFQTLDFIAPCVPTGLMFGRIGNFIGGELYGRQVQDPSYPFGMIFPTDPLGLVRHPSQIYQALCEGLLLFIILWWFSSKPRPRMAVSAVFLVGYGVARFFMEFFRQPDADQGFILFGWMTKGQILSFPMIIIGLWMIWYAYRKNIYDWQLKK
>NZ_CP031979.1|WP_001055585.1|3001933_3002317_+|IS66-family-insertion-sequence-hypothetical-protein
MNMDIYSATPPVAKKRRKYSKEFKLSIVNACKNPNTSIASVALQHSINANLVSRWIRIFSHHEGAVQDPTHVNPAFIALPYTAAISQPIDERITLCITVPHTNNDIQLKWQTSEIPALAELLKALAT
>NZ_CP031979.1|WP_079398519.1|3002352_3002649_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MDMRAGMDTTMAQVVRAFGYIKPHCAYLFCNKRGHRMKVLVHDGLGIWLCARRLEQGKFHWAQVHQGETVALSPEQLQALIQGLPWQRIGRQQVVTML
>NZ_CP031979.1|WP_005080957.1|3002723_3004307_+|IS66-like-element-ISAba25-family-transposase
MNTLPDLSQLTHEQLLEFTRQLALQHQSLAQSNQQLDAKVQHLSILNQKYEHELALFKKHKFAQKNEHLTAKQIHLWDEAVEEDIAAVDLELERLNADKTNAATQKAKTNKPKRRPLPDHLHTIRIEHEPASTQCACGCQLRRIGEDVSEKLHFRPAQFYKEQHVRGKWVCDQCDTLTQQAMPAYVIDKGIASPELLSHVLVSKYADHLPLYRQRLIYQRAGIDLSRSTLSDWIGRCGVELEPLANALKEVVLQQRVLHADETPVTIMRMGENNKKPKKGYVWAYATTQYNPVQAVIYDFQDSRSGQHAEEFLKGWQGYLVCDDYSGYKARFKSGQVIEVGCMAHARRKFHELHVTGKSQVAEQALVLIQKLYAIEAELRKKTDGTAEDRREYRQQHSQPVMQQLYEWLNQHHLTVPSSSPTAKAINYTLKRWPALSRYLDDGNLPICNNWVENQMRPWALGRKNWLFAGSLRSGQRAANIMTLIQSAKLNGLDPYAYLSDVLKRLPTHKVTQIEELLPHCWKPKSN
>NZ_CP031979.1|WP_100833423.1|3004811_3005941_-|IS3-family-transposase
MTRRKRRNHSAEFKVKVALAAIKGDHTLAELSTQFDLHQNQIIDWKNQLLEQSVNIFSRPTAQQEPEIDLKALHAKIGHQALQIGFFRRCAQKNRATERQKMIDKTHQLSVRQQSQLIQINRSTLYYKPKEISSTDLSLMRLIDEIHLDYPFMGSRMIRDMLQRQGHQIGRRKVRRLMRLMGIHALYPKPNTSKPNLAHRIFPYLLKNMVIDHSNQVWCTDITYIPMAKGFVYLCAVIDWHSRKVLAHRVSISMETDFCIDALQEAIVKYGCPEVFNTDQGSQFTSEAFLNELKLRNIRISMDGKGRWMDNVMIERLWRSVKHEEVYLKAYDTVKQAKQSIAEYLDFYNMIRPHSSLNKATPDEFYDQHLLKVMAA
>NZ_CP031979.1|WP_008941222.1|3007670_3008114_+|tripartite-tricarboxylate-transporter-TctB-family-protein
MSAERIFSGTLGLVSLGLLYLAWGYVAPIAYDPLGPRPYPVLLLLLLISCCLYLTFRPRKLAEFIDLGYTPSVLKKIGLLMLFMLIYAVTFEFLGFPIATAIMFFLVGTLFGGSLKASLITGIVFGCLLYGLFDYILDVPLPLGFFS
>NZ_CP031979.1|WP_005086812.1|3008128_3009625_+|tripartite-tricarboxylate-transporter-permease
MDVFEYLMYGFQVALTPQNLFIALIGAFIGTIVGLLPGLGPINGVALLLPFAYALGLPPESALILLAAVYLGCEYGGRISAILINVPGDAAAIMSTMDGYPLAKQGKAGIALSLSAMSSFIGSLIAIIGIVLFAPLLAKWAIVFGPAEYFVLMVFALTCLSGLVGDQPIKTAVAALIGLLFATVGVDAVTGVYRFTFDSVNLSDGVQFTTIVIGFFSISEILIMLEKTAIGQKALGQGKRSLFNLKEFLFTLKTTIRSSLLGFIVGILPGAGATIASAMSYTSERKLAGKDGKFGDGDLRGIAAPEAANNASACGSFIPMLTLGVPGSGTTAVMLGALTLYNITPGPQLFTEQPTIVWGLIASLFIASILLLIMNISLVRFFAKLLSVPNFILLPAIAAVSFVGVYAIHSTVFDLVLMVGLGIFGYILRKLNFPLSALILGFVLGELMESSLRRALSISQGELSILFDGYITKVLWILAGIMIVLPLIRWLRNRHRAI
>NZ_CP031979.1|WP_008941221.1|3009690_3010755_+|AbrB-family-transcriptional-regulator
MQLYLKYALSLSLAFLGALVAQWLHLPIPWLLGPLFTTALLKINHAPIECHNSARSIGLSIIGLTLGLYFTPEMIHLIASHWLVLLIGLLFALLLGAIGAFILQRWAKVDFKTAWFASAIGGANEMSHLAEHYQARVDQVASAHTLRVLMVVVIVPFFYQFMGWHGFDTDQIAKHLEVNWFGFFSLVLISYIASRIFIQFKLPNPWTFGALLVAIFFTAQDIHLSAIPTPIIHLGQVLLGWSLGNKFKPGFFKTAPRYLSIVALCNLGALFLTGLLAYTLMQWTDLPIATLGLGLAPGGVAEMTITAKVLQLGVPIVTAFHVVRMVGVLGTVGYLYLFFDKILQKKIQTQKNRN
>NZ_CP031979.1|WP_008941219.1|3011334_3013773_+|ribonuclease-R
MTTNWVDPEAKAEAERYDNPIPSRTLILTTLEQLKTAQSHAELVEHFNIQDQKSIDALNHRLSAMVRDGQLMKDGFKYQPSTDAPSYEATVYINSKGLGTANIAGQDDVLLPERELRLVFNGDRVKVRQTSVDRKGKAWGFITEVVQRRVKQIIGKVAEHQGEYFIQPSNPNQHQPITLEKELIEHANAKVGDMLRVAIDDYPTREELATGHVVQSMADKADTEIIIPQTILEFGLPYEFPEAVIKEAESFKEPSAQDIKNRVDLRDLPLVTIDGEDARDFDDAVYAEKRPGGGYRVVVAIADVSHYVRLESPLNEEAEDRGTSVYFPHFVLPMLPEALSNGLCSLNPHVDRLCMVCDLKLSRAGKVTGYEFYPAVMHSKARLTYTQVGQYFEGATDAIPEDKTIHKSLNTLFQLYQTLKGLRAERHAMEFETIETYMTFDELGGIKEILPRTRNDAHKLIEECMLLANVAAAEYCLEHDIPMLYRVHEAPEFSRIQKVRDFVKLLGLPFPEQPTQADYQRVIEATKDRLDAPSIHAVLLRSMMQAYYGAKNSGHYGLAYEAYTHFTSPIRRYPDLLLHRAIKAYLQQKPYPLSGAALDDAGEHFSQTERRADEASRSVTTWLKCHYMQQHLGDEFVGVISAVTEFGLFVTLKDLYVDGMIHVSQLGEDFFLYDQASQSLIGQNRGQSFSLGDEVKIQVAGVNLEERKIDFQLVQQLTHLGRVIRQKAPRTANPSSSNRASTTEEVFGKAPSSTKAKVSEDGEKPVRKKKDKNKPSSYSKKPAKKASAKPDTKEKAKKKVKKKKSNAKAKAE
>NZ_CP031979.1|WP_020846310.1|3014602_3015535_-|IS5-family-transposase
MKKPTHKIYRTTNWPAYNRALMSRGNIAIWFDPATQWYAPSKGKQGRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFVQSLIKLCGLNWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLIDSTGMKFLGEGEWKRKKHGPEYRRQWRKLHIGIDAETLQIRAIQLTTNNVSDSQVLGDLLDQIPQDEQIDSVYTDGAYDTKQCRQVIADRQAHAVIPPRKNAKPWKDTKISSLERNELLRTVKRLGRRLWKKWSGYHRRSLVETKMHCIKLLGDKLMARSFPSQVNEIHARVAVLNRFTELGRPLTQVTP
>NZ_CP031979.1|WP_004637744.1|3015713_3016358_-|MBL-fold-metallo-hydrolase
MLQVKIVPVTAFAQNCSILWDSETKEAILIDAGGDAAVLKKEVEDLGLKVKALWLTHGHLDHAGAVGELAEAWKIPVIGPHKEDQFWLDMIQEVSARYGFPIPQPVKVNQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKKHGLLWTGDVLFKGSIGRTDFPRGNHQQLLDSIQRECFSLPDETQFISGHGPISTIGYEKQFNPFVASKAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP031979_4	4.1\|2999114\|18\|NZ_CP031979\|CRT	2999114-2999131	18	NZ_CP031979.1	2999399-2999416	1	0.944
NZ_CP031979_4	4.1\|2999114\|18\|NZ_CP031979\|CRT	2999114-2999131	18	NZ_CP031979.1	3000827-3000844	1	0.944
NZ_CP031979_4	4.2\|2999168\|30\|NZ_CP031979\|CRT	2999168-2999197	30	NZ_CP031979.1	2999387-2999416	0	1.0
NZ_CP031979_4	4.2\|2999168\|30\|NZ_CP031979\|CRT	2999168-2999197	30	NZ_CP031979.1	3000815-3000844	0	1.0
NZ_CP031979_4	4.3\|2999234\|18\|NZ_CP031979\|CRT	2999234-2999251	18	NZ_CP031979.1	2999399-2999416	0	1.0
NZ_CP031979_4	4.3\|2999234\|18\|NZ_CP031979\|CRT	2999234-2999251	18	NZ_CP031979.1	3000827-3000844	0	1.0
NZ_CP031979_4	4.4\|2999288\|18\|NZ_CP031979\|CRT	2999288-2999305	18	NZ_CP031979.1	2999399-2999416	1	0.944
NZ_CP031979_4	4.4\|2999288\|18\|NZ_CP031979\|CRT	2999288-2999305	18	NZ_CP031979.1	3000827-3000844	1	0.944
NZ_CP031979_4	4.5\|2999342\|21\|NZ_CP031979\|CRT	2999342-2999362	21	NZ_CP031979.1	2999399-2999419	0	1.0
NZ_CP031979_4	4.5\|2999342\|21\|NZ_CP031979\|CRT	2999342-2999362	21	NZ_CP031979.1	3000827-3000847	0	1.0

1. spacer 4.1|2999114|18|NZ_CP031979|CRT matches to position: 2999399-2999416, mismatch: 1, identity: 0.944

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

2. spacer 4.1|2999114|18|NZ_CP031979|CRT matches to position: 3000827-3000844, mismatch: 1, identity: 0.944

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

3. spacer 4.2|2999168|30|NZ_CP031979|CRT matches to position: 2999387-2999416, mismatch: 0, identity: 1.0

ggtttattaagcccaatcactggcattatt	CRISPR spacer
ggtttattaagcccaatcactggcattatt	Protospacer
******************************

4. spacer 4.2|2999168|30|NZ_CP031979|CRT matches to position: 3000815-3000844, mismatch: 0, identity: 1.0

ggtttattaagcccaatcactggcattatt	CRISPR spacer
ggtttattaagcccaatcactggcattatt	Protospacer
******************************

5. spacer 4.3|2999234|18|NZ_CP031979|CRT matches to position: 2999399-2999416, mismatch: 0, identity: 1.0

ccaatcactggcattatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
******************

6. spacer 4.3|2999234|18|NZ_CP031979|CRT matches to position: 3000827-3000844, mismatch: 0, identity: 1.0

ccaatcactggcattatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
******************

7. spacer 4.4|2999288|18|NZ_CP031979|CRT matches to position: 2999399-2999416, mismatch: 1, identity: 0.944

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

8. spacer 4.4|2999288|18|NZ_CP031979|CRT matches to position: 3000827-3000844, mismatch: 1, identity: 0.944

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

9. spacer 4.5|2999342|21|NZ_CP031979|CRT matches to position: 2999399-2999419, mismatch: 0, identity: 1.0

ccaatcactggcattattggt	CRISPR spacer
ccaatcactggcattattggt	Protospacer
*********************

10. spacer 4.5|2999342|21|NZ_CP031979|CRT matches to position: 3000827-3000847, mismatch: 0, identity: 1.0

ccaatcactggcattattggt	CRISPR spacer
ccaatcactggcattattggt	Protospacer
*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031979_4	4.2\|2999168\|30\|NZ_CP031979\|CRT	2999168-2999197	30	NZ_CP040048	Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence	572753-572782	6	0.8
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	NC_019526	Enterobacteria phage vB_KleM-RaK2, complete genome	133452-133483	8	0.75
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	MT708547	Klebsiella phage Muenster, complete genome	256186-256217	8	0.75
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	AB897757	Klebsiella phage K64-1 DNA, complete genome	133403-133434	8	0.75
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	105874-105905	8	0.75
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	MN693967	Marine virus AFVG_250M992, complete genome	26160-26191	8	0.75
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	NZ_CP028268	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence	16654-16685	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	NC_021529	Vibrio phage nt-1, complete genome	193447-193478	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	KX349253	Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome	31363-31394	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	KX349251	Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome	31366-31397	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	KX349268	Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome	31369-31400	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	KX349230	Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome	31710-31741	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MF042360	Pseudomonas phage Phabio, complete genome	227106-227137	9	0.719
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	NZ_CP033935	Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence	17595-17626	9	0.719
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	NC_048015	Cyanophage S-TIM4, complete genome	145348-145379	9	0.719
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	MH512890	Cyanophage S-TIM4	145348-145379	9	0.719
NZ_CP031979_2	2.3\|1503629\|32\|NZ_CP031979\|CRISPRCasFinder,CRT,PILER-CR	1503629-1503660	32	NC_015283	Prochlorococcus phage P-RSM4, complete genome	145281-145312	9	0.719
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MN693397	Marine virus AFVG_25M279, complete genome	27311-27342	10	0.688
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MN693087	Marine virus AFVG_25M280, complete genome	25316-25347	10	0.688
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MN693388	Marine virus AFVG_25M277, complete genome	3618-3649	10	0.688
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MN693389	Marine virus AFVG_25M278, complete genome	1147-1178	10	0.688
NZ_CP031979_2	2.1\|1503509\|32\|NZ_CP031979\|CRISPRCasFinder,CRT	1503509-1503540	32	MN693389	Marine virus AFVG_25M278, complete genome	31527-31558	10	0.688

1. spacer 4.2|2999168|30|NZ_CP031979|CRT matches to NZ_CP040048 (Acinetobacter baumannii strain VB1190 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ggtttattaagcccaatcactggcattatt	CRISPR spacer
gatattttaagcccgattactggcattatc	Protospacer
*.* * ********.**.***********.

2. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to NC_019526 (Enterobacteria phage vB_KleM-RaK2, complete genome) position: , mismatch: 8, identity: 0.75

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
gtttaaaagtaattcttgaaaagtattatttt	Protospacer
. ***************** .*****   **

3. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to MT708547 (Klebsiella phage Muenster, complete genome) position: , mismatch: 8, identity: 0.75

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
gtttaaaagtaattcttgaaaagtattatttt	Protospacer
. ***************** .*****   **

4. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 8, identity: 0.75

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
gtttaaaagtaattcttgaaaagtattatttt	Protospacer
. ***************** .*****   **

5. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

--aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
ttatttcaga--aattcttgatgagtaggtgtaa	Protospacer
  * ** *.*  *************** **** .

6. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to MN693967 (Marine virus AFVG_250M992, complete genome) position: , mismatch: 8, identity: 0.75

-----aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
ccaagtatt-----taatcctggatgagtatgtgttg	Protospacer
      ***     ****.** ***************

7. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to NZ_CP028268 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
tttcagtggctactgatacagctacaattgga	Protospacer
.  **.******* *************    *

8. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to NC_021529 (Vibrio phage nt-1, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
tgaatttggctacaaatacatctacaaagatt	Protospacer
..*   ********.***** ******** *

9. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to KX349253 (Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
cagttcacgctacagatacatctacaaacttg	Protospacer
**..    ************ ******* **.

10. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to KX349251 (Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
cagttcacgctacagatacatctacaaacttg	Protospacer
**..    ************ ******* **.

11. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to KX349268 (Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
cagttcacgctacagatacatctacaaacttg	Protospacer
**..    ************ ******* **.

12. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to KX349230 (Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
cagttcacgctacagatacatctacaaacttg	Protospacer
**..    ************ ******* **.

13. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 9, identity: 0.719

caacaatggctacagatacagctacaaagtta	CRISPR spacer
taggggtagctacaaatacagcttcaaagttt	Protospacer
.*. ..*.******.******** *******

14. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033935 (Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
aaacaaaaaaaattcttgatgagtatgaccac	Protospacer
** .****. *****************  .

15. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to NC_048015 (Cyanophage S-TIM4, complete genome) position: , mismatch: 9, identity: 0.719

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
aaagaaaagtaaatcatgatgagtatgaaaac	Protospacer
**  ******** ** *********** .

16. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to MH512890 (Cyanophage S-TIM4) position: , mismatch: 9, identity: 0.719

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
aaagaaaagtaaatcatgatgagtatgaaaac	Protospacer
**  ******** ** *********** .

17. spacer 2.3|1503629|32|NZ_CP031979|CRISPRCasFinder,CRT,PILER-CR matches to NC_015283 (Prochlorococcus phage P-RSM4, complete genome) position: , mismatch: 9, identity: 0.719

aattaaaagtaattcttgatgagtatgtgttg	CRISPR spacer
aaagaaaagtaaatcatgatgagtatgaaaac	Protospacer
**  ******** ** *********** .

18. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MN693397 (Marine virus AFVG_25M279, complete genome) position: , mismatch: 10, identity: 0.688

caacaatggctacagatacagctacaaagtta	CRISPR spacer
ataaaatggctacagttacaggtacaagtggc	Protospacer
  * *********** ***** *****.

19. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MN693087 (Marine virus AFVG_25M280, complete genome) position: , mismatch: 10, identity: 0.688

caacaatggctacagatacagctacaaagtta	CRISPR spacer
ataaaatggctacagttacaggtacaagtggc	Protospacer
  * *********** ***** *****.

20. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MN693388 (Marine virus AFVG_25M277, complete genome) position: , mismatch: 10, identity: 0.688

caacaatggctacagatacagctacaaagtta	CRISPR spacer
ataaaatggctacagttacaggtacaagtggc	Protospacer
  * *********** ***** *****.

21. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 10, identity: 0.688

caacaatggctacagatacagctacaaagtta	CRISPR spacer
ataaaatggctacagttacaggtacaagtggc	Protospacer
  * *********** ***** *****.

22. spacer 2.1|1503509|32|NZ_CP031979|CRISPRCasFinder,CRT matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 10, identity: 0.688

caacaatggctacagatacagctacaaagtta	CRISPR spacer
acaaaatggctacagttacaggtacaagtggc	Protospacer
  * *********** ***** *****.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

105711 : 169166

Escherichia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087486619.1\|105711_106930_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_005088721.1\|107549_108704_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_004641634.1\|109022_109463_+	hypothetical protein	NA	NA	NA	NA
WP_004641633.1\|109562_110870_-	DUF445 domain-containing protein	NA	NA	NA	NA
WP_004641631.1\|110887_111445_-	hypothetical protein	NA	NA	NA	NA
WP_005088719.1\|111471_112011_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	2.4e-22	36.4
WP_005087247.1\|112194_113772_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_005088717.1\|113843_114341_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_004641622.1\|114399_115746_-	hypothetical protein	NA	NA	NA	NA
WP_005088715.1\|116008_116617_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_005088714.1\|116613_118497_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	6.4e-99	35.7
WP_005087235.1\|120328_121606_+	urea ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005088707.1\|121697_123332_+	urea ABC transporter permease subunit UrtB	NA	NA	NA	NA
WP_005088704.1\|123336_124407_+	urea ABC transporter permease subunit UrtC	NA	NA	NA	NA
WP_005088702.1\|124407_125235_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	1.5e-12	28.6
WP_005088699.1\|125244_125943_+	urea ABC transporter ATP-binding subunit UrtE	G9BWD6	Planktothrix_phage	1.7e-17	25.1
WP_005087230.1\|126186_126924_-	hypothetical protein	NA	NA	NA	NA
WP_005087228.1\|127004_127553_-	N-acetyltransferase	NA	NA	NA	NA
WP_005087226.1\|127878_128604_-	hypothetical protein	NA	NA	NA	NA
WP_004641598.1\|128971_129331_+	HPF/RaiA family ribosome-associated protein	NA	NA	NA	NA
WP_005087224.1\|129470_130016_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_017396428.1\|130046_130814_+	transporter	NA	NA	NA	NA
WP_160124138.1\|130891_132745_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_008942132.1\|132747_133443_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_017396427.1\|133484_134672_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-21	34.9
WP_005087216.1\|134954_135866_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005087215.1\|136055_136493_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004641582.1\|136556_136907_-	arsenate reductase	NA	NA	NA	NA
WP_008942133.1\|137346_138171_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_008942134.1\|138212_138863_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_008942576.1\|138992_140150_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000550240.1\|140448_140841_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_087486619.1\|141618_142838_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_160132011.1\|143708_145034_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_160132012.1\|145051_145270_-	DUF3565 domain-containing protein	NA	NA	NA	NA
WP_017395612.1\|145270_145723_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_017395613.1\|145902_146385_+	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	7.5e-12	31.9
WP_160132013.1\|146610_147555_+	glutathione synthase	NA	NA	NA	NA
WP_017394484.1\|147808_148906_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_005087195.1\|148919_150365_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_005087193.1\|150404_151331_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_004641557.1\|151335_152193_+	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_118901957.1\|152258_153521_+	cell division protein FtsA	NA	NA	NA	NA
WP_118901954.1\|153786_154962_+	cell division protein FtsZ	NA	NA	NA	NA
WP_004641551.1\|155128_156031_+	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_004641549.1\|156129_156570_-	hypothetical protein	NA	NA	NA	NA
WP_004641547.1\|156676_157360_+	M23 family metallopeptidase	G3MBP9	Bacillus_virus	2.4e-19	40.1
WP_004641545.1\|157565_160283_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_151800544.1\|160285_162244_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_008942146.1\|162382_162664_+	hypothetical protein	NA	NA	NA	NA
WP_151800543.1\|162925_163501_+	TMEM165/GDT1 family protein	NA	NA	NA	NA
WP_100222603.1\|163826_164917_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_118901948.1\|167138_167945_+	FprA family A-type flavoprotein	NA	NA	NA	NA
WP_008942576.1\|168008_169166_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

175234 : 243401

Enterobacteria_phage(20.0%)

transposase,integrase

attL 183360:183377|attR 252239:252256

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151800586.1\|175234_176647_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	3.2e-79	36.5
WP_151800587.1\|176767_177688_-	putative porin	NA	NA	NA	NA
WP_004641522.1\|177952_178735_-	putative porin	NA	NA	NA	NA
WP_100222739.1\|179145_180240_+	peptide chain release factor 2	NA	NA	NA	NA
WP_005403396.1\|180516_180819_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008942153.1\|180874_181939_+	alkene reductase	NA	NA	NA	NA
WP_008942154.1\|182068_183388_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
183360:183377	attL	NA	NA	NA	NA
WP_005088669.1\|183384_184095_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_005088667.1\|184074_185064_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_151800602.1\|185512_187471_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.7e-92	40.6
WP_005088664.1\|187555_188662_-	dimethyl sulfone monooxygenase SfnG	NA	NA	NA	NA
WP_004641499.1\|188685_189426_-	FMN reductase	NA	NA	NA	NA
WP_075314441.1\|189776_190430_+	response regulator transcription factor	NA	NA	NA	NA
WP_005087156.1\|190549_191470_-	porin Omp33-36	NA	NA	NA	NA
WP_008942158.1\|192190_193018_+	carbapenem-hydrolyzing class D beta-lactamase OXA-214	NA	NA	NA	NA
WP_017396633.1\|193347_195069_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_160132014.1\|195123_196776_+	NTPase	X2KLG0	Campylobacter_phage	1.6e-16	24.5
WP_008942576.1\|198113_199271_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005088654.1\|199389_202221_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	56.6
WP_017396722.1\|202480_203053_+	DUF2939 domain-containing protein	NA	NA	NA	NA
WP_004641483.1\|203108_203462_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_008941060.1\|203613_204288_-	thiaminase II	NA	NA	NA	NA
WP_160132015.1\|204460_205543_+	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	6.5e-88	51.1
WP_004641478.1\|205674_207039_+	MFS transporter	NA	NA	NA	NA
WP_004641476.1\|207090_207672_+	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	1.4e-36	62.3
WP_017396719.1\|208072_209506_+	amino acid permease	NA	NA	NA	NA
WP_008941075.1\|209563_211066_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	9.2e-16	26.6
WP_008941076.1\|211220_212513_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.3e-26	28.6
WP_008941077.1\|212509_213958_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_171057917.1\|214020_215001_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004641467.1\|215024_215651_-	hydrolase	NA	NA	NA	NA
WP_005088628.1\|215936_216797_+	pirin family protein	NA	NA	NA	NA
WP_005088626.1\|217232_218531_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008941079.1\|218532_219360_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_005088619.1\|219800_220715_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_118901380.1\|221228_222387_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.5e-50	39.1
WP_005088612.1\|223102_223540_-	hypothetical protein	NA	NA	NA	NA
WP_005274609.1\|224907_225837_+\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
WP_160124150.1\|226534_227020_-	hypothetical protein	NA	NA	NA	NA
WP_017396498.1\|227287_228487_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	4.7e-79	41.7
WP_008941109.1\|228880_230761_+	potassium transporter Kup	A7J6G4	Paramecium_bursaria_Chlorella_virus	7.9e-73	30.2
WP_017396594.1\|230920_231997_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	9.8e-28	37.5
WP_008941111.1\|232068_232311_+	hypothetical protein	NA	NA	NA	NA
WP_004641445.1\|232380_233070_-	aquaporin Z	NA	NA	NA	NA
WP_017396593.1\|233243_234251_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_160132016.1\|234365_235013_+	sterol desaturase family protein	NA	NA	NA	NA
WP_004641438.1\|235314_236073_-	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_017396592.1\|236185_237136_+	homoserine kinase	NA	NA	NA	NA
WP_008941114.1\|237145_237763_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_004641431.1\|237799_238192_+	membrane protein	NA	NA	NA	NA
WP_008941115.1\|238228_239113_-	DMT family transporter	NA	NA	NA	NA
WP_008941116.1\|239099_240554_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.7e-187	71.8
WP_008941117.1\|240788_241520_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
WP_008941118.1\|241687_242221_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_010326927.1\|242375_243401_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
252239:252256	attR	NA	NA	NA	NA

DBSCAN-SWA_3

585340 : 636423

uncultured_virus(13.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100834114.1\|585340_586484_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_004637851.1\|587105_587441_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_005092188.1\|587564_588461_+	alpha/beta fold hydrolase	A2RQC8	Archaeal_BJ1_virus	2.3e-22	30.7
WP_160132028.1\|588460_588898_+	thioredoxin TrxC	V5L6J2	Insectomime_virus	4.0e-12	36.9
WP_005092193.1\|588899_589331_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_005092196.1\|589371_589851_+	GAF domain-containing protein	NA	NA	NA	NA
WP_005092199.1\|589905_590400_-	ester cyclase	NA	NA	NA	NA
WP_004637858.1\|590474_590969_-	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_004637859.1\|590983_591472_-	YajQ family cyclic di-GMP-binding protein	NA	NA	NA	NA
WP_004637860.1\|591562_591877_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_008942197.1\|591964_593872_-	FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
WP_004637862.1\|593889_594303_-	hypothetical protein	NA	NA	NA	NA
WP_004637863.1\|594306_594609_-	hypothetical protein	NA	NA	NA	NA
WP_004637864.1\|594631_595243_-	septation protein IspZ	NA	NA	NA	NA
WP_005092206.1\|595288_596164_+	PHP domain-containing protein	NA	NA	NA	NA
WP_004637866.1\|596158_597070_-	bestrophin	NA	NA	NA	NA
WP_005092208.1\|597114_597849_-	DNA repair protein RadC	NA	NA	NA	NA
WP_005092210.1\|597963_599217_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	8.5e-39	34.2
WP_160132029.1\|599373_599751_+	ATP-binding protein	NA	NA	NA	NA
WP_005092215.1\|599917_600763_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	2.1e-17	42.6
WP_160132030.1\|600749_601487_+	2OG-Fe(II) oxygenase	NA	NA	NA	NA
WP_005092219.1\|601491_601737_+	metal-binding protein	NA	NA	NA	NA
WP_005085472.1\|601723_602332_+	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2P1EMK1	Moumouvirus	2.0e-14	37.0
WP_005085470.1\|602387_602846_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_004637875.1\|602873_603134_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	7.2e-09	43.2
WP_004637876.1\|603145_603562_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_004637877.1\|603658_604717_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_005092221.1\|604841_605402_+	oligoribonuclease	M4M9I5	Vibrio_phage	4.6e-21	32.0
WP_004637879.1\|605563_606292_+	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_171265848.1\|606392_607226_+	enoyl-ACP reductase	NA	NA	NA	NA
WP_001223318.1\|607910_608612_+\|transposase	IS1-like element ISPa14 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_125316827.1\|608576_609038_-	restriction endonuclease	NA	NA	NA	NA
WP_005092228.1\|609846_611235_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_005092230.1\|611246_613238_-	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	3.9e-38	39.9
WP_005092232.1\|613239_614559_-	MacA family efflux pump subunit	A0A140XAI1	Dickeya_phage	1.3e-08	58.5
WP_004637887.1\|614666_615662_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_005085445.1\|615671_616181_-	hypothetical protein	NA	NA	NA	NA
WP_008942201.1\|616388_619013_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.1e-173	41.1
WP_008942202.1\|619156_619507_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_005085438.1\|620014_621739_+	acetolactate synthase 3 large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	4.1e-52	29.2
WP_004637892.1\|621738_622230_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_004637893.1\|622335_623352_+	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_005089444.1\|624442_625375_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	7.4e-56	40.3
WP_160132274.1\|626902_627592_-	hypothetical protein	NA	NA	NA	NA
WP_088631513.1\|627593_628684_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_008942205.1\|629466_630174_-	hypothetical protein	NA	NA	NA	NA
WP_008942206.1\|630468_631980_-	hypothetical protein	NA	NA	NA	NA
WP_008942207.1\|632139_632535_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_005080957.1\|632706_634290_-\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_079398519.1\|634364_634661_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_001055585.1\|634696_635080_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_115736368.1\|635490_636423_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9

DBSCAN-SWA_4

651732 : 721114

uncultured_Caudovirales_phage(27.78%)

integrase,tRNA,transposase

attL 643849:643865|attR 683975:683991

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
643849:643865	attL	NA	NA	NA	NA
WP_005092264.1\|651732_652524_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	S4VW33	Pandoravirus	3.5e-14	28.5
WP_004637913.1\|652546_653002_-	CHAP domain-containing protein	D5GVH7	Campylobacter_virus	1.3e-13	43.2
WP_017396681.1\|653259_654279_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_008942215.1\|654414_655566_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	1.7e-89	44.2
WP_008942216.1\|655549_655825_-	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_125316826.1\|655962_656859_+	hypothetical protein	NA	NA	NA	NA
WP_065286433.1\|656861_657788_-	hypothetical protein	NA	NA	NA	NA
WP_125316825.1\|657952_659599_+	hypothetical protein	NA	NA	NA	NA
WP_001055585.1\|662406_662790_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_079398519.1\|662825_663122_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|663196_664780_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_065286432.1\|665069_666014_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_008942225.1\|666076_666736_-	hypothetical protein	NA	NA	NA	NA
WP_008942226.1\|666751_666976_-	hypothetical protein	NA	NA	NA	NA
WP_017396499.1\|667107_667362_-	hypothetical protein	NA	NA	NA	NA
WP_065286431.1\|667916_670004_-	AAA family ATPase	NA	NA	NA	NA
WP_008942192.1\|670217_670505_+	hypothetical protein	NA	NA	NA	NA
WP_008942191.1\|670562_671606_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	8.6e-61	39.5
WP_008942190.1\|671774_672815_+	YqaJ viral recombinase family protein	S6C475	Thermus_phage	2.8e-43	36.8
WP_008942189.1\|672995_673922_+	hypothetical protein	NA	NA	NA	NA
WP_008942188.1\|674250_675981_+	type I restriction-modification system subunit M	NA	NA	NA	NA
WP_008942187.1\|675970_677404_+	putative DNA binding domain-containing protein	NA	NA	NA	NA
WP_008942186.1\|677400_678795_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_005274609.1\|679976_680906_+\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
WP_020846310.1\|682236_683169_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_008942183.1\|683268_686370_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.1e-74	30.6
683975:683991	attR	NA	NA	NA	NA
WP_008942181.1\|689615_690209_+	LysE family transporter	NA	NA	NA	NA
WP_005092312.1\|690484_690919_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.3e-43	65.0
WP_004637919.1\|690976_691297_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.3e-23	65.1
WP_005092314.1\|691303_691777_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	3.6e-35	49.4
WP_005092315.1\|691788_692829_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_005092317.1\|692821_693541_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.0e-89	70.6
WP_004637923.1\|694044_694479_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_004637924.1\|694608_695184_+	diaminobutyrate acetyltransferase	NA	NA	NA	NA
WP_005085340.1\|695229_696549_+	diaminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_005085334.1\|696545_696959_+	ectoine synthase	NA	NA	NA	NA
WP_005085333.1\|696961_697867_+	ectoine hydroxylase	NA	NA	NA	NA
WP_008942180.1\|697911_699099_-	MFS transporter	NA	NA	NA	NA
WP_005085329.1\|699115_699535_-	RidA family protein	NA	NA	NA	NA
WP_005085327.1\|699606_700104_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_005085324.1\|700796_701924_+	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_004637935.1\|701935_702259_+	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_004637936.1\|702262_703729_+	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_017396599.1\|703791_704613_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_008942177.1\|704940_705267_+	hypothetical protein	NA	NA	NA	NA
WP_004637939.1\|705347_705746_-	ribosome silencing factor	NA	NA	NA	NA
WP_005085320.1\|705827_706622_-	TIM barrel protein	NA	NA	NA	NA
WP_017396601.1\|706647_707511_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_008942173.1\|707585_708374_-	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_008942172.1\|708451_711262_-	response regulator	A0A1V0SGX0	Hokovirus	1.8e-49	28.8
WP_171057119.1\|711399_712338_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	2.2e-55	41.4
WP_004637945.1\|712401_713223_+	3'-5' exonuclease	NA	NA	NA	NA
WP_118903200.1\|713232_714624_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.0e-28	25.9
WP_004637947.1\|714670_716977_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	NA	NA	NA	NA
WP_118903198.1\|717103_717490_-	hypothetical protein	NA	NA	NA	NA
WP_087486619.1\|718095_719314_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_160132032.1\|720181_721114_-\|transposase	IS5-like element IS17 family transposase	Q1MVF0	Enterobacteria_phage	6.1e-58	40.9

