CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP031995	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chc, complete sequence	0 crisprs	NA	0	0	0
NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	1 crisprs	NA	0	1	0
NZ_CP031992	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chf, complete sequence	0 crisprs	WYL	0	0	0
NZ_CP031997	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126cha, complete sequence	0 crisprs	NA	0	0	0
NZ_CP031991	Acinetobacter haemolyticus strain 2126ch chromosome, complete genome	5 crisprs	csa3,RT,cas3,DEDDh,WYL,PrimPol	8	9	19
NZ_CP031996	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chb, complete sequence	0 crisprs	NA	0	0	0
NZ_CP031993	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126che, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031991_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031991_1

70181-70324

Orphan

Consensus_repeat	Method
GAGTAATAAAGTTTCATACTGA	PILER-CR

2 spacers

TnsE_C

The CRISPR arrays of NZ_CP031991_1

>merge|NZ_CP031991|1|70181-70324|PILER-CR
GAGTAATAAAGTTTCATACTGATCCTAACCTATCTTATTGATATTTCTACTTCGTAATGAATGGAAGAAAAAATAAAGTTTCATACTCAGCTTTATCATTTCTTCCATTTTTACTTTTCATCGAGTAATAAAGTTTCATACTGA

>NZ_CP031991|1|1|70181-70324|PILER-CR
GAGTAATAAAGTTTCATACTGA	TCCTAACCTATCTTATTGATATTTCTACTTCGTAATGAATGGAAGAAAA
AATAAAGTTTCATACTCAGCTT	TATCATTTCTTCCATTTTTACTTTTCATCGAGT
AATAAAGTTTCATACTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031991.1\|WP_004683632.1\|79699_81223_-\|TniQ-family-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP031991.1\|WP_004683638.1\|71092_72520_-\|DNA-cytosine-methyltransferase	unknown	unknown	gnl\|CDD\|223348
NZ_CP031991.1\|WP_008942098.1\|68054_68714_+\|bifunctional-nicotinamidase/pyrazinamidase	unknown	unknown	gnl\|CDD\|238493
NZ_CP031991.1\|WP_004756853.1\|70359_70842_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_160140319.1\|61997_63185_+\|class-C-beta-lactamase	unknown	unknown	gnl\|CDD\|236894
NZ_CP031991.1\|WP_004683639.1\|70931_71144_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP031991.1\|WP_010326927.1\|84161_85187_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031991.1\|WP_008942095.1\|63269_64547_+\|replication-associated-recombination-protein-A	unknown	unknown	gnl\|CDD\|237355
NZ_CP031991.1\|WP_004683633.1\|78102_79707_-\|hypothetical-protein	TnsE_C	TnsE	gnl\|CDD\|376049
NZ_CP031991.1\|WP_017396433.1\|68802_69267_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP031991.1\|WP_004683636.1\|72582_73806_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_160140318.1\|60811_61972_+\|PQQ-dependent-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|369642
NZ_CP031991.1\|WP_004683630.1\|81236_82883_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379165
NZ_CP031991.1\|WP_005088791.1\|69490_70129_+\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP031991.1\|WP_004637244.1\|65515_66235_-\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	unknown	unknown	gnl\|CDD\|181800
NZ_CP031991.1\|WP_010326927.1\|74612_75638_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP031991.1\|WP_008942096.1\|64546_65434_+\|aromatic-amino-acid-DMT-transporter-YddG	unknown	unknown	gnl\|CDD\|183277
NZ_CP031991.1\|WP_160140320.1\|76243_77334_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP031991.1\|WP_008942097.1\|66888_67782_-\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
NZ_CP031991.1\|WP_005087342.1\|66270_66873_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371893