DBSCAN-SWA_5

919728 : 942426

Hokovirus(14.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005081501.1\|919728_920310_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_005081504.1\|920329_920626_-	50S ribosomal protein L25	NA	NA	NA	NA
WP_004638154.1\|920722_921676_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	2.1e-42	34.9
WP_005081506.1\|922172_923006_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_005081509.1\|923019_923601_-	outer membrane lipoprotein LolB	NA	NA	NA	NA
WP_008942493.1\|923605_925243_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004638159.1\|925403_926687_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_017396695.1\|926992_927925_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.6e-58	40.9
WP_017395859.1\|928082_928421_-\|transposase	transposase	NA	NA	NA	NA
WP_160132039.1\|928512_928728_-	hypothetical protein	NA	NA	NA	NA
WP_010326927.1\|928748_929774_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_160132040.1\|929764_929926_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_005091458.1\|930548_932426_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	7.9e-57	31.3
WP_004638161.1\|932613_933603_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_005091456.1\|933674_934724_+	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_005081516.1\|934804_935545_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_005081517.1\|935628_936201_+	flavodoxin family protein	NA	NA	NA	NA
WP_005091452.1\|936236_936710_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.5e-23	42.3
WP_005091450.1\|936836_937031_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_005091449.1\|937032_937269_-	hypothetical protein	NA	NA	NA	NA
WP_001223318.1\|937447_938149_-\|transposase	IS1-like element ISPa14 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_125316813.1\|938824_941299_+	hypothetical protein	NA	NA	NA	NA
WP_118901380.1\|941266_942426_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.5e-50	39.1

DBSCAN-SWA_6

1102661 : 1161509

uncultured_virus(20.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100222743.1\|1102661_1103886_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.6e-21	33.1
WP_125316802.1\|1103914_1106119_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_017396447.1\|1106341_1106608_+	hypothetical protein	NA	NA	NA	NA
WP_005081727.1\|1106722_1107133_+	DUF596 domain-containing protein	NA	NA	NA	NA
WP_005091198.1\|1107678_1108227_+	hypothetical protein	NA	NA	NA	NA
WP_004638306.1\|1109360_1111190_-	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
WP_088631513.1\|1112117_1113207_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_004638309.1\|1113694_1114447_+	metallophosphoesterase	NA	NA	NA	NA
WP_004652030.1\|1114638_1114929_+	co-chaperone GroES	A0A221S322	uncultured_virus	2.2e-14	42.4
WP_004638311.1\|1114986_1116621_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.1e-175	60.6
WP_005091188.1\|1116772_1117510_+	hypothetical protein	NA	NA	NA	NA
WP_118878069.1\|1117628_1118561_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	4.6e-58	40.9
WP_005081744.1\|1118613_1118988_-	diacylglycerol kinase	NA	NA	NA	NA
WP_008940899.1\|1119179_1120247_+	4-phosphoerythronate dehydrogenase	A0A285PXZ1	Cedratvirus	1.7e-19	31.4
WP_008940900.1\|1120243_1121230_+	EF-P lysine aminoacylase GenX	A0A1V0SAC0	Catovirus	5.5e-25	27.8
WP_005081751.1\|1121278_1121458_-	hypothetical protein	NA	NA	NA	NA
WP_004638319.1\|1121673_1122291_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_005091180.1\|1122444_1123083_+	Fe-S biogenesis protein NfuA	NA	NA	NA	NA
WP_125316792.1\|1123257_1125297_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.3e-09	30.7
WP_005091177.1\|1125331_1126339_-	hypothetical protein	NA	NA	NA	NA
WP_125316791.1\|1126363_1127371_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_017395771.1\|1127609_1128224_+	carbonic anhydrase	NA	NA	NA	NA
WP_017395772.1\|1128308_1128746_+	AAC(6')-Ighjkrstuvwx family aminoglycoside N-acetyltransferase	NA	NA	NA	NA
WP_171287615.1\|1128767_1129391_-	arylesterase	NA	NA	NA	NA
WP_004638327.1\|1129434_1130139_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-33	38.2
WP_125316790.1\|1130135_1132622_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_017395776.1\|1132702_1133131_-	VOC family protein	NA	NA	NA	NA
WP_004638330.1\|1133392_1134196_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_004638331.1\|1134294_1134966_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_005091161.1\|1135121_1137200_+	polyphosphate kinase 1	NA	NA	NA	NA
WP_125316789.1\|1137248_1138292_-	nitronate monooxygenase	NA	NA	NA	NA
WP_017395778.1\|1138568_1139573_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_005081790.1\|1139574_1141008_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_075315936.1\|1141161_1141620_-	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_004638338.1\|1141826_1142528_-	VIT family protein	NA	NA	NA	NA
WP_004638339.1\|1142748_1143963_+	hypothetical protein	NA	NA	NA	NA
WP_004638340.1\|1143998_1144880_-	hypothetical protein	NA	NA	NA	NA
WP_125316787.1\|1144857_1146705_-	hypothetical protein	NA	NA	NA	NA
WP_004638342.1\|1146705_1147956_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_160132048.1\|1148847_1149597_-	hypothetical protein	NA	NA	NA	NA
WP_008940918.1\|1149754_1151185_-	deoxyribodipyrimidine photo-lyase	A0A2H4UV63	Bodo_saltans_virus	3.0e-56	32.6
WP_004638347.1\|1151303_1151786_-	peptidylprolyl isomerase	NA	NA	NA	NA
WP_008940919.1\|1151907_1153194_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017396684.1\|1153287_1154604_-	D-alanyl-D-alanine carboxypeptidase PBP6B	B6DZZ7	Stx2-converting_phage	3.2e-36	38.2
WP_008940921.1\|1154770_1156474_+	M61 family metallopeptidase	NA	NA	NA	NA
WP_004638351.1\|1156631_1157030_-	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_008940922.1\|1157507_1159739_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_100833423.1\|1160380_1161509_+\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1218744 : 1282671

Acinetobacter_phage(67.44%)

transposase,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020846310.1\|1218744_1219677_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005091071.1\|1220668_1221424_+	hypothetical protein	NA	NA	NA	NA
WP_017395805.1\|1221938_1223285_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_125316780.1\|1223349_1224459_-	META and DUF4377 domain-containing protein	NA	NA	NA	NA
WP_005091068.1\|1224672_1225446_-	dioxygenase	NA	NA	NA	NA
WP_004638409.1\|1225553_1226033_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_005081938.1\|1226355_1228785_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	9.0e-279	62.7
WP_005091067.1\|1228930_1229518_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_005081942.1\|1230044_1230245_+	hypothetical protein	NA	NA	NA	NA
WP_160132276.1\|1230324_1230693_-	MerR family DNA-binding protein	NA	NA	NA	NA
WP_005080957.1\|1230683_1232267_-\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_079398519.1\|1232341_1232638_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_001055585.1\|1232673_1233057_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_005080957.1\|1233272_1234856_-\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_079398519.1\|1234930_1235227_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_001055585.1\|1235262_1235646_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_005091064.1\|1235806_1238515_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.1e-87	36.6
WP_005091061.1\|1238691_1239945_+	RND transporter	NA	NA	NA	NA
WP_160132051.1\|1240253_1240502_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_160132052.1\|1240498_1240858_-	hypothetical protein	NA	NA	NA	NA
WP_160132053.1\|1240854_1241454_-	HNH endonuclease	M1PKJ5	Streptococcus_phage	1.1e-20	36.4
WP_160132054.1\|1241455_1241692_-	hypothetical protein	NA	NA	NA	NA
WP_160132055.1\|1241833_1242910_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	1.6e-78	49.7
WP_160132056.1\|1242914_1243592_-	DUF3820 family protein	A0A1L2C8X2	Pseudomonas_phage	5.6e-29	42.1
WP_160132057.1\|1243588_1244710_-	AAA family ATPase	A0A0P0HSM9	Acinetobacter_phage	4.6e-177	83.4
WP_160132058.1\|1244712_1245042_-	hypothetical protein	NA	NA	NA	NA
WP_160132059.1\|1245038_1245293_-	hypothetical protein	NA	NA	NA	NA
WP_160132060.1\|1245292_1245751_-	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	3.9e-26	48.2
WP_160132061.1\|1245953_1246871_-	hypothetical protein	NA	NA	NA	NA
WP_087010868.1\|1246876_1247914_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_160132062.1\|1247894_1248773_-	site-specific DNA-methyltransferase	C5IHN3	Burkholderia_virus	3.3e-74	48.5
WP_160132063.1\|1248924_1249224_-	hypothetical protein	A0A0D4DCL0	Acinetobacter_phage	1.0e-38	84.7
WP_160132064.1\|1249260_1250010_-	hypothetical protein	A0A0D4DBI5	Acinetobacter_phage	3.5e-88	74.2
WP_160132065.1\|1250126_1250318_+	hypothetical protein	NA	NA	NA	NA
WP_160132066.1\|1250349_1250625_+	hypothetical protein	NA	NA	NA	NA
WP_160132067.1\|1250672_1251134_+	hypothetical protein	NA	NA	NA	NA
WP_160132068.1\|1251130_1251427_+	hypothetical protein	A0A0D4DCL5	Acinetobacter_phage	9.9e-31	70.1
WP_004639734.1\|1251423_1251774_+	hypothetical protein	A0A0D4DBI9	Acinetobacter_phage	1.5e-46	86.1
WP_004639731.1\|1251802_1252006_-	hypothetical protein	NA	NA	NA	NA
WP_171055801.1\|1252092_1253079_+	DUF1376 domain-containing protein	A0A0D4DBT2	Acinetobacter_phage	1.2e-32	63.2
WP_160132069.1\|1253075_1253825_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.7e-98	70.4
WP_160132277.1\|1253824_1254247_+	hypothetical protein	NA	NA	NA	NA
WP_160132070.1\|1254243_1254639_+	hypothetical protein	NA	NA	NA	NA
WP_160132071.1\|1254638_1255034_+	hypothetical protein	NA	NA	NA	NA
WP_160132072.1\|1255026_1255200_+	hypothetical protein	NA	NA	NA	NA
WP_160132073.1\|1255196_1255628_+	VRR-NUC domain-containing protein	A0A0D4DBJ8	Acinetobacter_phage	3.5e-61	80.1
WP_160132278.1\|1255842_1256037_+	hypothetical protein	NA	NA	NA	NA
WP_160132074.1\|1256046_1256592_+	hypothetical protein	A0A0D4DCD6	Acinetobacter_phage	7.8e-82	83.1
WP_160132075.1\|1257240_1257444_+	hypothetical protein	A0A1B1P9J1	Acinetobacter_phage	7.8e-19	69.7
WP_160132076.1\|1257394_1257670_+	DUF968 domain-containing protein	A0A1B1P9J2	Acinetobacter_phage	2.9e-37	82.4
WP_160132077.1\|1257744_1258302_+	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_160132078.1\|1258298_1258706_+	hypothetical protein	NA	NA	NA	NA
WP_160132079.1\|1258756_1259233_+	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	1.2e-57	67.5
WP_160132080.1\|1259237_1259762_+\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	2.7e-39	53.1
WP_160132081.1\|1259774_1261268_+\|terminase	terminase	A0A2H4J8J8	uncultured_Caudovirales_phage	1.8e-205	69.9
WP_160132082.1\|1261269_1262706_+	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	1.2e-118	46.3
WP_160132083.1\|1262708_1263827_+\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	5.7e-111	55.0
WP_160132084.1\|1263823_1264063_+	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	4.5e-18	57.3
WP_160132085.1\|1264170_1264923_+	hypothetical protein	J7I0W4	Acinetobacter_phage	1.0e-68	58.8
WP_160132086.1\|1264943_1265900_+	hypothetical protein	A0A0M3LQL5	Mannheimia_phage	9.4e-115	67.2
WP_160132087.1\|1265950_1266535_+	HeH/LEM domain protein	J7I4P7	Acinetobacter_phage	4.7e-08	54.2
WP_004731333.1\|1266538_1266913_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	3.5e-33	57.4
WP_160132279.1\|1266912_1267287_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	2.4e-21	44.4
WP_160132088.1\|1267283_1267541_+	hypothetical protein	NA	NA	NA	NA
WP_160132089.1\|1267543_1267918_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	7.6e-20	42.9
WP_160132090.1\|1267914_1268325_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	2.4e-14	31.9
WP_160132091.1\|1268393_1269332_+	hypothetical protein	NA	NA	NA	NA
WP_171503523.1\|1269420_1269591_+	hypothetical protein	NA	NA	NA	NA
WP_160132092.1\|1269662_1270148_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	7.3e-39	56.2
WP_160132093.1\|1270150_1270420_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	1.5e-25	65.9
WP_160132094.1\|1270416_1270719_-	Arc family DNA-binding protein	A0A0P0IVR2	Acinetobacter_phage	6.4e-09	66.0
WP_160132095.1\|1270839_1271001_+	Arc family DNA-binding protein	A0A0P0I460	Acinetobacter_phage	6.8e-10	60.4
WP_160132280.1\|1271121_1271370_+	hypothetical protein	NA	NA	NA	NA
WP_160132096.1\|1271366_1272152_+	phage antirepressor KilAC domain-containing protein	A0A0H3UZF1	Geobacillus_virus	2.6e-22	47.7
WP_160132097.1\|1272148_1272460_+	hypothetical protein	NA	NA	NA	NA
WP_160132098.1\|1272537_1273038_+	hypothetical protein	NA	NA	NA	NA
WP_160132099.1\|1273136_1277285_+	tape measure protein	A0A220VZA0	Acinetobacter_phage	9.6e-180	35.8
WP_160132100.1\|1277366_1278125_+	hypothetical protein	J7HXF9	Acinetobacter_phage	3.5e-88	64.3
WP_160132101.1\|1278117_1278504_+	hypothetical protein	J7I476	Acinetobacter_phage	9.5e-42	65.6
WP_160132102.1\|1278565_1279054_+	hypothetical protein	NA	NA	NA	NA
WP_160132103.1\|1279046_1279532_+	DUF1833 family protein	NA	NA	NA	NA
WP_160132281.1\|1279531_1279852_+	hypothetical protein	NA	NA	NA	NA
WP_160132104.1\|1279848_1282671_+	hypothetical protein	A0A1B1P9G8	Acinetobacter_phage	1.9e-142	35.2

DBSCAN-SWA_8

1286480 : 1351076

Acinetobacter_phage(31.58%)

integrase,holin,transposase

attL 1285509:1285525|attR 1289366:1289382

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1285509:1285525	attL	NA	NA	NA	NA
WP_160132106.1\|1286480_1286762_+\|holin	holin	C7BGD7	Burkholderia_phage	1.3e-19	51.7
WP_160132107.1\|1286758_1287349_+	DUF3380 domain-containing protein	U5PZP0	Acinetobacter_phage	3.0e-55	55.0
WP_160132108.1\|1287505_1288918_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A0R6PHM8	Moraxella_phage	1.4e-82	43.5
WP_004638418.1\|1289340_1289628_-	cell division protein ZapA	NA	NA	NA	NA
1289366:1289382	attR	NA	NA	NA	NA
WP_004638419.1\|1289624_1290185_-	hypothetical protein	NA	NA	NA	NA
WP_004638420.1\|1290251_1290887_+	UPF0149 family protein	NA	NA	NA	NA
WP_005091060.1\|1290941_1292261_+	Xaa-Pro aminopeptidase	NA	NA	NA	NA
WP_005091059.1\|1292723_1293932_+	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_005091057.1\|1293928_1295161_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_004638425.1\|1295334_1295586_+	hypothetical protein	NA	NA	NA	NA
WP_005091056.1\|1295643_1296246_-	amino acid transporter	NA	NA	NA	NA
WP_005091053.1\|1296353_1297244_+	LysR family transcriptional regulator ArgP	NA	NA	NA	NA
WP_005091051.1\|1297309_1298146_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-45	39.6
WP_005091048.1\|1298162_1299098_+	penicillin-binding protein activator	NA	NA	NA	NA
WP_151212216.1\|1299094_1299514_+	YraN family protein	NA	NA	NA	NA
WP_004638431.1\|1299582_1300275_+	BON domain-containing protein	NA	NA	NA	NA
WP_125316779.1\|1300278_1301151_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_005081970.1\|1301171_1301924_-	NAD(+) diphosphatase	NA	NA	NA	NA
WP_005091045.1\|1301923_1303570_-	hypothetical protein	NA	NA	NA	NA
WP_008940948.1\|1303696_1305055_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-37	40.3
WP_005091042.1\|1305322_1308385_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	2.8e-19	31.7
WP_005091040.1\|1308393_1310238_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004638439.1\|1310265_1311333_+	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_005091037.1\|1311332_1312343_+	ABC transporter permease	NA	NA	NA	NA
WP_005091035.1\|1312320_1313913_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-15	33.5
WP_005091034.1\|1314027_1315272_+	NADH:flavin oxidoreductase/NADH oxidase family protein	NA	NA	NA	NA
WP_004638443.1\|1315450_1316113_-	ribonuclease T	L0N5X9	Acaryochloris_phage	2.0e-07	35.4
WP_004638444.1\|1316097_1317132_-	dihydroorotase	NA	NA	NA	NA
WP_005091032.1\|1317294_1318572_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.6e-19	39.0
WP_004638446.1\|1318628_1319867_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_005091031.1\|1320064_1321138_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_008940950.1\|1321223_1321988_+	DUF817 family protein	NA	NA	NA	NA
WP_004638449.1\|1322177_1322648_+	DUF3015 family protein	NA	NA	NA	NA
WP_005091029.1\|1322730_1324611_+	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_004638451.1\|1324646_1325009_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_017394508.1\|1325023_1325572_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	6.4e-92	94.5
WP_026056331.1\|1325662_1326352_-	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	1.2e-98	82.1
WP_080631714.1\|1326679_1327705_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_005274609.1\|1328168_1329098_+\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
WP_005091020.1\|1329300_1330107_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	4.2e-132	89.6
WP_005082005.1\|1330116_1331166_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	4.3e-169	88.0
WP_160132110.1\|1331446_1332241_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_005091018.1\|1332334_1333696_-	L-cystine transporter	NA	NA	NA	NA
WP_088631513.1\|1334025_1335115_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_171055785.1\|1335246_1335822_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.5e-104	93.2
WP_171055742.1\|1336448_1337864_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_005091017.1\|1337987_1338479_+	chorismate lyase	NA	NA	NA	NA
WP_005091016.1\|1338493_1339375_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_004638463.1\|1339485_1340745_+	hypothetical protein	NA	NA	NA	NA
WP_004638464.1\|1340834_1341047_+	hypothetical protein	NA	NA	NA	NA
WP_005091014.1\|1341064_1341505_-	DUF2726 domain-containing protein	NA	NA	NA	NA
WP_004638474.1\|1342000_1342627_-	superoxide dismutase	NA	NA	NA	NA
WP_008940951.1\|1342852_1343476_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.3e-77	69.3
WP_008940952.1\|1343812_1344571_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_005082015.1\|1344765_1345947_+	trypsin-like peptidase domain-containing protein	W5SAB9	Pithovirus	2.1e-07	27.7
WP_017394374.1\|1346141_1347353_-	alginate export family protein	NA	NA	NA	NA
WP_005082017.1\|1347435_1348782_-	MFS transporter	NA	NA	NA	NA
WP_004638481.1\|1349172_1350231_-	OmpW family protein	NA	NA	NA	NA
WP_001223318.1\|1350374_1351076_-\|transposase	IS1-like element ISPa14 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0

DBSCAN-SWA_9

1489010 : 1559601

Pseudomonas_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100833423.1\|1489010_1490139_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_005081154.1\|1490642_1491335_-	3'-5' exonuclease	A0A059VJT9	Pseudomonas_phage	4.8e-36	40.3
WP_160132112.1\|1491574_1492807_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_005081149.1\|1492833_1493535_-	hypothetical protein	NA	NA	NA	NA
WP_004638623.1\|1493736_1494990_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.1e-97	52.8
WP_005081147.1\|1495139_1495571_-	hypothetical protein	NA	NA	NA	NA
WP_004638625.1\|1495951_1497040_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	6.7e-08	50.0
WP_005081145.1\|1497039_1497861_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_005081141.1\|1497857_1498490_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
WP_004638628.1\|1498506_1499565_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_004638629.1\|1499707_1500478_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_010326927.1\|1500840_1501866_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_020846310.1\|1502226_1503159_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_026057242.1\|1503933_1504719_+	HesA/MoeB/ThiF family protein	NA	NA	NA	NA
WP_005081125.1\|1504764_1506063_+	AarF/ABC1/UbiB kinase family protein	A0A0R6PHP6	Moraxella_phage	7.8e-104	48.0
WP_004638638.1\|1506168_1506549_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_004638639.1\|1506505_1506940_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_004638640.1\|1506979_1507531_+	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_004638641.1\|1507572_1508208_-	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
WP_005081122.1\|1508211_1509534_-	MFS transporter	NA	NA	NA	NA
WP_005081120.1\|1509697_1512403_+	outer membrane protein assembly factor	NA	NA	NA	NA
WP_125316772.1\|1512449_1516958_+	translocation/assembly module TamB domain-containing protein	NA	NA	NA	NA
WP_004638645.1\|1517124_1517511_+	hypothetical protein	NA	NA	NA	NA
WP_004638647.1\|1517770_1520410_+	bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase	NA	NA	NA	NA
WP_005081115.1\|1520526_1521108_+	hypothetical protein	NA	NA	NA	NA
WP_005081113.1\|1521259_1522717_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_004638650.1\|1522986_1523961_+	ion transporter	NA	NA	NA	NA
WP_005081107.1\|1526272_1527226_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	3.9e-76	42.9
WP_005081105.1\|1527218_1528175_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_005081102.1\|1528165_1528930_+	ATP-binding cassette domain-containing protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.3e-15	25.4
WP_005081100.1\|1528939_1529890_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_160132114.1\|1529935_1531156_-	MFS transporter	NA	NA	NA	NA
WP_017394409.1\|1531359_1532178_+	DUF4198 domain-containing protein	NA	NA	NA	NA
WP_005090912.1\|1532223_1532883_-	epoxyqueuosine reductase QueH	NA	NA	NA	NA
WP_005081091.1\|1533126_1534047_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004638660.1\|1534151_1534607_-	DUF441 domain-containing protein	NA	NA	NA	NA
WP_005081089.1\|1534731_1535178_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_005081087.1\|1535284_1536163_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005081085.1\|1536225_1537086_-	hypothetical protein	NA	NA	NA	NA
WP_004638664.1\|1537539_1538100_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_004638665.1\|1538180_1538960_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_005081081.1\|1539060_1539804_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_088631513.1\|1541416_1542506_+\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_005081078.1\|1542889_1543255_+	NirD/YgiW/YdeI family stress tolerance protein	A0A1I9LJU6	Stx_converting_phage	5.7e-12	43.9
WP_004638671.1\|1543347_1544007_+	response regulator transcription factor	NA	NA	NA	NA
WP_005081075.1\|1544010_1545372_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	9.9e-17	29.0
WP_004638676.1\|1545435_1545606_-	hemin uptake protein HemP	NA	NA	NA	NA
WP_005081073.1\|1545782_1546694_+	thiamine phosphate synthase	NA	NA	NA	NA
WP_005081070.1\|1546722_1547280_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_005081068.1\|1547298_1549701_-	penicillin-binding protein 1B	NA	NA	NA	NA
WP_100222603.1\|1549871_1550962_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_171503524.1\|1551111_1552020_+	NAD(+) kinase	NA	NA	NA	NA
WP_004638685.1\|1552016_1552289_+	YeaC family protein	NA	NA	NA	NA
WP_160132116.1\|1552500_1555065_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	1.4e-290	53.5
WP_005081062.1\|1555337_1556855_+	hypothetical protein	NA	NA	NA	NA
WP_005081059.1\|1556857_1557922_+	hypothetical protein	NA	NA	NA	NA
WP_160132117.1\|1558017_1558563_+	hypothetical protein	NA	NA	NA	NA
WP_010326927.1\|1558575_1559601_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7

DBSCAN-SWA_10

1570362 : 1620143

Enterobacteria_phage(25.0%)

transposase,tRNA,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017396695.1\|1570362_1571295_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.6e-58	40.9
WP_125316770.1\|1571528_1572425_-	DUF4882 domain-containing protein	NA	NA	NA	NA
WP_125316769.1\|1572583_1573597_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_125316768.1\|1573593_1576146_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_004638785.1\|1576207_1576939_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_004638786.1\|1577025_1577559_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_004638790.1\|1578028_1578376_+	hypothetical protein	NA	NA	NA	NA
WP_004638793.1\|1578496_1578709_+	hypothetical protein	NA	NA	NA	NA
WP_004638794.1\|1578758_1579760_-	biotin synthase BioB	NA	NA	NA	NA
WP_171057911.1\|1579827_1580907_-\|tRNA	tRNA epoxyqueuosine(34) reductase QueG	NA	NA	NA	NA
WP_005090753.1\|1580975_1582484_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_004638800.1\|1582490_1583036_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_004638801.1\|1583603_1583822_+	hypothetical protein	NA	NA	NA	NA
WP_004638802.1\|1583932_1584142_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	4.4e-17	65.0
WP_100222743.1\|1584246_1585471_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.6e-21	33.1
WP_004638805.1\|1585763_1585976_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	9.0e-18	68.3
WP_100222603.1\|1586929_1588019_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004638809.1\|1588819_1588981_+	hypothetical protein	NA	NA	NA	NA
WP_118902436.1\|1589094_1589529_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_125316765.1\|1589728_1590289_+	FxsA family protein	NA	NA	NA	NA
WP_004638813.1\|1590334_1590508_-	hypothetical protein	NA	NA	NA	NA
WP_171055746.1\|1590748_1591006_+	hypothetical protein	NA	NA	NA	NA
WP_118902433.1\|1591075_1592242_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.6e-124	61.1
WP_005081009.1\|1592623_1594612_+	transketolase	NA	NA	NA	NA
WP_160132118.1\|1596043_1596670_+	hypothetical protein	NA	NA	NA	NA
WP_005081004.1\|1596706_1597117_-	OsmC family protein	NA	NA	NA	NA
WP_005081001.1\|1597226_1598318_-	hypothetical protein	NA	NA	NA	NA
WP_004638828.1\|1598591_1599173_+	polyisoprenoid-binding protein	NA	NA	NA	NA
WP_005080999.1\|1599253_1599793_-	N-acetyltransferase	NA	NA	NA	NA
WP_005080997.1\|1599824_1600082_-	hypothetical protein	NA	NA	NA	NA
WP_004638832.1\|1600340_1600874_-	lecithin retinol acyltransferase family protein	NA	NA	NA	NA
WP_005080995.1\|1601032_1601767_+	phosphodiester glycosidase family protein	NA	NA	NA	NA
WP_017394697.1\|1601805_1602033_-	hypothetical protein	NA	NA	NA	NA
WP_005080993.1\|1602281_1603367_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	NA	NA	NA	NA
WP_005080991.1\|1603542_1603989_+	DUF4265 domain-containing protein	NA	NA	NA	NA
WP_005080989.1\|1604047_1607812_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_004638843.1\|1608012_1608504_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_005080988.1\|1608547_1610044_-	sodium/proline symporter PutP	NA	NA	NA	NA
WP_004638847.1\|1610612_1610987_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005080985.1\|1611083_1612109_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_005080982.1\|1612238_1612679_-	MaoC family dehydratase	NA	NA	NA	NA
WP_005080980.1\|1612678_1614529_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	2.1e-25	25.7
WP_118902430.1\|1614719_1616576_+\|capsid	phage capsid protein	A0A1D8EQB5	Escherichia_phage	1.5e-108	37.2
WP_008941507.1\|1616860_1617037_+	hypothetical protein	NA	NA	NA	NA
WP_100222603.1\|1617157_1618247_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_005274609.1\|1619213_1620143_+\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3

DBSCAN-SWA_11

1628720 : 1676417

Enterobacteria_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005064486.1\|1628720_1629653_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.0e-60	41.9
WP_017395859.1\|1629723_1630062_-\|transposase	transposase	NA	NA	NA	NA
WP_160132119.1\|1630153_1630435_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_160132120.1\|1630482_1631630_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_118902427.1\|1632073_1633237_-	cupin domain-containing protein	NA	NA	NA	NA
WP_118902424.1\|1633429_1635454_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.7e-41	34.0
WP_161412332.1\|1635510_1635837_-	hypothetical protein	NA	NA	NA	NA
WP_005080957.1\|1636012_1637596_-\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_079398519.1\|1637670_1637967_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_001055585.1\|1638002_1638386_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_160132121.1\|1638407_1639493_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_075315520.1\|1639715_1640228_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_004638888.1\|1640245_1641274_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_075315521.1\|1641288_1642410_+	YdcF family protein	NA	NA	NA	NA
WP_005090707.1\|1642409_1643438_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_161401269.1\|1643466_1644864_-	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_017396695.1\|1645371_1646304_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.6e-58	40.9
WP_118902418.1\|1646525_1647005_+	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_118903121.1\|1647347_1648502_+	MFS transporter	NA	NA	NA	NA
WP_075315524.1\|1648504_1649995_-	amidase	NA	NA	NA	NA
WP_004638902.1\|1650191_1650668_+	hypothetical protein	NA	NA	NA	NA
WP_004638905.1\|1650715_1652080_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_004638908.1\|1652097_1652517_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_005090700.1\|1652542_1652992_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_160132122.1\|1653704_1654739_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_004638917.1\|1654739_1655330_-	ANTAR domain-containing protein	NA	NA	NA	NA
WP_004638920.1\|1655852_1657211_+	MFS transporter	NA	NA	NA	NA
WP_171455243.1\|1657250_1659785_+	nitrite reductase large subunit	NA	NA	NA	NA
WP_118902414.1\|1659796_1661416_+	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_118902411.1\|1661502_1664283_+	nitrate reductase	NA	NA	NA	NA
WP_005090691.1\|1664279_1664909_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_160132123.1\|1664950_1666282_-	D-serine ammonia-lyase	NA	NA	NA	NA
WP_087486619.1\|1667614_1668833_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_005090686.1\|1670565_1671597_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_005090684.1\|1671622_1671874_+	MoaD/ThiS family protein	NA	NA	NA	NA
WP_005090682.1\|1671875_1672388_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_004638941.1\|1672405_1673329_+	bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB	NA	NA	NA	NA
WP_075315534.1\|1673328_1674564_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005080915.1\|1674722_1675205_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_088631513.1\|1675326_1676417_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA

DBSCAN-SWA_12

1769008 : 1837610

Faecalibacterium_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100834114.1\|1769008_1770153_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_125316755.1\|1770203_1770455_+	hypothetical protein	NA	NA	NA	NA
WP_125316754.1\|1770469_1770799_+	hypothetical protein	NA	NA	NA	NA
WP_005090547.1\|1771049_1771724_-	DUF4145 domain-containing protein	NA	NA	NA	NA
WP_005090546.1\|1771765_1772074_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005090545.1\|1772070_1773402_-	HipA domain-containing protein	NA	NA	NA	NA
WP_005090543.1\|1773639_1774338_+	DUF1826 domain-containing protein	NA	NA	NA	NA
WP_080631714.1\|1774532_1775558_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_160132126.1\|1775548_1776643_-	WG repeat-containing protein	NA	NA	NA	NA
WP_080631714.1\|1776635_1777661_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_115736425.1\|1777767_1779960_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_075316505.1\|1780175_1780607_+	SRPBCC family protein	NA	NA	NA	NA
WP_075315587.1\|1780783_1781665_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_075315588.1\|1781895_1782600_+	CoA transferase subunit A	NA	NA	NA	NA
WP_075315589.1\|1782601_1783249_+	CoA transferase subunit B	NA	NA	NA	NA
WP_008941408.1\|1783324_1784497_+	thiolase family protein	NA	NA	NA	NA
WP_008941407.1\|1784732_1786097_-	MFS transporter	NA	NA	NA	NA
WP_008941406.1\|1786191_1787466_-	porin	NA	NA	NA	NA
WP_008941404.1\|1788894_1790589_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.8e-28	24.8
WP_004639168.1\|1790699_1791293_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_017396625.1\|1791462_1792635_+	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_008941402.1\|1792659_1794261_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	6.0e-21	70.8
WP_008941401.1\|1794270_1795074_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_017396624.1\|1795085_1797077_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_008941399.1\|1797073_1797976_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.2e-49	40.4
WP_026056311.1\|1798079_1799036_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008941397.1\|1799239_1802710_+	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_005090523.1\|1802812_1803148_-	DUF3325 domain-containing protein	NA	NA	NA	NA
WP_125316752.1\|1803144_1804839_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_005090518.1\|1804843_1805191_-	hypothetical protein	NA	NA	NA	NA
WP_005090517.1\|1805359_1805785_-	YbaN family protein	NA	NA	NA	NA
WP_005090515.1\|1805896_1806493_-	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_008941393.1\|1806526_1807441_-	energy transducer TonB	NA	NA	NA	NA
WP_017396727.1\|1807450_1808938_-	DUF560 domain-containing protein	NA	NA	NA	NA
WP_008941391.1\|1809019_1809811_-	transferrin-binding protein-like solute binding protein	NA	NA	NA	NA
WP_008941389.1\|1813300_1814305_-	FecR domain-containing protein	NA	NA	NA	NA
WP_161412328.1\|1814305_1814827_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_008941387.1\|1815015_1815960_+	ABC transporter permease	NA	NA	NA	NA
WP_004639185.1\|1815959_1816838_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-37	37.3
WP_008941386.1\|1816991_1818014_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008941385.1\|1818078_1818513_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_080631714.1\|1820680_1821706_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_160132127.1\|1822258_1825864_-	urea carboxylase	NA	NA	NA	NA
WP_008942416.1\|1825867_1826521_-	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_115736418.1\|1826538_1827276_-	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_004639193.1\|1827547_1828027_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_115736417.1\|1828157_1828796_+	LysE family translocator	NA	NA	NA	NA
WP_001055585.1\|1829731_1830115_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_079398519.1\|1830150_1830447_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|1830521_1832105_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_115736416.1\|1832216_1833290_-	amidohydrolase family protein	NA	NA	NA	NA
WP_115736415.1\|1833625_1835830_-	OsmC domain/YcaO domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|1836677_1837610_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9