Protein	Function_ID	Function_description	E-value
NZ_CP031991.1\|WP_004683632.1\|79699_81223_-\|TniQ-family-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	1.61792e-21
NZ_CP031991.1\|WP_004683638.1\|71092_72520_-\|DNA-cytosine-methyltransferase	gnl\|CDD\|223348	COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair].	2.29544e-57
NZ_CP031991.1\|WP_008942098.1\|68054_68714_+\|bifunctional-nicotinamidase/pyrazinamidase	gnl\|CDD\|238493	cd01011, nicotinamidase, Nicotinamidase/pyrazinamidase (PZase). Nicotinamidase, a ubiquitous enzyme in prokaryotes, converts nicotinamide to nicotinic acid (niacin) and ammonia, which in turn can be recycled to make nicotinamide adenine dinucleotide (NAD). The same enzyme is also called pyrazinamidase, because in converts the tuberculosis drug pyrazinamide (PZA) into its active form pyrazinoic acid (POA).	4.79035e-101
NZ_CP031991.1\|WP_160140319.1\|61997_63185_+\|class-C-beta-lactamase	gnl\|CDD\|236894	PRK11289, ampC, beta-lactamase/D-alanine carboxypeptidase; Provisional.	0
NZ_CP031991.1\|WP_008942096.1\|64546_65434_+\|aromatic-amino-acid-DMT-transporter-YddG	gnl\|CDD\|183277	PRK11689, PRK11689, aromatic amino acid efflux DMT transporter YddG.	5.8248e-154
NZ_CP031991.1\|WP_010326927.1\|84161_85187_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.97342e-93
NZ_CP031991.1\|WP_008942095.1\|63269_64547_+\|replication-associated-recombination-protein-A	gnl\|CDD\|237355	PRK13342, PRK13342, recombination factor protein RarA; Reviewed.	0
NZ_CP031991.1\|WP_004683633.1\|78102_79707_-\|hypothetical-protein	gnl\|CDD\|376049	pfam18623, TnsE_C, TnsE C-terminal domain. The bacterial transposon Tn7 facilitates horizontal transfer by directing transposition into actively replicating DNA with the element-encoded protein TnsE. Structural analysis of the C-terminal domain of TnsE identified a central V-shaped loop that toggles between two distinct conformations. It is suggested that a conformational change within the C-terminal domain of TnsE underlies target site selection by regulating stable engagement of the target DNA while providing a signal for activating transposition.	7.28541e-34
NZ_CP031991.1\|WP_017396433.1\|68802_69267_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.32057e-31
NZ_CP031991.1\|WP_160140318.1\|60811_61972_+\|PQQ-dependent-sugar-dehydrogenase	gnl\|CDD\|369642	pfam07995, GSDH, Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.	3.7101e-165
NZ_CP031991.1\|WP_004683630.1\|81236_82883_-\|AAA-family-ATPase	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	7.23023e-20
NZ_CP031991.1\|WP_005088791.1\|69490_70129_+\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	3.77517e-34
NZ_CP031991.1\|WP_004637244.1\|65515_66235_-\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	gnl\|CDD\|181800	PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed.	4.23094e-148
NZ_CP031991.1\|WP_010326927.1\|74612_75638_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.97342e-93
NZ_CP031991.1\|WP_004683639.1\|70931_71144_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.5915e-14
NZ_CP031991.1\|WP_160140320.1\|76243_77334_+\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	6.40215e-09
NZ_CP031991.1\|WP_008942097.1\|66888_67782_-\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	1.50756e-176
NZ_CP031991.1\|WP_005087342.1\|66270_66873_-\|hypothetical-protein	gnl\|CDD\|371893	pfam12092, DUF3568, Protein of unknown function (DUF3568). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 130 amino acids in length.	0.000990594