DBSCAN-SWA_13

2184935 : 2240338

Acinetobacter_phage(63.41%)

transposase,integrase,terminase,tail,capsid

attL 2183954:2183969|attR 2203004:2203019

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2183954:2183969	attL	NA	NA	NA	NA
WP_020846310.1\|2184935_2185868_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_125317038.1\|2186189_2187338_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_160124242.1\|2187327_2188368_+	hypothetical protein	NA	NA	NA	NA
WP_125317006.1\|2188461_2188728_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_125317037.1\|2189144_2189408_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_004671840.1\|2189391_2189655_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_125317036.1\|2190025_2191078_+	hypothetical protein	NA	NA	NA	NA
WP_125317005.1\|2191163_2192372_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.1e-62	38.2
WP_004639596.1\|2192717_2194748_-	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_004639597.1\|2194917_2195307_+	hypothetical protein	NA	NA	NA	NA
WP_004639599.1\|2195537_2196881_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	7.6e-54	79.4
WP_004639601.1\|2197073_2197757_+	pirin family protein	NA	NA	NA	NA
WP_161403048.1\|2198532_2198652_+	hypothetical protein	NA	NA	NA	NA
WP_100223926.1\|2198873_2200038_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.5e-138	84.9
WP_004639604.1\|2200418_2200628_-	hypothetical protein	NA	NA	NA	NA
WP_005089862.1\|2200966_2201143_+	hypothetical protein	NA	NA	NA	NA
WP_160132132.1\|2201898_2202453_-	glycoside hydrolase family protein	I2GUG4	Acinetobacter_phage	1.4e-73	76.1
WP_160132133.1\|2202449_2202827_-	hypothetical protein	A0A2H4JFC0	uncultured_Caudovirales_phage	1.8e-29	59.8
WP_160132134.1\|2202901_2206576_-	hypothetical protein	NA	NA	NA	NA
2203004:2203019	attR	NA	NA	NA	NA
WP_160132104.1\|2206634_2209457_-	hypothetical protein	A0A1B1P9G8	Acinetobacter_phage	1.9e-142	35.2
WP_160132281.1\|2209453_2209774_-	hypothetical protein	NA	NA	NA	NA
WP_160132103.1\|2209773_2210259_-	DUF1833 family protein	NA	NA	NA	NA
WP_160132102.1\|2210251_2210740_-	hypothetical protein	NA	NA	NA	NA
WP_160132101.1\|2210801_2211188_-	hypothetical protein	J7I476	Acinetobacter_phage	9.5e-42	65.6
WP_160132100.1\|2211180_2211939_-	hypothetical protein	J7HXF9	Acinetobacter_phage	3.5e-88	64.3
WP_160132135.1\|2212020_2214801_-\|tail	phage tail tape measure protein	A0A1B1P9E6	Acinetobacter_phage	5.4e-62	29.1
WP_160132136.1\|2214866_2215466_-	hypothetical protein	NA	NA	NA	NA
WP_160132137.1\|2215542_2215869_-	hypothetical protein	NA	NA	NA	NA
WP_160132138.1\|2215865_2216651_-	phage antirepressor KilAC domain-containing protein	A0A0H3UZF1	Geobacillus_virus	4.1e-23	49.5
WP_160132139.1\|2216647_2216938_-	hypothetical protein	NA	NA	NA	NA
WP_075175435.1\|2217016_2217181_-	Arc family DNA-binding protein	A0A0P0I460	Acinetobacter_phage	2.1e-06	51.9
WP_160132140.1\|2217323_2217581_+	Arc family DNA-binding protein	A0A0P0IVR2	Acinetobacter_phage	6.2e-05	32.5
WP_160132283.1\|2217661_2217937_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	5.4e-23	62.5
WP_160132141.1\|2217933_2218434_-	hypothetical protein	NA	NA	NA	NA
WP_160132142.1\|2218489_2219404_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.2e-35	31.4
WP_160132143.1\|2219467_2219830_-	hypothetical protein	NA	NA	NA	NA
WP_160132284.1\|2219826_2220366_-	hypothetical protein	A5VW58	Enterobacteria_phage	2.7e-34	49.7
WP_160132090.1\|2220521_2220932_-	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	2.4e-14	31.9
WP_160132089.1\|2220928_2221303_-	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	7.6e-20	42.9
WP_160132088.1\|2221305_2221563_-	hypothetical protein	NA	NA	NA	NA
WP_160132279.1\|2221559_2221934_-	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	2.4e-21	44.4
WP_004731333.1\|2221933_2222308_-	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	3.5e-33	57.4
WP_160132087.1\|2222311_2222896_-	HeH/LEM domain protein	J7I4P7	Acinetobacter_phage	4.7e-08	54.2
WP_160132086.1\|2222946_2223903_-	hypothetical protein	A0A0M3LQL5	Mannheimia_phage	9.4e-115	67.2
WP_160132085.1\|2223923_2224676_-	hypothetical protein	J7I0W4	Acinetobacter_phage	1.0e-68	58.8
WP_160132084.1\|2224783_2225023_-	hypothetical protein	A0A1S5SBT9	Streptococcus_phage	4.5e-18	57.3
WP_160132083.1\|2225019_2226138_-\|capsid	minor capsid protein	A0A0P0IR98	Acinetobacter_phage	5.7e-111	55.0
WP_160132082.1\|2226140_2227577_-	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	1.2e-118	46.3
WP_160132081.1\|2227578_2229072_-\|terminase	terminase	A0A2H4J8J8	uncultured_Caudovirales_phage	1.8e-205	69.9
WP_160132080.1\|2229084_2229609_-\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	2.7e-39	53.1
WP_160132079.1\|2229613_2230090_-	hypothetical protein	A0A2H4JDI9	uncultured_Caudovirales_phage	1.2e-57	67.5
WP_160132078.1\|2230140_2230548_-	hypothetical protein	NA	NA	NA	NA
WP_160132077.1\|2230544_2231102_-	DUF4065 domain-containing protein	NA	NA	NA	NA
WP_160132076.1\|2231176_2231452_-	DUF968 domain-containing protein	A0A1B1P9J2	Acinetobacter_phage	2.9e-37	82.4
WP_160132075.1\|2231402_2231606_-	hypothetical protein	A0A1B1P9J1	Acinetobacter_phage	7.8e-19	69.7
WP_160132074.1\|2232254_2232800_-	hypothetical protein	A0A0D4DCD6	Acinetobacter_phage	7.8e-82	83.1
WP_160132278.1\|2232809_2233004_-	hypothetical protein	NA	NA	NA	NA
WP_160132073.1\|2233218_2233650_-	VRR-NUC domain-containing protein	A0A0D4DBJ8	Acinetobacter_phage	3.5e-61	80.1
WP_160132072.1\|2233646_2233820_-	hypothetical protein	NA	NA	NA	NA
WP_160132071.1\|2233812_2234208_-	hypothetical protein	NA	NA	NA	NA
WP_160132144.1\|2234207_2234603_-	hypothetical protein	NA	NA	NA	NA
WP_160132145.1\|2234599_2235226_-	DNA cytosine methyltransferase	A0A2I7QXI9	Vibrio_phage	2.6e-73	58.6
WP_160132146.1\|2235222_2235672_-	peroxidase	NA	NA	NA	NA
WP_160132147.1\|2235668_2236991_-	AAA family ATPase	A0A2H4J6D5	uncultured_Caudovirales_phage	1.0e-159	73.2
WP_160132148.1\|2236990_2237782_-	hypothetical protein	I3PUZ7	Vibrio_phage	2.3e-10	40.5
WP_171503525.1\|2237781_2237937_-	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	4.4e-14	87.2
WP_004769486.1\|2237976_2238351_-	helix-turn-helix domain-containing protein	A0A0N7IRF8	Acinetobacter_phage	1.4e-34	62.5
WP_005145850.1\|2238359_2238560_-	helix-turn-helix transcriptional regulator	A0A0P0IKT3	Acinetobacter_phage	9.0e-28	89.4
WP_160132149.1\|2238673_2239336_+	helix-turn-helix domain-containing protein	A0A0P0IYD9	Acinetobacter_phage	1.1e-106	88.2
WP_160132062.1\|2239459_2240338_+	site-specific DNA-methyltransferase	C5IHN3	Burkholderia_virus	3.3e-74	48.5

DBSCAN-SWA_14

2243415 : 2248558

Acinetobacter_phage(33.33%)

integrase

attL 2243495:2243510|attR 2249717:2249732

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160132153.1\|2243415_2244468_+	hypothetical protein	A0A1B0VN89	Pseudomonas_phage	6.0e-22	39.2
2243495:2243510	attL	NA	NA	NA	NA
WP_160132154.1\|2244478_2245276_+	recombinase RecT	G9L6A2	Escherichia_phage	3.4e-57	57.6
WP_160132155.1\|2245262_2245901_+	hypothetical protein	A0A1X9SFE6	Acinetobacter_phage	2.9e-43	46.3
WP_160132285.1\|2245900_2246179_+	hypothetical protein	K4HYN5	Acinetobacter_phage	4.2e-31	78.6
WP_160132156.1\|2246178_2246523_+	hypothetical protein	NA	NA	NA	NA
WP_160132157.1\|2246522_2246864_+	hypothetical protein	NA	NA	NA	NA
WP_160132158.1\|2246856_2247246_+	hypothetical protein	A0A2H4JCC6	uncultured_Caudovirales_phage	1.7e-22	48.1
WP_160132159.1\|2247245_2247533_+	HTH domain-containing protein	NA	NA	NA	NA
WP_160132160.1\|2247544_2248558_-\|integrase	tyrosine-type recombinase/integrase	A0A0R6PHH4	Moraxella_phage	5.7e-86	51.0
2249717:2249732	attR	NA	NA	NA	NA

DBSCAN-SWA_15

2293937 : 2372955

Bordetella_phage(25.0%)

integrase,transposase,head,terminase,protease,tRNA,tail

attL 2331371:2331426|attR 2373740:2373795

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005084709.1\|2293937_2294945_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.3e-124	66.1
WP_005084707.1\|2295089_2295305_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_004639869.1\|2295334_2295781_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	4.2e-17	40.8
WP_005084704.1\|2295856_2296216_-	hypothetical protein	NA	NA	NA	NA
WP_005089750.1\|2296252_2296618_-	GFA family protein	NA	NA	NA	NA
WP_125316992.1\|2296664_2297159_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_075315274.1\|2297218_2298661_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_008942019.1\|2298785_2299373_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_125316991.1\|2299474_2300440_-	D-glycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.2e-16	28.2
WP_075315268.1\|2300457_2301108_-	hypothetical protein	NA	NA	NA	NA
WP_125316990.1\|2301375_2302476_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_125316989.1\|2302642_2303941_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	9.8e-107	46.7
WP_004639896.1\|2303945_2304557_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.8e-48	55.3
WP_004639899.1\|2304845_2305076_+	hypothetical protein	NA	NA	NA	NA
WP_026056278.1\|2305220_2305448_-	hypothetical protein	NA	NA	NA	NA
WP_087486619.1\|2306322_2307542_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_020846310.1\|2307612_2308545_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_004639911.1\|2310126_2311056_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_100222741.1\|2311529_2312297_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_005084671.1\|2312429_2312648_-	hypothetical protein	NA	NA	NA	NA
WP_160132162.1\|2313266_2315906_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.7e-36	22.0
WP_005084667.1\|2316015_2316555_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004639922.1\|2316803_2317133_+	ferredoxin family protein	NA	NA	NA	NA
WP_171057129.1\|2317308_2317965_+	peptidase M15	NA	NA	NA	NA
WP_005084663.1\|2318099_2318768_+	O-methyltransferase	S5YRC3	Mycobacterium_phage	1.3e-25	36.7
WP_005084661.1\|2318887_2319730_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	5.9e-36	33.9
WP_125316988.1\|2319846_2320461_-	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	8.1e-11	52.4
WP_005084657.1\|2320453_2321053_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.1e-20	38.4
WP_004639933.1\|2321146_2322337_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_005084655.1\|2322349_2324473_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-29	24.5
WP_005084653.1\|2324469_2326005_-	TolC family protein	NA	NA	NA	NA
WP_005084652.1\|2326194_2326941_-	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-21	26.9
WP_005084650.1\|2326940_2327489_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_005084648.1\|2327472_2328021_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_004639946.1\|2328065_2328605_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_005084646.1\|2328608_2329586_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	8.9e-36	31.7
WP_125316987.1\|2329861_2331283_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-54	31.5
2331371:2331426	attL	NA	NA	NA	NA
WP_160132163.1\|2331636_2332653_+\|integrase	tyrosine-type recombinase/integrase	A0A0R6PHH4	Moraxella_phage	1.0e-66	41.1
WP_160132164.1\|2332664_2332889_+	hypothetical protein	NA	NA	NA	NA
WP_160132165.1\|2333076_2333601_-	secretion activator protein	A0A2H4J8Q8	uncultured_Caudovirales_phage	6.4e-73	75.0
WP_160132286.1\|2333611_2333983_-	hypothetical protein	A0A2H4JFC0	uncultured_Caudovirales_phage	8.0e-38	65.0
WP_160132166.1\|2338459_2345275_-	GNAT family N-acetyltransferase	Q775D4	Bordetella_phage	8.7e-45	25.3
WP_160132167.1\|2345833_2348086_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_160132168.1\|2348085_2348574_-	hypothetical protein	NA	NA	NA	NA
WP_160132169.1\|2348575_2349043_-	DUF2833 domain-containing protein	NA	NA	NA	NA
WP_160132170.1\|2349039_2351037_-	hypothetical protein	Q775D1	Bordetella_phage	5.5e-133	39.5
WP_160132171.1\|2351036_2351591_-	hypothetical protein	NA	NA	NA	NA
WP_160132172.1\|2351607_2351790_-	hypothetical protein	NA	NA	NA	NA
WP_160132173.1\|2351802_2352207_-	hypothetical protein	NA	NA	NA	NA
WP_160132174.1\|2352220_2353243_-	hypothetical protein	Q775C7	Bordetella_phage	7.3e-89	49.6
WP_160132175.1\|2353260_2353884_-	hypothetical protein	A0A2I7RHR0	Vibrio_phage	7.5e-12	35.1
WP_160132176.1\|2353846_2354176_-	hypothetical protein	NA	NA	NA	NA
WP_160132177.1\|2354168_2355857_-\|head,tail	phage head-tail adapter protein	G9L6C2	Escherichia_phage	8.7e-71	31.1
WP_160132178.1\|2355858_2356137_-	hypothetical protein	NA	NA	NA	NA
WP_160132179.1\|2356212_2357835_-\|terminase	terminase	Q775B9	Bordetella_phage	2.9e-180	58.7
WP_160132180.1\|2357834_2358161_-	hypothetical protein	NA	NA	NA	NA
WP_160132181.1\|2358153_2358729_-\|terminase	terminase small subunit	A0A0M3LSU1	Mannheimia_phage	3.9e-23	45.7
WP_160132183.1\|2359150_2361751_-	PriCT-2 domain-containing protein	Q775B5	Bordetella_phage	1.9e-271	53.9
WP_160132184.1\|2361747_2362119_-	hypothetical protein	NA	NA	NA	NA
WP_171503527.1\|2362115_2362274_-	hypothetical protein	NA	NA	NA	NA
WP_160132185.1\|2362270_2362528_-	helix-turn-helix domain-containing protein	A0A1C9IHV8	Salmonella_phage	7.6e-11	51.5
WP_160132186.1\|2362665_2363286_+	helix-turn-helix domain-containing protein	A2I308	Vibrio_virus	4.5e-25	37.4
WP_160132187.1\|2363431_2363872_+	hypothetical protein	NA	NA	NA	NA
WP_171503528.1\|2363868_2364027_+	hypothetical protein	NA	NA	NA	NA
WP_160132188.1\|2364036_2364705_+	hypothetical protein	NA	NA	NA	NA
WP_160132189.1\|2364708_2365998_+	DUF2800 domain-containing protein	B6SCX9	Bacteriophage	6.3e-98	46.4
WP_160132190.1\|2366011_2366569_+	DUF2815 family protein	Q775A5	Bordetella_phage	3.3e-59	60.2
WP_160132191.1\|2366732_2367062_+	hypothetical protein	G3EN79	Psychrobacter_phage	1.6e-18	50.5
WP_160132192.1\|2367121_2367940_+	DUF2303 family protein	NA	NA	NA	NA
WP_160132193.1\|2368048_2370112_+	DNA polymerase I	Q775A3	Bordetella_phage	2.1e-260	64.7
WP_160132194.1\|2370116_2370722_+	hypothetical protein	Q8HAP4	Burkholderia_phage	4.4e-09	33.8
WP_171503529.1\|2370733_2370895_+	hypothetical protein	NA	NA	NA	NA
WP_160132195.1\|2370875_2371139_+	VRR-NUC domain-containing protein	Q775A2	Bordetella_phage	6.5e-26	68.6
WP_160132196.1\|2371135_2371564_+	hypothetical protein	NA	NA	NA	NA
WP_160132197.1\|2371560_2372955_+	ATP-dependent helicase	Q774Z8	Bordetella_phage	3.9e-194	68.6
2373740:2373795	attR	NA	NA	NA	NA

DBSCAN-SWA_16

2452235 : 2646399

174

Enterobacteria_phage(23.26%)