>NZ_CP031991.1|WP_005088791.1|69490_70129_+|YitT-family-protein
MNTEQNISLVSAVTPVVEQHSKIEDALAMLIGTFILSFAMILLKQAGIMTGGTAGLSLLIHYITDVQFGILFFLINIPFYYFAYKKMGLALVVKTFIAVALLAGFTEIIPHFVQLSTVHPIYATVFANVLMGVSFLILFRHRSSLGGINLLVLYLQERFQLPAGKVQMGIDVAILLTSLFFVEWHLILISILGVVILNSIILLNHKATRYVA
>NZ_CP031991.1|WP_017396433.1|68802_69267_+|Lrp/AsnC-family-transcriptional-regulator
MIEELDEFDRKIIHHLQLNGRLANQELAELVGLSTSQCSRRRIQLEQKKIITGYYAQVALSADPTPIMGIIEVKLQNYNDATHDRFVDFLLHEPAVKDIHKLTGSYDFALKVAVRNLDDMVKLIGTLSSSDFGVSNLNTSIVLEKLKENGIATK
>NZ_CP031991.1|WP_008942098.1|68054_68714_+|bifunctional-nicotinamidase/pyrazinamidase
MSHQTSKLLNNAALIVVDVQNGFTPGGNLAVADADQIIPLINRLAPQFEHVVLTQDWHPDQHISFADNHKNKQPFETIELSYGTQVLWPKHCVQGTHDAEFHSELQIPTAQLIIRKGVHQHIDSYSAFMEADRQTPTGLNGYLKEHQIDTVYIVGIATDFCVAWTAIDAADLGFKTYVIEDACKAIDLNGSLSEAWQQMLAKGVIRIQSGPIFNETRDN
>NZ_CP031991.1|WP_008942097.1|66888_67782_-|4-hydroxy-tetrahydrodipicolinate-synthase
MTQLAQNIQGSIVALVTPMFEDGRVDWKSLEKLVEWHIQQGTHSIVAVGTTGEASTLSMEEHTQVIKEVIRVANKRIPIIAGTGANSTHEAIELTKAAKELGADAALLVTPYYNKPTQEGLYQHYKAIAEAVDIPQILYNVPGRTGVDMQNETVIRLADVKNIVGIKDATGDVPRGKALIDGLNGKIAVYSGDDETAWELILLGAKGNISVTANVAPKQMSDVCEAALAGDKEKAQVLNQQIANLHNILFCESNPIPVKWALHEMGYIGTGVRLPLTTLAEQYREPLRADLKVAGII
>NZ_CP031991.1|WP_005087342.1|66270_66873_-|hypothetical-protein
MQLRVGIVLVISALSLAGCGRFALNNHSLDYKKAEALEPLKFPEGATVRPFTPLYPAPTVDPLAIQHAPTFENKTGNRYALPRPESMQTTASNPDDNVVTLGRPQLVMDGNRNPLLKVEGPTAEAWQYTFATLNSLNYKVISQANNGYEATIQVDNQTYVLKLSAVGSNNTIALFKPDATFADQAIATEVLAQIYQNWPA
>NZ_CP031991.1|WP_004637244.1|65515_66235_-|phosphoribosylaminoimidazolesuccinocarboxamide-synthase
MLKQTLLYTGKAKSVYETDNADHLILVFRDDASAFNGEKIEQLDRKGKVNNRFNAFIMEKLAEAGIETHFEKLLSPTEVLVKKLQMIPVECVIRNYAAGSLCRRLGVEEGKELTPPTFELFFKDDALGDPMVNESQAIALGWATADQLEKMKELTYQVNDVLKALFDAGNMILVDFKLEFGVFHDRIVLGDEFSPDGCRLWDKDTKKKLDKDRFRQGLGGVVEAYEEVAARLGINLDDL
>NZ_CP031991.1|WP_008942096.1|64546_65434_+|aromatic-amino-acid-DMT-transporter-YddG
MNSKKATLIGLVAILLWSLIVALIKDVSTHFGAVGGAALIYTLASVFLLFSVGWVQLKSFPKTYLILGSFLFVAYEICLSLSIGYSQNNRQAIEVGMVNYLWPTFTMVAAILFNQQKANVLIIPGFAISLLGIGWVLGGEQGFDLPNMWGNIQSNPLSYGLAFVGTLLWAAYCTLTARIAQGANGITLFFVLVAVVLWIKYFLMGGGGLNFDWSSSVSLVMAAVAMGFGYAAWNVGILHGNVTLLAGASYFIPVFSALFAAFLLSTPLELSFWYGAFMVCIGSILCWFSTRTRKD