transposase,tRNA,integrase,protease

attL 2546807:2546823|attR 2577482:2577498

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020846310.1\|2452235_2453168_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005084518.1\|2453852_2457683_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	3.7e-101	52.4
WP_005084516.1\|2458035_2459376_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_005084515.1\|2459508_2460114_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_005084513.1\|2460121_2461120_+	Holliday junction branch migration DNA helicase RuvB	NA	NA	NA	NA
WP_005084511.1\|2461131_2461794_+	hypothetical protein	NA	NA	NA	NA
WP_004640100.1\|2461885_2462299_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_005084509.1\|2462318_2463017_+	protein TolQ	NA	NA	NA	NA
WP_004640103.1\|2463016_2463469_+	protein TolR	NA	NA	NA	NA
WP_020846167.1\|2463472_2464705_+	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_005084503.1\|2464804_2466088_+	Tol-Pal system beta propeller repeat protein TolB	NA	NA	NA	NA
WP_004641816.1\|2466110_2466674_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_004640107.1\|2466714_2466903_-	hypothetical protein	NA	NA	NA	NA
WP_005084499.1\|2467079_2468054_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	5.6e-46	35.5
WP_005084497.1\|2468107_2468884_+	RNA methyltransferase	NA	NA	NA	NA
WP_005084495.1\|2469042_2469654_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_004640114.1\|2469646_2469970_+	hypothetical protein	NA	NA	NA	NA
WP_004640116.1\|2469959_2470349_+	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_020846195.1\|2470405_2470522_-	GlyGly-CTERM sorting domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|2470561_2471494_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_125316983.1\|2471501_2471756_-	CSLREA domain-containing protein	NA	NA	NA	NA
WP_004640121.1\|2471868_2472567_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_005084490.1\|2472587_2473784_-	AI-2E family transporter	NA	NA	NA	NA
WP_004640125.1\|2473917_2474988_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.2e-78	46.7
WP_171055806.1\|2474984_2475614_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.5e-28	37.9
WP_005084488.1\|2475660_2476458_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005084487.1\|2476604_2477627_-	signal peptide peptidase SppA	A0A2I6UH21	Salinibacter_virus	5.0e-13	27.2
WP_005084485.1\|2477766_2478723_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_005084481.1\|2478711_2481150_-	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	8.8e-16	45.9
WP_004640139.1\|2481233_2481920_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	2.9e-33	37.8
WP_005084477.1\|2481912_2483148_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_004640143.1\|2483173_2483758_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_004640144.1\|2483772_2484666_-	EamA family transporter	NA	NA	NA	NA
WP_004640146.1\|2484673_2485144_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_005084475.1\|2485352_2486291_+	hypothetical protein	NA	NA	NA	NA
WP_004757630.1\|2486326_2486470_+	hypothetical protein	NA	NA	NA	NA
WP_100222743.1\|2486534_2487760_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.6e-21	33.1
WP_005086184.1\|2487864_2488944_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.0e-89	49.6
WP_020846310.1\|2489184_2490117_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_008941743.1\|2490305_2491802_+	TolC family protein	NA	NA	NA	NA
WP_004757626.1\|2491814_2492975_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004640160.1\|2492978_2494109_+	ABC transporter permease	NA	NA	NA	NA
WP_004682706.1\|2494105_2495218_+	ABC transporter permease	NA	NA	NA	NA
WP_160132200.1\|2495242_2497972_-	DNA gyrase subunit A	A0A172JHV7	Bacillus_phage	2.2e-92	28.5
WP_005028482.1\|2498386_2499379_+\|transposase	IS5-like element ISAba23 family transposase	NA	NA	NA	NA
WP_005086188.1\|2499568_2500084_-	DinB family protein	NA	NA	NA	NA
WP_004952903.1\|2500199_2501132_-	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
WP_005086189.1\|2501149_2501899_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_161414287.1\|2502337_2503225_-	tyrosine recombinase	A0A0K0MWE8	Gordonia_phage	9.6e-13	29.1
WP_005086190.1\|2503381_2503993_+	LysE family translocator	NA	NA	NA	NA
WP_004640183.1\|2503989_2504664_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005086192.1\|2504663_2505518_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_005086193.1\|2505523_2506774_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_005086194.1\|2506796_2507036_-	lipoprotein	NA	NA	NA	NA
WP_005086196.1\|2507368_2508868_-	alanine:cation symporter family protein	NA	NA	NA	NA
WP_005086199.1\|2509225_2510614_+	DNA repair protein RadA	NA	NA	NA	NA
WP_005086202.1\|2510696_2511767_+	Tim44 domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|2512264_2513197_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_001055585.1\|2514527_2514911_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_079398519.1\|2514946_2515243_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|2515317_2516901_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_171057142.1\|2517050_2518580_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_125316982.1\|2519118_2522805_+	methionine synthase	A0A140XBC7	Dickeya_phage	5.6e-14	60.0
WP_005084465.1\|2522877_2523528_-	hypothetical protein	NA	NA	NA	NA
WP_020846310.1\|2523628_2524561_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005084463.1\|2524590_2524827_-	hypothetical protein	NA	NA	NA	NA
WP_005084461.1\|2525028_2525514_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.9e-19	44.3
WP_004640207.1\|2525645_2526137_-	DUF2505 family protein	NA	NA	NA	NA
WP_005084458.1\|2526244_2526535_-	hypothetical protein	NA	NA	NA	NA
WP_005084454.1\|2526624_2527065_+	universal stress protein	NA	NA	NA	NA
WP_125316981.1\|2527118_2528282_-	alanine racemase	NA	NA	NA	NA
WP_005084451.1\|2528397_2529681_-	FAD-binding protein	NA	NA	NA	NA
WP_005084449.1\|2529677_2531426_-	neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein	NA	NA	NA	NA
WP_005084447.1\|2531489_2532587_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_005084445.1\|2532874_2533720_-	taurine dioxygenase	NA	NA	NA	NA
WP_005084443.1\|2533750_2534632_-	taurine ABC transporter permease TauC	NA	NA	NA	NA
WP_005084441.1\|2534628_2535420_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.7e-29	36.3
WP_020846271.1\|2535429_2536470_-	taurine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005084436.1\|2536683_2537607_+	chromate resistance protein	NA	NA	NA	NA
WP_005084433.1\|2537609_2538953_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.6e-30	67.4
WP_005084431.1\|2538965_2539583_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.4e-16	32.8
WP_005084430.1\|2539579_2540275_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_005084428.1\|2540271_2541042_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001223318.1\|2541238_2541940_+\|transposase	IS1-like element ISPa14 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_020846310.1\|2542202_2543135_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005274609.1\|2545722_2546652_-\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
2546807:2546823	attL	NA	NA	NA	NA
WP_005089530.1\|2547886_2548666_+	hypothetical protein	NA	NA	NA	NA
WP_005089529.1\|2548751_2548976_-	hypothetical protein	NA	NA	NA	NA
WP_005089528.1\|2548985_2550389_-	glutamine synthetase	NA	NA	NA	NA
WP_005196405.1\|2550501_2551203_-	response regulator transcription factor	NA	NA	NA	NA
WP_005196404.1\|2551214_2553863_-	sensor histidine kinase KdpD	B5LWN0	Feldmannia_species_virus	6.2e-15	26.8
WP_005089524.1\|2553876_2554488_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_005089522.1\|2554497_2556510_-	potassium-transporting ATPase subunit KdpB	E4ZFI9	Streptococcus_phage	4.0e-38	27.6
WP_171065224.1\|2556526_2558245_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_005089519.1\|2558428_2559079_+	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_005196403.1\|2559090_2560425_+	hypothetical protein	NA	NA	NA	NA
WP_160132202.1\|2561266_2562169_-	hydrolase or metal-binding protein	NA	NA	NA	NA
WP_008941908.1\|2562310_2563432_-	YqaJ viral recombinase family protein	A0A139ZPJ9	Marinitoga_camini_virus	1.2e-41	42.1
WP_017396539.1\|2563611_2564652_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.1e-59	39.6
WP_080591903.1\|2564680_2564971_-	hypothetical protein	NA	NA	NA	NA
WP_026056280.1\|2565076_2565412_-	hypothetical protein	NA	NA	NA	NA
WP_008941912.1\|2565481_2566159_-	hypothetical protein	NA	NA	NA	NA
WP_008941913.1\|2566174_2566672_-	hypothetical protein	NA	NA	NA	NA
WP_004669027.1\|2566733_2566883_-	hypothetical protein	NA	NA	NA	NA
WP_004669028.1\|2566895_2567153_-	hypothetical protein	NA	NA	NA	NA
WP_004669030.1\|2567275_2567611_-	hypothetical protein	NA	NA	NA	NA
WP_008941915.1\|2567615_2568647_-	hypothetical protein	NA	NA	NA	NA
WP_008941916.1\|2569176_2569497_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_008941917.1\|2569520_2570357_-	hypothetical protein	NA	NA	NA	NA
WP_008941918.1\|2571244_2572450_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_005082419.1\|2572455_2573463_+	hypothetical protein	NA	NA	NA	NA
WP_005082417.1\|2573578_2573845_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_005274609.1\|2574883_2575813_+\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
WP_160132203.1\|2575835_2575988_-	hypothetical protein	NA	NA	NA	NA
WP_005084955.1\|2576110_2577316_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	7.3e-64	38.5
WP_125316950.1\|2577681_2578158_-	transcription elongation factor GreB	NA	NA	NA	NA
2577482:2577498	attR	NA	NA	NA	NA
WP_005084391.1\|2578532_2579642_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_004640249.1\|2579689_2580073_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_004640251.1\|2580269_2581175_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.1e-91	64.2
WP_161414322.1\|2581758_2582535_+	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	9.2e-36	53.7
WP_004640254.1\|2582752_2583658_+\|protease	protease HtpX	NA	NA	NA	NA
WP_005084386.1\|2583720_2584299_-	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_004640257.1\|2584375_2585713_-	magnesium transporter	NA	NA	NA	NA
WP_005084384.1\|2585992_2589094_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_005084382.1\|2589435_2591049_+	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_005084380.1\|2591255_2592395_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_005084378.1\|2592444_2593047_-	nicotinamide mononucleotide transporter	K4FAY9	Cronobacter_phage	4.8e-08	29.9
WP_005084376.1\|2593496_2594444_+	DMT family transporter	NA	NA	NA	NA
WP_005084373.1\|2594598_2596197_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_171057132.1\|2596227_2596518_-	hypothetical protein	NA	NA	NA	NA
WP_005084369.1\|2596651_2598271_-	VWA domain-containing protein	NA	NA	NA	NA
WP_005084367.1\|2598397_2599249_-	dihydropteroate synthase	NA	NA	NA	NA
WP_004640283.1\|2599382_2601278_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	2.6e-108	46.8
WP_004640284.1\|2601415_2602066_-	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_004640287.1\|2602330_2602657_+	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_005084362.1\|2602662_2603199_+	DOMON-like domain-containing protein	NA	NA	NA	NA
WP_004640291.1\|2603251_2603794_-	hypothetical protein	NA	NA	NA	NA
WP_004640293.1\|2604154_2605294_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
WP_008941573.1\|2605308_2608542_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_004640296.1\|2608634_2609111_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_005091342.1\|2609287_2610328_-\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	7.7e-171	82.7
WP_160132204.1\|2610691_2611354_+	antibiotic acetyltransferase	NA	NA	NA	NA
WP_020846310.1\|2611321_2612254_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005089448.1\|2612675_2613113_+	universal stress protein	NA	NA	NA	NA
WP_005084354.1\|2613292_2613607_-	MGMT family protein	NA	NA	NA	NA
WP_005089446.1\|2613689_2614250_+	hypothetical protein	NA	NA	NA	NA
WP_160132205.1\|2614278_2615211_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.2e-55	39.9
WP_004640318.1\|2615635_2616526_-	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	2.9e-33	37.3
WP_004640320.1\|2616569_2617487_-	DUF808 domain-containing protein	NA	NA	NA	NA
WP_008941579.1\|2617655_2618669_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_008941580.1\|2619083_2619728_+	YqiJ family protein	NA	NA	NA	NA
WP_008941581.1\|2619759_2621472_+	flotillin family protein	NA	NA	NA	NA
WP_008941582.1\|2621605_2622496_-	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	6.5e-17	31.6
WP_004640348.1\|2622508_2623675_-	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_004640350.1\|2623811_2625245_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-40	26.5
WP_008941583.1\|2625304_2626495_-	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_171503530.1\|2626494_2629347_-	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_005083000.1\|2630042_2630753_-	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_026056325.1\|2630767_2632663_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_005083003.1\|2632672_2633038_-	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_004640364.1\|2633037_2633439_-	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_004640370.1\|2634341_2635616_+	citrate (Si)-synthase	NA	NA	NA	NA
WP_005089435.1\|2635681_2636170_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_004640374.1\|2636280_2637213_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_115736073.1\|2637261_2638487_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1
WP_008941585.1\|2638667_2639288_+	DedA family protein	NA	NA	NA	NA
WP_008941586.1\|2639303_2639954_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_005083020.1\|2640025_2640901_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_008941587.1\|2641003_2641609_+	LysE family transporter	NA	NA	NA	NA
WP_004640385.1\|2641738_2642263_-	YecA family protein	NA	NA	NA	NA
WP_004640386.1\|2642335_2642542_-	hypothetical protein	NA	NA	NA	NA
WP_004681517.1\|2642885_2644766_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-39	34.1
WP_017396702.1\|2644904_2645192_+	DUF493 domain-containing protein	NA	NA	NA	NA
WP_100222603.1\|2645308_2646399_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2958036 : 3005941

Paenibacillus_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088631513.1\|2958036_2959127_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_099143725.1\|2959999_2960751_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.6e-24	45.8
WP_017396528.1\|2960879_2961485_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_004640918.1\|2961515_2962424_-	DMT family transporter	NA	NA	NA	NA
WP_008941239.1\|2962603_2963464_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008941238.1\|2963646_2965173_+	fumarate hydratase	NA	NA	NA	NA
WP_008941237.1\|2965323_2966580_+	hypothetical protein	NA	NA	NA	NA
WP_005086756.1\|2966648_2967365_-	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_004640927.1\|2967525_2968836_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	8.6e-127	55.9
WP_004640929.1\|2968863_2969469_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.4e-63	61.6
WP_004640930.1\|2969675_2971007_-	trigger factor	NA	NA	NA	NA
WP_160132216.1\|2971264_2973457_+	TonB-dependent receptor	NA	NA	NA	NA
WP_008941234.1\|2974050_2975745_+	2-isopropylmalate synthase	NA	NA	NA	NA
WP_004640940.1\|2975826_2976987_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_005086774.1\|2976986_2977580_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
WP_171057898.1\|2977621_2978164_+	SEL1-like repeat protein	NA	NA	NA	NA
WP_008941232.1\|2978260_2978752_+	hypothetical protein	NA	NA	NA	NA
WP_008941231.1\|2978813_2979437_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	3.0e-13	29.1
WP_004640952.1\|2979587_2979806_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_017395723.1\|2979818_2980268_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_004640957.1\|2980264_2981053_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_118901873.1\|2981226_2983425_+	PhoX family phosphatase	NA	NA	NA	NA
WP_115736360.1\|2983483_2984266_-	NRDE family protein	NA	NA	NA	NA
WP_004640964.1\|2984372_2985185_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_004640966.1\|2985220_2985811_-	NAD(P)H:quinone oxidoreductase	M1IDR7	Acanthocystis_turfacea_Chlorella_virus	6.6e-18	35.2
WP_004640968.1\|2985926_2987177_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_008941226.1\|2987204_2988113_-	DMT family transporter	NA	NA	NA	NA
WP_005086790.1\|2988220_2989030_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005086792.1\|2989021_2989918_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_008941225.1\|2989988_2990630_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_004640980.1\|2990671_2991169_-	YcxB family protein	NA	NA	NA	NA
WP_008941224.1\|2991324_2992620_+	hypothetical protein	NA	NA	NA	NA
WP_100833423.1\|2993363_2994492_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_001055585.1\|3001933_3002317_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_079398519.1\|3002352_3002649_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|3002723_3004307_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_100833423.1\|3004811_3005941_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

3209874 : 3252380

uncultured_virus(30.0%)

transposase,integrase

attL 3209387:3209402|attR 3251720:3251735

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3209387:3209402	attL	NA	NA	NA	NA
WP_087486619.1\|3209874_3211093_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_171503532.1\|3211090_3212518_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_008942230.1\|3212562_3215727_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.6e-22	19.4
WP_023187985.1\|3215730_3216912_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_032047825.1\|3217362_3218346_+	cation transporter	A0A1V0SED0	Indivirus	7.4e-22	27.1
WP_023187987.1\|3218386_3220075_+	hypothetical protein	NA	NA	NA	NA
WP_001055585.1\|3220185_3220569_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_079398519.1\|3220604_3220901_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|3220975_3222559_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_023187988.1\|3222798_3223113_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023187989.1\|3223233_3225720_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.9e-92	34.4
WP_023187990.1\|3225730_3226189_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_023187991.1\|3226322_3227915_+	hypothetical protein	Q858S3	Enterobacteria_phage	2.3e-17	45.1
WP_023187992.1\|3229010_3229601_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_023187993.1\|3229626_3230499_+	DMT family transporter	NA	NA	NA	NA
WP_023187994.1\|3230563_3230752_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_160132220.1\|3230846_3232154_-	MFS transporter	NA	NA	NA	NA
WP_023187996.1\|3232230_3232920_-	hypothetical protein	NA	NA	NA	NA
WP_023270952.1\|3232930_3233644_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_023187998.1\|3233684_3234017_-	hypothetical protein	NA	NA	NA	NA
WP_023187999.1\|3234029_3237164_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_023188000.1\|3237181_3238651_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_023270954.1\|3238664_3239864_-	TolC family protein	NA	NA	NA	NA
WP_087486619.1\|3240252_3241471_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_023188003.1\|3241753_3242095_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_023188004.1\|3242185_3242866_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	6.6e-30	40.2
WP_001289337.1\|3243353_3244457_+	hypothetical protein	A0A2H4J138	uncultured_Caudovirales_phage	3.0e-72	44.7
WP_000530048.1\|3244445_3245084_-	hypothetical protein	A0A2H4J137	uncultured_Caudovirales_phage	1.4e-26	38.6
WP_023270956.1\|3245152_3246568_-	hypothetical protein	NA	NA	NA	NA
WP_005028482.1\|3246906_3247899_+\|transposase	IS5-like element ISAba23 family transposase	NA	NA	NA	NA
WP_023188009.1\|3248951_3249803_-	TniB family NTP-binding protein	NA	NA	NA	NA
WP_000999878.1\|3249799_3251689_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_001064759.1\|3251681_3252380_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
3251720:3251735	attR	NA	NA	NA	NA

DBSCAN-SWA_19

3329143 : 3386511

Faecalibacterium_phage(16.67%)

integrase,tRNA,transposase

attL 3348331:3348350|attR 3388924:3388943

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_115736213.1\|3329143_3330943_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_075316386.1\|3331246_3331858_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_005085700.1\|3331916_3332570_-	glutathione S-transferase	NA	NA	NA	NA
WP_115736214.1\|3332666_3333065_-	OsmC family protein	NA	NA	NA	NA
WP_115736215.1\|3333061_3334009_-	pirin family protein	NA	NA	NA	NA
WP_080592133.1\|3334162_3334345_-	DUF2798 domain-containing protein	NA	NA	NA	NA
WP_005085705.1\|3334577_3335069_-	flavin reductase	NA	NA	NA	NA
WP_004637464.1\|3335254_3336283_-	methionine synthase	NA	NA	NA	NA
WP_115736216.1\|3336310_3337312_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_115736217.1\|3337679_3340118_+	AAA family ATPase	NA	NA	NA	NA
WP_004637461.1\|3340166_3341735_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.7e-25	33.3
WP_171055760.1\|3342182_3343409_+	DUF445 family protein	NA	NA	NA	NA
WP_005085711.1\|3343466_3343835_-	NirD/YgiW/YdeI family stress tolerance protein	NA	NA	NA	NA
WP_004637457.1\|3343967_3344390_-	DoxX family protein	NA	NA	NA	NA
WP_115736218.1\|3344614_3345256_+	DedA family protein	NA	NA	NA	NA
WP_005085714.1\|3345279_3345870_-	LysE family transporter	NA	NA	NA	NA
WP_004637453.1\|3346082_3346469_-	hypothetical protein	NA	NA	NA	NA
WP_115736219.1\|3346478_3347321_-	ParA family protein	V5UP47	Mycobacterium_phage	4.2e-10	24.3
WP_115736220.1\|3347401_3347794_-	SirB2 family protein	NA	NA	NA	NA
WP_115736221.1\|3347803_3348112_-	BolA family transcriptional regulator	NA	NA	NA	NA
3348331:3348350	attL	NA	NA	NA	NA
WP_017482406.1\|3348825_3349053_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000122748.1\|3349168_3349378_+	hypothetical protein	NA	NA	NA	NA
WP_125298015.1\|3349397_3350579_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	3.6e-39	30.1
WP_004895356.1\|3350571_3350820_+	hypothetical protein	NA	NA	NA	NA
WP_160132223.1\|3350888_3351455_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_075695892.1\|3351465_3352209_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.2e-43	37.1
WP_087486619.1\|3352392_3353611_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_075695893.1\|3354055_3355591_-	kinase	NA	NA	NA	NA
WP_160132224.1\|3355583_3356939_-	protein phosphatase 2C domain-containing protein	NA	NA	NA	NA
WP_080631714.1\|3356959_3357985_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_160132225.1\|3357975_3358644_-	hypothetical protein	NA	NA	NA	NA
WP_075695895.1\|3358649_3359177_-	hypothetical protein	NA	NA	NA	NA
WP_075695896.1\|3359223_3359859_-	VWA domain-containing protein	NA	NA	NA	NA
WP_075695897.1\|3359977_3360517_-	hypothetical protein	NA	NA	NA	NA
WP_075695898.1\|3360530_3360956_-	hypothetical protein	NA	NA	NA	NA
WP_075695899.1\|3360952_3361681_-	OmpA family protein	NA	NA	NA	NA
WP_160132226.1\|3361684_3363058_-	hypothetical protein	NA	NA	NA	NA
WP_075695902.1\|3364861_3365716_+	hypothetical protein	NA	NA	NA	NA
WP_075695903.1\|3365742_3367170_+	hypothetical protein	NA	NA	NA	NA
WP_151730919.1\|3367214_3370091_-	HsdR family type I site-specific deoxyribonuclease	NA	NA	NA	NA
WP_005274609.1\|3371062_3371992_-\|transposase	IS5-like element ISAba10 family transposase	Q1MVF0	Enterobacteria_phage	8.4e-52	38.3
WP_160132227.1\|3371992_3372289_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_160132287.1\|3372307_3372487_-	DUF4431 domain-containing protein	NA	NA	NA	NA
WP_080631714.1\|3372536_3373562_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	2.2e-24	30.7
WP_019838385.1\|3373802_3374654_-	hypothetical protein	NA	NA	NA	NA
WP_160132228.1\|3374713_3375925_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	8.8e-25	27.6
WP_160132229.1\|3375924_3377493_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.0e-162	56.7
WP_075695908.1\|3377696_3378758_-	endonuclease	A0A2I2MUI7	uncultured_Caudovirales_phage	1.1e-76	62.8
WP_075695909.1\|3378760_3379351_-	class I SAM-dependent methyltransferase	A0A2H4J5G6	uncultured_Caudovirales_phage	2.8e-32	82.5
WP_075695910.1\|3379502_3379832_+	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_001282337.1\|3379931_3380246_+	hypothetical protein	NA	NA	NA	NA
WP_004907063.1\|3380314_3380578_-	hypothetical protein	NA	NA	NA	NA
WP_160132288.1\|3380882_3381380_+	hypothetical protein	NA	NA	NA	NA
WP_160132230.1\|3381376_3383557_+	hypothetical protein	NA	NA	NA	NA
WP_160132231.1\|3383553_3386511_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
3388924:3388943	attR	NA	NA	NA	NA

DBSCAN-SWA_20

3474665 : 3527458

Bacillus_virus(33.33%)

protease,holin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_125316877.1\|3474665_3476846_-\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_004637386.1\|3477163_3477880_-	ribonuclease PH	NA	NA	NA	NA
WP_171065866.1\|3477977_3479120_-	fatty acid desaturase	NA	NA	NA	NA
WP_042874097.1\|3479150_3480176_-	oxidoreductase	NA	NA	NA	NA
WP_004637383.1\|3480489_3481140_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_004637382.1\|3481246_3481876_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005085864.1\|3481938_3482559_-	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_008942484.1\|3482737_3483451_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
WP_008942485.1\|3483450_3484149_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_004637378.1\|3484179_3484926_+	YciK family oxidoreductase	NA	NA	NA	NA
WP_005092718.1\|3485090_3485468_+	RcnB family protein	NA	NA	NA	NA
WP_005092720.1\|3485610_3486966_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_005092722.1\|3487275_3488265_+	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005092725.1\|3488277_3489267_+	aliphatic sulfonate ABC transporter substrate-binding protein	G3M9Z0	Bacillus_virus	2.2e-05	32.8
WP_118902089.1\|3489293_3490469_+	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_004637372.1\|3490465_3491269_+	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
WP_160132260.1\|3491284_3492085_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.2e-31	39.5
WP_005085882.1\|3492326_3492938_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_125316879.1\|3493194_3493464_-	hypothetical protein	NA	NA	NA	NA
WP_125316880.1\|3493485_3493743_-	hypothetical protein	NA	NA	NA	NA
WP_160132261.1\|3494248_3494974_-	hypothetical protein	NA	NA	NA	NA
WP_125316882.1\|3494966_3496088_-	ATP-binding protein	NA	NA	NA	NA
WP_125316883.1\|3496532_3497099_-	5'-nucleosidase	NA	NA	NA	NA
WP_125316884.1\|3497161_3498295_-	TDT family transporter	NA	NA	NA	NA
WP_125316885.1\|3498502_3499504_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_017395867.1\|3499566_3502404_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	3.1e-73	25.9
WP_004637362.1\|3502396_3502927_+	signal peptidase II	NA	NA	NA	NA
WP_004637361.1\|3502926_3503409_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_005085893.1\|3503515_3504058_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_005092737.1\|3504409_3504646_-	hypothetical protein	NA	NA	NA	NA
WP_004637358.1\|3510582_3511137_-	peptidyl-prolyl cis-trans isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.6e-18	37.3
WP_004637357.1\|3511267_3512365_-	alpha/beta hydrolase	A0A2K9L3Q5	Tupanvirus	2.5e-10	29.5
WP_005086118.1\|3512573_3512774_-	hypothetical protein	NA	NA	NA	NA
WP_160132262.1\|3513060_3513267_-	hypothetical protein	NA	NA	NA	NA
WP_004637354.1\|3513681_3514536_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005091991.1\|3515696_3516242_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_005086107.1\|3516430_3518374_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.7e-147	48.6
WP_005091989.1\|3518657_3519542_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_160132263.1\|3519705_3520617_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_005091986.1\|3521040_3521955_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_088631513.1\|3522191_3523282_-\|transposase	IS4 family transposase ISAba1	NA	NA	NA	NA
WP_008942557.1\|3523546_3524317_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_008942558.1\|3524419_3524803_+	hypothetical protein	NA	NA	NA	NA
WP_171503534.1\|3524843_3526028_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_100833423.1\|3526328_3527458_-\|transposase	IS3 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP031979.1|WP_004640952.1|2979587_2979806_+|Sec-independent-protein-translocase-subunit-TatA

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP031979.1|WP_004640952.1|2979587_2979806_+|Sec-independent-protein-translocase-subunit-TatA

2979587_2979806_+

72 aa aa

2958036-3005941

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP031979_4	Orphan	4.1\|2999114\|18\|NZ_CP031979\|CRT	2999114-2999131	18	2999399-2999416	1
NZ_CP031979_4	Orphan	4.3\|2999234\|18\|NZ_CP031979\|CRT	2999234-2999251	18	2999399-2999416	0
NZ_CP031979_4	Orphan	4.4\|2999288\|18\|NZ_CP031979\|CRT	2999288-2999305	18	2999399-2999416	1
NZ_CP031979_4	Orphan	4.1\|2999114\|18\|NZ_CP031979\|CRT	2999114-2999131	18	3000827-3000844	1
NZ_CP031979_4	Orphan	4.3\|2999234\|18\|NZ_CP031979\|CRT	2999234-2999251	18	3000827-3000844	0
NZ_CP031979_4	Orphan	4.4\|2999288\|18\|NZ_CP031979\|CRT	2999288-2999305	18	3000827-3000844	1
NZ_CP031979_4	Orphan	4.2\|2999168\|30\|NZ_CP031979\|CRT	2999168-2999197	30	2999387-2999416	0
NZ_CP031979_4	Orphan	4.2\|2999168\|30\|NZ_CP031979\|CRT	2999168-2999197	30	3000815-3000844	0
NZ_CP031979_4	Orphan	4.5\|2999342\|21\|NZ_CP031979\|CRT	2999342-2999362	21	2999399-2999419	0
NZ_CP031979_4	Orphan	4.5\|2999342\|21\|NZ_CP031979\|CRT	2999342-2999362	21	3000827-3000847	0

1. spacer 4.1|2999114|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 2999399-2999416, mismatch: 1

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

2. spacer 4.3|2999234|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 2999399-2999416, mismatch: 0

ccaatcactggcattatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
******************

3. spacer 4.4|2999288|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 2999399-2999416, mismatch: 1

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

4. spacer 4.1|2999114|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 3000827-3000844, mismatch: 1

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

5. spacer 4.3|2999234|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 3000827-3000844, mismatch: 0

ccaatcactggcattatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
******************

6. spacer 4.4|2999288|18|NZ_CP031979|CRT matches to NZ_CP031979 position: 3000827-3000844, mismatch: 1

ccaatcactggcatcatt	CRISPR spacer
ccaatcactggcattatt	Protospacer
**************.***

7. spacer 4.2|2999168|30|NZ_CP031979|CRT matches to NZ_CP031979 position: 2999387-2999416, mismatch: 0

ggtttattaagcccaatcactggcattatt	CRISPR spacer
ggtttattaagcccaatcactggcattatt	Protospacer
******************************

8. spacer 4.2|2999168|30|NZ_CP031979|CRT matches to NZ_CP031979 position: 3000815-3000844, mismatch: 0

ggtttattaagcccaatcactggcattatt	CRISPR spacer
ggtttattaagcccaatcactggcattatt	Protospacer
******************************

9. spacer 4.5|2999342|21|NZ_CP031979|CRT matches to NZ_CP031979 position: 2999399-2999419, mismatch: 0

ccaatcactggcattattggt	CRISPR spacer
ccaatcactggcattattggt	Protospacer
*********************

10. spacer 4.5|2999342|21|NZ_CP031979|CRT matches to NZ_CP031979 position: 3000827-3000847, mismatch: 0

ccaatcactggcattattggt	CRISPR spacer
ccaatcactggcattattggt	Protospacer
*********************

3. NZ_CP031981

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031981_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031981_1

748-843

Orphan

Consensus_repeat	Method
TTAAATATGACGGATTGACTACTAACTATGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031981_1

>merge|NZ_CP031981|1|748-843|CRISPRCasFinder
TTAAATATGACGGATTGACTACTAACTATGACGGATTGACTACTAACTATGACGGATTGACTACTTAACTATGACGGATTGACTACTAACTATGAC

>NZ_CP031981|1|1|748-843|CRISPRCasFinder
TTAAATATGACGGATTGACTACTAACTATGAC	GGATTGACTACTAACTATGACGGATTGACTAC
TTAACTATGACGGATTGACTACTAACTATGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031981.1\|WP_004728121.1\|7192_7510_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031981.1\|WP_000235176.1\|4161_4560_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319923
NZ_CP031981.1\|WP_001133626.1\|2702_2978_+\|metal/formaldehyde-sensitive-transcriptional-repressor	unknown	unknown	gnl\|CDD\|197388
NZ_CP031981.1\|WP_008942535.1\|1831_2389_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031981.1\|WP_151800610.1\|6377_6665_+\|BrnT-family-toxin	unknown	unknown	gnl\|CDD\|367913
NZ_CP031981.1\|WP_000439570.1\|5033_5867_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP031981.1\|WP_000842148.1\|2999_4109_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP031981.1\|WP_151800611.1\|6651_6966_+\|BrnA-antitoxin-family-protein	unknown	unknown	gnl\|CDD\|373040
NZ_CP031981.1\|WP_004282220.1\|8123_8369_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031981.1\|WP_004676219.1\|7749_7974_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NZ_CP031981.1\|WP_000235176.1\|4161_4560_+\|VOC-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.06133e-42
NZ_CP031981.1\|WP_001133626.1\|2702_2978_+\|metal/formaldehyde-sensitive-transcriptional-repressor	gnl\|CDD\|197388	cd10153, RcnR-FrmR-like_DUF156, Transcriptional regulators RcnR and FrmR, and related domains; this domain family was previously known as part of DUF156. This domain family includes various transcriptional regulators that respond to different stressors. It includes Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), and E. coli FrmR (formally known as YaiN, formaldehyde sensitive). Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA; RcnA may act through modulating NikR, to repress the NIkABCDE nickel transporter. In vitro, purified RncR binds to the rncA promoter DNA fragment in the absence of Ni2+ or Co2+, and the affinity of RncR for this promoter is reduced in the presence of excess nickel. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon. This family belongs to a larger superfamily that includes CsoRs (copper-sensitive operon repressors). CsoRs form homotetramers (dimer of dimers). In Mycobacterium tuberculosis CsoR, within each dimer, two Cys residues on opposite subunits, along with a His residue, bind the Cu(I) ion (forming a triagonal S2N coordination complex, C-H-C). These residues are conserved in the majority of members of this superfamily. In this family, however, not all these residues are conserved; in E.coli RcnR and FrmR there is a His or a Thr instead of the second Cys (C-H-H or C-H-T) respectively. For E. coli FrmR, an N-terminal His residue, not conserved in all members of this family, is also involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue that facilitate allosteric regulation of DNA binding for CsoRs are poorly conserved in this family.	2.86477e-38
NZ_CP031981.1\|WP_151800610.1\|6377_6665_+\|BrnT-family-toxin	gnl\|CDD\|367913	pfam04365, BrnT_toxin, Ribonuclease toxin, BrnT, of type II toxin-antitoxin system. BrnT is a ribonuclease toxin of a type II toxin-antitoxin system that exhibits a RelE-like fold. The antitoxin that neutralizes this toxin is pfam14384. BrnT is found in bacteria, archaea, bacteriophage, and plasmids. BrnT-BrnA forms a 2:2 tetrameric complex and autoregulates its own expression, which is induced by a number of different environmental stresses. Expression of BrnT alone results in cessation of bacterial growth which can be rescued after subsequent expression of BrnA.	1.63682e-28
NZ_CP031981.1\|WP_000439570.1\|5033_5867_+\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	1.35202e-132
NZ_CP031981.1\|WP_000842148.1\|2999_4109_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP031981.1\|WP_151800611.1\|6651_6966_+\|BrnA-antitoxin-family-protein	gnl\|CDD\|373040	pfam14384, BrnA_antitoxin, BrnA antitoxin of type II toxin-antitoxin system. BrnA is family of antitoxins that neutralizes the toxin BrnT, pfam04365. It consists of 3 alpha-helices and a C-terminal ribbon-helix-helix DNA binding domain. As in other toxin-antitoxin systems, BrnA negatively autoregulates the brnTA operon and has higher affinity for the DNA operator when complexed with BrnT. It dimerizes with two molecules of its toxin BrnT.	2.41318e-20
NZ_CP031981.1\|WP_004676219.1\|7749_7974_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00754589