>NZ_CP031991.1|WP_008942095.1|63269_64547_+|replication-associated-recombination-protein-A
MSDTHIPLPERLRPRDLSEIIGQDHLLGDNAPLRQMIDQGHLPSIIFWGPPGVGKTTIALLLAQAVDRPFISLSALNTGVKELREVIAESGDLLTPVVFIDEIHRFNKSQQDALLNAVEKGKITLIGATTENPSFEVNSALLSRCQVYTLNSLDAEAIQTLLNKAIQTDKFLKERFIQIEEYDALIQFAAGDARKALNLIDLIASTFEADVENVVTNAIVVKVAQQNIARYDKSGEQHYDLVSAFIKSIRGSDPDATLYWMARMLKGGEDPVFIARRMLIAASEDIGNSNPNALLLAGECFRSVQAVGMPEARIILGQCAVYLATSPKSNSTYLAINRALELAEKTANLPVPLHLRNAPTKLMKQQGYGLDYLYPHNYPEHFVLQAYLPPELQGTKLYERALNKREVEAERLQQRRWQQEQQQQQ
>NZ_CP031991.1|WP_160140319.1|61997_63185_+|class-C-beta-lactamase
MTKPNDFSRTLKKLLMAAGLLSFSSILWAKNLTEQQVKAVIDQQFKPLLAQYKVPGMAVAVTLNGKHYFVNYGLASKQSQQAVSNKTLFELGSVSKVFNATLAGYAQAQGQLSFSDHPAKYFPELKNTAVNQATLLNLGTYNAGGFPLQFPDHVVKQQDMIRYFQEWQSKTKIGAARQYSNPSIGLMGYVTALAMKKPYVELIEQTLFPQLGMTQSFINVPKPYMSQYAWGYKADQAMRVSPGMFDAEAYGVKSSSADMLKFLDAQINVQQLQQPIRKAIEHTHVGYFELGAMTQGLGWEQYAYPVKLETLLEGNSSKMALESHAITPIKQPKIASPATYFNKTGATNGFGAYAAFIPQQKIGMVMLANTNFPNEARITATYQAMQQILKQNAAQ
>NZ_CP031991.1|WP_160140318.1|60811_61972_+|PQQ-dependent-sugar-dehydrogenase
MIKHIVTPLLCSGFIFLQACGTNNSNPKTTDQSTAQHSRQASLQTYHIENIAQFNEPWAITSLPDQRLLITERRGQLKIFDPKTKQSLSVEGIPAVSYGGQGGLGDVILHPDFQNNHWIYLSYAVKGQGGYGAVISRAKLDLSSATQPKLSDVKVIWQQVPKVSGQGHYGHRMVFGADGKLWVSSGERQKFDPAQDMKSNLGKVLRLNEDGTPAEGNPFSQQGGVSAEIWSLGHRNPLGIAFDTQGQIWVVEMGPEGGDELNLIVKGANYGYPIVSNGNHYSGLPIPDHSTRPEFKAPEIDWTPVISPSSMIVYTGDQFPLWRQKALIGGLSSKSIVVVDLNAQPVKEVQRLDMKQRIRGLHQAQDGSIWVIEDGPQAKLLKLNAN
>NZ_CP031991.1|WP_004756853.1|70359_70842_-|hypothetical-protein
MKQIASPIFQSFLELLSHNQIDGWTSNKIWNNLNLSKDEKERINQQQLYRLLRKMVQQGHLVKHIHSDNPRLSTFVETESMYEFRKQFDLAIVKTDSKKLNFKTNELKEKQKIYENQIKASEQALIDFPELKTEILRRKNQLLQNIEKLKAYTDFLTSLI
>NZ_CP031991.1|WP_004683639.1|70931_71144_+|helix-turn-helix-transcriptional-regulator
MFMSELTIQFGQLVRKYRKEKNMSQEQLALLCNMDRSYLGRIERGEVNPTLEKIYELASALETLPSKLLP
>NZ_CP031991.1|WP_004683638.1|71092_72520_-|DNA-cytosine-methyltransferase
MHFIDLFAGCGGLSLGLLQAGLTGTFAIEKNPDAFKSLKFNLIDGTSSKQYQWNQQDLPIQPYDIHNLILEKSHLLAELGRTKSIDLIAGGPPCQGFSTAGRRDPNDPRSTLVYDYLKVVSLVRPKIILMENVKGITYKIKDQPATANSIKSNLAELGYLPITFIEDSSVWGVPQHRIRFILFGINIEEIIGVNPSLSKKQILEFSKKVTPLFEEKFNLFAKNFKANKNLPIKVSAQEAIADLKTLSKYNRAYKLKNVTDIPSDRFLQISSTHCPQNLNRSYIDLMRKGLSQDFLPTGLRLANHTPIIKAKFKRILKDLNSPYLSEKYKLRRMRTLPKDYVLDTFNTKKQITKVLDASECAPTITTLPDDLLHYDEPRILTVRECARLQSFPDWFEFHGPYTTGGDRRKVSCPKYTQVGNAIPPLMAEGIGLFLLNEFNNICHELKLELLNYQKEIIKNQGSNLDGKVSKALANS
>NZ_CP031991.1|WP_004683636.1|72582_73806_-|hypothetical-protein
MKFDDFDTTFDDFGTPEETTKNVIEKKEFLPWHKPRKQWIRHKQWWTQIDEHIVKKLKPGIDTIKYFGLPGNDLLDIRFFQQKLPSLQKKICLFGLINTEIGWSSAQTQLSKIMDLDGVDKSSKVEQLNFDYLENTSSIAFDKLMEFGCFDVVNLDFCENVIPNATENRLKALHNFMEYQFQKISENWVLFITTRSSKDTTNSGLYEELVACIDENLSEVIYFQEFIRVFSSILLNNNSIVRSDLENQKHINMLVVGLMNWLVKTAHNRHFKVKLSNVVRYDITGENTNDMMSMCFVFTRVMNFPNANPPLPTKAEQAKNSLNKLANISNLDDIMISGGINYYAQFVKEQIDLLKEAGYHTDDYLNQICTNDLAKLQTTAEQLNSIMEAIEQPQQLISAEIMSSDNA
>NZ_CP031991.1|WP_010326927.1|74612_75638_-|IS30-family-transposase
MEYIKLSYHHLNFEDRTALMLESRKEGFSARKFAELIKRHPSTIYRELKRNSINDVYQARYASDNTFARRRRGHRKLKIDSILWKFIVEAIRCLWSPQQIAKRLKTFPDLDQTMNVSHTTIYSTIRALPKGELKKDLLSCLRHENKKRKANGEPKKDSILQDIKTIHERPAEVQERKIPGHWEADLIKGKDNKSSIATLIERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTYDRGREMAEHKILEEDLGIDVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAMSLNTRPRKALDWLTPLEKFAQLVDYHKTFQTVAPHV
>NZ_CP031991.1|WP_160140320.1|76243_77334_+|IS4-family-transposase
MTHFNELHLILNKYLKWNKSHVKCFTLIMIALIVKQTCNLSSASKALPIKCLPQSFYRRIQRFFAGQYFDYRQISQLIFNIFSFDKVQLTLDRTNWKWGKRDINILMLAIVYRGIAIPIVWTLLNKRGNSDTKERIALIQRFISIFGKDRIVNVFADREFIGEKWFTWLIENDINFCIRVKKNFIVTNHLAKNHKISDLFRHLQVGQTECRKRRIWVGRVKLYISALRLEDGELLLVVSPMFNASAIRDYALRWEIETLFSCLKGRGFNLENTRLTDPGRVKKLIAVLAIGFCWCYLTGEWQHDRKKAIKIKKHGRLSVSLFRYGLDYVQMAILRLIGFGKKEEFKKVLAILRKKKPDRTRAL
>NZ_CP031991.1|WP_004683633.1|78102_79707_-|hypothetical-protein
MAKISHIAKNMKIKKIGSLFKKHNSGSWATNLALENENKVTETTYTNFSNAKLLRKNSHINPTQEYPKGYNLRFKISSTQDWLSSVYDSNLPKGKFIEHYFLFDAVRVDQFGQPMSETIKVRLPQFELARSLFFYTPYLARSAVLENSLSIDFDIVSNPDHYLINILPACSYPTSHFNDAGIRRILSWILLDSDIRQSFESISQFCTKYGYDVDQYRIWSFCFNPPQLNGVIFNTFGYYKAETSEFFVNEISGFERISSQISKEVEFYSDKFVESKSGGKGENSSGTKNDGKESTIKDDEEGNSDDVQIIDVVPTHFDFLEAIETRKTSKKTRHRNHGIKDQDLPSNNATSEVSTNEPIFEGTVPSAEFNGVEDETEDLHLYLDRFSAFQQMIDLFCKENSIKNFTFQLHKLPNIQGHSKHIKTDGNPRCVAEVSFQFHGQNIVILEVDTSDNKKPLSTRILSLKNTNQWHTIDRAKVLELIVTQCLRWPKGTLKKISFKSSTLNHPRMDIDKQEISANELETWLNRLNKCLEI
>NZ_CP031991.1|WP_004683632.1|79699_81223_-|TniQ-family-protein
MLNFPTPYPNELIYSTIARAGIHHAITSPKQLLEEVFANRKVIATIDLPSHLRCLLKHLPPHYTLENLAYKHTLFPIHALFSPENTRLKCLQWMRNQSKGSIHLTLGVAASKVKQISTHRYCRHCLEEQYDQYGEFFWSRLWYIQGANCCSKHKVKLSEFLQPVHLNGRHQFIPASSILNHKQSHNPAHELDLIVSRHVDELLNLPPSTSPTFHQWSQFYQLIAKRLGFNKGSSHIDHSKIYSAVIKTWDLKWLQEHHLDKLKSETSWLKAIFRKHRKSFSYLEHIIVLETFFTKNWTWTAILSEIHQLPSNPFKLDTSILKNKYKDILMLKEKRNEWMSLIQNYGIKPSRVKNAALYAWLYRNDKMWLLNKNRKFHVLPTLGRKKINWPLRDWQMVRRLFKIFYQSLNDLNLPRQSRNWYLRQLPQHSTVEKNLYQLPLTHKFLNTFSEDISSYQIRRITRTIIQFKKMNQHPANWQLLRHSGLSEERLTDEALKFLNQMKRMNHG
>NZ_CP031991.1|WP_004683630.1|81236_82883_-|AAA-family-ATPase
MTLPLNFIQARYTSSFGEYKDNPFIEALPPIMQEIADIKANLIGKVDFNPEDILRSKNERIHLSSQLLHQFFQPITRHISLEQKIAILIRQGYVGRNIADGKLHQHLQNGYERIMSGDINAFRFDAPKSTALSYSLIGCSGSGKSTTLQRILNLYPQVIYHEKYNFTQLVYLKIDCPHDGSLKNLCLHFFKAIDVALGTDFERKVALKRLGIEALLNYMRQITNTYAIGVLVIDEIQHLSVKNSGGAEKMLNFFVTLINVVGLPVVMVGTPKAKFIFDGDLRSARRGAGFGAVIWEPMKNNPPLSNTATRTEWMAFTNALWKYQWLTNKEQLSDEIRDCWYELSQGVLDIVVKLFVLAQCRAIMTGLERITPNLLRQVYEDELKFVHPMIEALKSGDPNRIALYSDLTIPYVDKTLLLLQKKIEEEQEKVEQYNGNVHAQRLHNLLIATGYPESKVISVIKKAFIDFPHLNMQELMPIVSNWLTEVEADKEIKPETTNLRKIKQSEWITLPSDDLRFKFSQKQKSQNFYDVLQSSELIFDTQTWIQSM
>NZ_CP031991.1|WP_010326927.1|84161_85187_-|IS30-family-transposase
MEYIKLSYHHLNFEDRTALMLESRKEGFSARKFAELIKRHPSTIYRELKRNSINDVYQARYASDNTFARRRRGHRKLKIDSILWKFIVEAIRCLWSPQQIAKRLKTFPDLDQTMNVSHTTIYSTIRALPKGELKKDLLSCLRHENKKRKANGEPKKDSILQDIKTIHERPAEVQERKIPGHWEADLIKGKDNKSSIATLIERNTRLCILATLPDAKAESVRKALTEALKYLPAELRKTLTYDRGREMAEHKILEEDLGIDVYFCDPHSPWQKGTCENMNGLIRQYLPKGIDLNQADQHYLNQVAMSLNTRPRKALDWLTPLEKFAQLVDYHKTFQTVAPHV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031991_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031991_2

513217-513703

Orphan

Consensus_repeat	Method
CCACCGATACCNCCAATNATGCCAGTGATNNGAT	CRT

8 spacers

The CRISPR arrays of NZ_CP031991_2

>merge|NZ_CP031991|2|513217-513703|CRT
CCACCGATACCACCAATAATGCCAGTGATTGGGCTTAATAAACCGCCGTCACCACCACCACCGATGCCACCAATAATGCCAGTGATTGGATTTAATAAACCGCCGTCACCACCACCGATACCACCAATGATGCCAGTGATTGGACTTAATAAACCGCCGTCACCACCACCGATGCCACCAATAATGCCAGTGATCAGATCAAGAGGACTACCATCACCGCCAATGCCACCGATACCGCCAATGATGCCAGTGATCAGATCAAGAGGACTACCGTCACCGCCACCGATACCACCAATGATGCCAGTGATTAGGTCAAGCGGACTACCGTCACCGCCAATGCCACCGATACCGCCAATGATGCCAGTGATTAGATCAAGAGGGTTACCATCACCACCACCGATACCGCCAATGATGCCAGTGATCAGATCAAGTGGACTACCATCGCCGCCAATGCCACCGATACCGCCAATGATGCCAGTGATTAGAT

>NZ_CP031991|2|1|513217-513703|CRT
CCACCGATACCACCAATAATGCCAGTGATTGGGC	TTAATAAACCGCCGTCACCACCA
CCACCGATGCCACCAATAATGCCAGTGATTGGAT	TTAATAAACCGCCGTCACCA
CCACCGATACCACCAATGATGCCAGTGATTGGAC	TTAATAAACCGCCGTCACCA
CCACCGATGCCACCAATAATGCCAGTGATCAGAT	CAAGAGGACTACCATCACCGCCAATG
CCACCGATACCGCCAATGATGCCAGTGATCAGAT	CAAGAGGACTACCGTCACCG
CCACCGATACCACCAATGATGCCAGTGATTAGGT	CAAGCGGACTACCGTCACCGCCAATG
CCACCGATACCGCCAATGATGCCAGTGATTAGAT	CAAGAGGGTTACCATCACCA
CCACCGATACCGCCAATGATGCCAGTGATCAGAT	CAAGTGGACTACCATCGCCGCCAATG
CCACCGATACCGCCAATGATGCCAGTGATTAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031991.1\|WP_008941226.1\|523068_523977_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP031991.1\|WP_005086808.1\|507254_508250_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|225722
NZ_CP031991.1\|WP_005086792.1\|521263_522160_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200583
NZ_CP031991.1\|WP_004640968.1\|524004_525255_-\|YihY-family-inner-membrane-protein	unknown	unknown	gnl\|CDD\|179313
NZ_CP031991.1\|WP_005086790.1\|522151_522961_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP031991.1\|WP_160140347.1\|511799_512321_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_008941219.1\|501179_503618_-\|ribonuclease-R	unknown	unknown	gnl\|CDD\|273947
NZ_CP031991.1\|WP_008941218.1\|498948_500988_-\|M3-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341051
NZ_CP031991.1\|WP_004640980.1\|520012_520510_+\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP031991.1\|WP_008941222.1\|506714_507158_-\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815
NZ_CP031991.1\|WP_115736360.1\|526915_527698_+\|NRDE-family-protein	unknown	unknown	gnl\|CDD\|377554
NZ_CP031991.1\|WP_115736359.1\|520551_521193_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP031991.1\|WP_005086812.1\|505203_506700_-\|tripartite-tricarboxylate-transporter-permease	unknown	unknown	gnl\|CDD\|225870
NZ_CP031991.1\|WP_004640990.1\|508769_509879_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP031991.1\|WP_004640966.1\|525370_525961_+\|NAD(P)H:quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|179647
NZ_CP031991.1\|WP_004640964.1\|525996_526809_-\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|183527
NZ_CP031991.1\|WP_005086820.1\|498703_498910_-\|YheV-family-putative-metal-binding-protein	unknown	unknown	gnl\|CDD\|312883
NZ_CP031991.1\|WP_008941221.1\|504073_505138_-\|AbrB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377472
NZ_CP031991.1\|WP_160140346.1\|510410_511109_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_008941224.1\|518561_519857_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP031991.1\|WP_005086808.1\|507254_508250_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|225722	COG3181, COG3181, Uncharacterized