>NZ_CP031981.1|WP_008942535.1|1831_2389_+|hypothetical-protein
MKTSTKYSVSDAATLYKKSRATLYKDIKNGVLSRDHDGSIDFSELLRVYGEPFSGKHSKHTDTSPTQTINTPEYTDNTVIELKNQIDFLKKQLEKAEDREAKANSRIDTLLTLIEMKPTQVHPTPTSDQSSVQSSPSQVEPTLNVDNDKHDGLTTPENKRIPVPEHVEPEPKKRGFWSRFFLPYG
>NZ_CP031981.1|WP_001133626.1|2702_2978_+|metal/formaldehyde-sensitive-transcriptional-repressor
MPNQVEDKKKILTRVRRIKGQAEAIEKALEDNVECGAILQQICSVRGAINGLMNEMLEVHLKDTLVSGETTEQQRKEELAEIAKILKSYLK
>NZ_CP031981.1|WP_000842148.1|2999_4109_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFGPGQPLQIVEVDVAPPKKGEVLIKISHTGVCHTDAFTLSGDDPEGVFPAILGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECVFCKSGKSNLCISVRETQGRGVMPDGTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPEANHEHVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGGIGLAVVQAARQAKAGRIIVVDMNPDKFALAKEFGATDFLNPKDYDKPIQQVIVEMTGWGVDHSFECIGNVNVMRAALESAHRGWGQSVIIGVAGAGQEISTRPFQLVTGRKWLGSAFGGVKGRTQLPGMVEDAMKGKIQLEPFVTHTMGLDQINEAFDLMHEGKSIRTVIHY
>NZ_CP031981.1|WP_000235176.1|4161_4560_+|VOC-family-protein
MATPVISGNDIFSHVFLGAVDLKKSVVFYDAALGALGIKNLGPFGNDWVLYGRDKPAFMITRPSNGAEPTSNGVTVGFAAATPAEVNAFHAAGLAAGGTDEGQPGPRGHLPGAYAAYLRDPAGNKVCAYTFV
>NZ_CP031981.1|WP_000439570.1|5033_5867_+|S-formylglutathione-hydrolase
MERIEHHASFEGWQDVFQHESTVLGCMMRFGIYLPPQAEHEKLPVLYWLSGLTCTEQNFITKAAVQRYAAEHGIIVVAPDTSPRGESVADDAAYDLGQGAGFYVDATELPWSDHYQMYSYVVDELPALIEANFPASSRRSISGHSMGGHGALVIALRNPGRYASVSAFSPIVAPTQVPWGQKALAAYLGEKNLEAWKQYDTVELIRVAQERLPLLVDQGLSDEFLEHQLRPQLLRTACEQVDHPLTLNLRPGHDHSYYFISTYLSEHMAHHAAALNR
>NZ_CP031981.1|WP_151800610.1|6377_6665_+|BrnT-family-toxin
MEQYFEWDEAKNRKNQKKHDVSFETASLVFDDPLRISMQDRHTDGEERWQTIGKVKGVLMLLVAHTIFDEDDCEIIRIISARQVTKAERDRYEHG
>NZ_CP031981.1|WP_151800611.1|6651_6966_+|BrnA-antitoxin-family-protein
MSMVRYSRKELNEKFSDKQDAEIQRLLAKGTVADDQLDLSDIPEITDWSNAVRHNQFYRPVKQQTSIRLDADVLAWFKSQGKGYQTRMNEILRDAMLKELKNHQ
>NZ_CP031981.1|WP_004728121.1|7192_7510_+|hypothetical-protein
MLGQHHHFLKKLSISDAAIAYRKPRSTILKYIKSGDFELDYNNLIEYSQLVKKLGEITSPIRDERDQQIEKLKDEVMHLKKQLNFFKYTSISNKHRLLISHKDSI
>NZ_CP031981.1|WP_004676219.1|7749_7974_-|helix-turn-helix-transcriptional-regulator
MPYEEFQRLMGKAGLSIKEFATLLDMNPNSITNYKKIGKVPTHIAVLVYLLSSMKDEGVDFYPIFEKIKSYSKD
>NZ_CP031981.1|WP_004282220.1|8123_8369_+|hypothetical-protein
MYSYPDSNTEKKIALMIINDFFIQKAHELWIFLQLDQCFNDYEATLIWTRRYLEKHPECEYSDIQKAFVSCFPEHFFSFDC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6018-6049	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6039-6070	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14314-14345	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14335-14366	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2706-2737	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2727-2758	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1572-1603	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1593-1624	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15134-15165	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15155-15186	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4058-4089	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4079-4110	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6031-6062	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6052-6083	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13480-13511	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13501-13532	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3684-3715	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3705-3736	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2307-2338	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2328-2359	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3598-3629	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3619-3650	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	228-259	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	249-280	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	59-90	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	80-111	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1817-1848	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1838-1869	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6654-6685	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6675-6706	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8645-8676	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8666-8697	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9523-9554	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9544-9575	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8103-8134	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8124-8155	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9414-9445	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9435-9466	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6928-6959	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6949-6980	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3638-3669	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3659-3690	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2718-2749	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2739-2770	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8318-8349	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8339-8370	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8318-8349	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8339-8370	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2122-2153	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2143-2174	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8537-8568	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8558-8589	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2818-2849	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2839-2870	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7752-7783	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7773-7804	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8144-8175	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8165-8196	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10198-10229	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10219-10250	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4129-4160	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4150-4181	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10478-10509	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10499-10530	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7568-7599	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7589-7620	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	247-278	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	268-299	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1389-1420	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1410-1441	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	759-790	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	780-811	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6952-6983	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6973-7004	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	17984-18015	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	18005-18036	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2195-2226	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2216-2247	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7686-7717	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7707-7738	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7703-7734	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7724-7755	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2972-3003	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2993-3024	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4250-4281	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4271-4302	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18027-18058	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18048-18079	0	1.0
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7417-7448	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7438-7469	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4788-4819	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4809-4840	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8559-8590	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8580-8611	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9450-9481	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9471-9502	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3221-3252	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3242-3273	1	0.969
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_014312	Klebsiella pneumoniae plasmid pKP048, complete sequence	33923-33954	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	33736-33767	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP023051	Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence	137476-137507	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MF399199	Acinetobacter baumannii strain D46 plasmid pD46-4, complete sequence	81897-81928	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP016764	Citrobacter freundii strain B38 plasmid pOZ181, complete sequence	208670-208701	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_021728	Acinetobacter baumannii BJAB07104 plasmid p2BJAB07104, complete sequence	14498-14529	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KX443408	Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence	59126-59157	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	72945-72976	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KX009507	Escherichia coli strain 06K2206 plasmid LM6771, complete sequence	30580-30611	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	72945-72976	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KM083064	Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence	11040-11071	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KT225462	Klebsiella pneumoniae strain YDC676 plasmid pYDC676, complete sequence	15891-15922	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	82195-82226	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	33092-33123	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026156	Klebsiella pneumoniae strain B12(AN) plasmid pB12AN_1, complete sequence	5686-5717	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP040051	Acinetobacter baumannii strain VB16141 plasmid unnamed1, complete sequence	157830-157861	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_004464	Citrobacter freundii plasmid pCTX-M3, complete sequence	78331-78362	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_007682	Escherichia coli plasmid pMUR050, complete sequence	23523-23554	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	269347-269378	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052160	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-2, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_021180	Klebsiella pneumoniae plasmid pNDM-1saitama01 DNA, complete sequence, strain: NDM-1saitama01	47233-47264	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052311	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence	123333-123364	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP027679	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence	71941-71972	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	66516-66547	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	379170-379201	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP029729	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence	192795-192826	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	4269-4300	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	172346-172377	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KJ187752	Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence	51083-51114	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052145	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-2, complete sequence	21151-21182	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP014650	Acinetobacter baumannii strain IOMTU433 plasmid pIOMTU433, complete sequence	1251-1282	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044454	Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-4, complete sequence	6554-6585	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033628	Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence	70170-70201	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP038646	Acinetobacter baumannii strain ACN21 plasmid unnamed2, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	136022-136053	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	353358-353389	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP012007	Acinetobacter baumannii strain Ab04-mff plasmid pAB04-1, complete sequence	115941-115972	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	80036-80067	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN175387	Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence	140438-140469	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	213043-213074	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019165	Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence	73574-73605	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	1992-2023	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	140993-141024	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	57768-57799	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP041083	Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence	123289-123320	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	252486-252517	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_016974	Providencia stuartii plasmid pMR0211, complete sequence	129281-129312	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_017172	Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete sequence	7220-7251	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	64116-64147	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	210601-210632	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	2279-2310	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	18918-18949	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LT985387	Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI	10636-10667	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	96027-96058	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP036195	Klebsiella pneumoniae strain BA34918 plasmid pIncX3	46739-46770	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC508263	Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence	75060-75091	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	225163-225194	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050416	Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019063	Escherichia coli plasmid pNDM-HK, complete sequence	24804-24835	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050426	Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LT009689	Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence	71778-71809	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP040054	Acinetobacter baumannii strain VB35179 plasmid unnamed1, complete sequence	178122-178153	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	204413-204444	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	240182-240213	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050433	Acinetobacter baumannii strain PM194229 plasmid pPM194229_1, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050386	Acinetobacter baumannii strain VB82 plasmid pVB82_1, complete sequence	190142-190173	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	117937-117968	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP029118	Escherichia coli strain AR435 plasmid unnamed5, complete sequence	117666-117697	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	234138-234169	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	232207-232238	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	24288-24319	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	260033-260064	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	175110-175141	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP050162	Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	82577-82608	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	186059-186090	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031235	Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence	50975-51006	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	59097-59128	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	238004-238035	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052423	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence	168984-169015	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	131618-131649	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019065	Escherichia coli plasmid pPG010208, complete sequence	20620-20651	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	211170-211201	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	85298-85329	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC536683	Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence	23823-23854	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC542971	Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence	96278-96309	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC542972	Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence	101394-101425	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	116343-116374	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	KX957970	Vibrio parahaemolyticus plasmid pVPS43, complete sequence	110095-110126	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021709	Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence	82830-82861	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP021551	Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence	96680-96711	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP023488	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence	152490-152521	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	KX957969	Vibrio alginolyticus plasmid pVAS114, complete sequence	113977-114008	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	97345-97376	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052205	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-2, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	1992-2023	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP012902	Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence	47690-47721	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP020596	Acinetobacter baumannii strain HWBA8 plasmid pHWBA8_1, complete sequence	9354-9385	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	208719-208750	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032193	Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence	12765-12796	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP040260	Acinetobacter baumannii strain P7774 plasmid unnamed1, complete sequence	80809-80840	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_022589	Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence	77049-77080	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052352	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence	16262-16293	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044337	Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence	53382-53413	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP007579	Acinetobacter baumannii AC30 plasmid pAC30b, complete sequence	6758-6789	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	31352-31383	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	161706-161737	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP046598	Acinetobacter indicus strain FS42-2 plasmid pFS42-2-3, complete sequence	3413-3444	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP030345	Enterobacter hormaechei strain AR_038 plasmid unnamed1	10319-10350	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP030345	Enterobacter hormaechei strain AR_038 plasmid unnamed1	132235-132266	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	189638-189669	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052393	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence	16262-16293	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	52169-52200	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	263190-263221	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP018143	Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence	126288-126319	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_AP018145	Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence	145049-145080	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	CP052316	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-1, complete sequence	1306-1337	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LN831184	Vibrio cholerae isolate V. cholerae 116-14 plasmid pNDM-116-14, complete sequence	232232-232263	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LN831185	Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence	74417-74448	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN937241	Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence	107980-108011	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_LT985241	Escherichia coli strain 721 plasmid RCS40_p, complete sequence	33073-33104	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC505604	Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence	75060-75091	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	LC508722	Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence	75060-75091	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MN101852	Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence	18954-18985	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	174691-174722	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	214047-214078	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MN101853	Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence	140400-140431	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_019889	Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence	62261-62292	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN657249	Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence	111158-111189	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN657250	Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence	111194-111225	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN657252	Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence	134420-134451	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	65657-65688	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MH011352	Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence	180693-180724	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MK413720	Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence	121318-121349	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	75770-75801	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN657241	Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence	132511-132542	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP012903	Providencia rettgeri strain N15-01091 plasmid pNDM15-1091, complete sequence	49446-49477	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MH001166	Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence	159056-159087	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	193045-193076	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	294301-294332	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	151708-151739	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	287996-288027	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	166624-166655	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	302552-302583	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	183933-183964	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	317390-317421	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344572	Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence	88579-88610	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MG450360	Escherichia coli strain AMA566 plasmid pAMA566, complete sequence	134913-134944	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MH892479	Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence	150519-150550	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP049048	Enterobacter hormaechei strain Y233 plasmid p233-142, complete sequence	72812-72843	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NC_021732	Acinetobacter baumannii BJAB0868 plasmid p3BJAB0868, complete sequence	15627-15658	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP044468	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-5, complete sequence	5814-5845	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	257700-257731	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF072965	Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence	138794-138825	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MG288680	Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence	121625-121656	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	247967-247998	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MG288682	Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence	74577-74608	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	247998-248029	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_MF344582	Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence	143388-143419	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP040068	Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence	124572-124603	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	244179-244210	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	279108-279139	7	0.781
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4767-4798	8	0.75
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9492-9523	8	0.75
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3200-3231	8	0.75
NZ_CP031981_1	1.1\|780\|32\|NZ_CP031981\|CRISPRCasFinder	780-811	32	NZ_CP033846	Klebsiella oxytoca strain FDAARGOS_500 plasmid unnamed2, complete sequence	381-412	10	0.688

1. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

2. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

3. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

4. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

5. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

6. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

7. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

8. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

9. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

10. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

11. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

12. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

13. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

14. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

15. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

16. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

17. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

18. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

19. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

20. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

21. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

22. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

23. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

24. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

25. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

26. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

27. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

28. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

29. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

30. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

31. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

32. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

33. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

34. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

35. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

36. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

37. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

38. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

39. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

40. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

41. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

42. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

43. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

44. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

45. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

46. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

47. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

48. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

49. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

50. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

51. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

52. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

53. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

54. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

55. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

56. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

57. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

58. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

59. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

60. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

61. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

62. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

63. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

64. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

65. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

66. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

67. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

68. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

69. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

70. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

71. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

72. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

73. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

74. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

75. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

76. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

77. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

78. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

79. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

80. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

81. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

82. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

83. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

84. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

85. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

86. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

87. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

88. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgacggattgactac	Protospacer
********************************

89. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactaccaactatgacggattgactac	Protospacer
***********.********************

90. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactaccaactatgacggattgactac	Protospacer
***********.********************

91. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

92. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

93. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

94. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

95. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

96. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

97. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

98. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.969

ggattgactactaactatgacggattgactac	CRISPR spacer
ggattgactactaactatgagggattgactac	Protospacer
******************** ***********

99. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_014312 (Klebsiella pneumoniae plasmid pKP048, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

100. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

101. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP023051 (Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

102. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MF399199 (Acinetobacter baumannii strain D46 plasmid pD46-4, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

103. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP016764 (Citrobacter freundii strain B38 plasmid pOZ181, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

104. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_021728 (Acinetobacter baumannii BJAB07104 plasmid p2BJAB07104, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

105. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KX443408 (Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

106. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

107. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KX009507 (Escherichia coli strain 06K2206 plasmid LM6771, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

108. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

109. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KM083064 (Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

110. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KT225462 (Klebsiella pneumoniae strain YDC676 plasmid pYDC676, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

111. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

112. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

113. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026156 (Klebsiella pneumoniae strain B12(AN) plasmid pB12AN_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

114. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP040051 (Acinetobacter baumannii strain VB16141 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

115. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_004464 (Citrobacter freundii plasmid pCTX-M3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

116. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_007682 (Escherichia coli plasmid pMUR050, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

117. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

118. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052160 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

119. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_021180 (Klebsiella pneumoniae plasmid pNDM-1saitama01 DNA, complete sequence, strain: NDM-1saitama01) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

120. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052311 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

121. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP027679 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

122. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

123. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

124. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP029729 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

125. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

126. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

127. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KJ187752 (Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

128. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052145 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

129. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP014650 (Acinetobacter baumannii strain IOMTU433 plasmid pIOMTU433, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

130. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044454 (Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-4, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

131. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033628 (Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

132. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP038646 (Acinetobacter baumannii strain ACN21 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

133. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

134. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

135. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP012007 (Acinetobacter baumannii strain Ab04-mff plasmid pAB04-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

136. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

137. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN175387 (Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

138. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

139. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019165 (Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

140. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

141. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

142. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

143. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP041083 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

144. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

145. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

146. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_016974 (Providencia stuartii plasmid pMR0211, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

147. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_017172 (Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

148. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

149. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

150. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

151. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

152. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LT985387 (Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

153. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

154. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP036195 (Klebsiella pneumoniae strain BA34918 plasmid pIncX3) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

155. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC508263 (Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

156. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

157. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050416 (Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

158. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019063 (Escherichia coli plasmid pNDM-HK, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

159. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050426 (Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

160. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LT009689 (Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

161. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP040054 (Acinetobacter baumannii strain VB35179 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

162. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

163. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

164. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050433 (Acinetobacter baumannii strain PM194229 plasmid pPM194229_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

165. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050386 (Acinetobacter baumannii strain VB82 plasmid pVB82_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

166. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

167. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP029118 (Escherichia coli strain AR435 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

168. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

169. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

170. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

171. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

172. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

173. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP050162 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

174. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

175. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031235 (Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

176. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

177. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

178. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052423 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

179. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

180. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019065 (Escherichia coli plasmid pPG010208, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

181. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

182. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

183. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC536683 (Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

184. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC542971 (Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

185. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC542972 (Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

186. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

187. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to KX957970 (Vibrio parahaemolyticus plasmid pVPS43, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

188. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021709 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

189. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP021551 (Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

190. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP023488 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

191. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to KX957969 (Vibrio alginolyticus plasmid pVAS114, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

192. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

193. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052205 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

194. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

195. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP012902 (Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

196. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP020596 (Acinetobacter baumannii strain HWBA8 plasmid pHWBA8_1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

197. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

198. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032193 (Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

199. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP040260 (Acinetobacter baumannii strain P7774 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

200. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_022589 (Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

201. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052352 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

202. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044337 (Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

203. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP007579 (Acinetobacter baumannii AC30 plasmid pAC30b, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

204. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

205. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

206. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP046598 (Acinetobacter indicus strain FS42-2 plasmid pFS42-2-3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

207. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP030345 (Enterobacter hormaechei strain AR_038 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

208. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP030345 (Enterobacter hormaechei strain AR_038 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

209. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

210. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052393 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

211. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

212. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

213. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP018143 (Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

214. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_AP018145 (Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

215. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to CP052316 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

216. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LN831184 (Vibrio cholerae isolate V. cholerae 116-14 plasmid pNDM-116-14, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

217. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LN831185 (Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

218. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN937241 (Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

219. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_LT985241 (Escherichia coli strain 721 plasmid RCS40_p, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

220. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC505604 (Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

221. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to LC508722 (Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

222. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MN101852 (Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

223. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

224. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

225. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MN101853 (Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

226. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_019889 (Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

227. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN657249 (Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

228. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN657250 (Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

229. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN657252 (Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

230. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

231. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MH011352 (Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

232. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MK413720 (Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

233. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

234. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN657241 (Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

235. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP012903 (Providencia rettgeri strain N15-01091 plasmid pNDM15-1091, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

236. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MH001166 (Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

237. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

238. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

239. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

240. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

241. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

242. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

243. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

244. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

245. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344572 (Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

246. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MG450360 (Escherichia coli strain AMA566 plasmid pAMA566, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

247. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MH892479 (Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

248. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP049048 (Enterobacter hormaechei strain Y233 plasmid p233-142, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

249. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NC_021732 (Acinetobacter baumannii BJAB0868 plasmid p3BJAB0868, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

250. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP044468 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-5, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

251. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

252. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF072965 (Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

253. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MG288680 (Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

254. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

255. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MG288682 (Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

256. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

257. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_MF344582 (Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

258. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP040068 (Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

259. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

260. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 7, identity: 0.781

ggattgactactaactatgacggattgactac	CRISPR spacer
gaactagcaacgaactatgacgaattgactac	Protospacer
*.*.*..* ** **********.*********

261. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 8, identity: 0.75

ggattgactactaactatgacggattgactac	CRISPR spacer
ctttcagctcctaactatgagggattgactac	Protospacer
   *...** ********** ***********

262. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 8, identity: 0.75

ggattgactactaactatgacggattgactac	CRISPR spacer
ctttcagctcctaactatgagggattgactac	Protospacer
   *...** ********** ***********

263. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 8, identity: 0.75

ggattgactactaactatgacggattgactac	CRISPR spacer
ctttcagctcctaactatgagggattgactac	Protospacer
   *...** ********** ***********

264. spacer 1.1|780|32|NZ_CP031981|CRISPRCasFinder matches to NZ_CP033846 (Klebsiella oxytoca strain FDAARGOS_500 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

ggattgactactaactatgacggattgactac	CRISPR spacer
acagcagaaactaaacatgacggattgactac	Protospacer
. * ...  ***** .****************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031980

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP031979

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

3. NZ_CP031981

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection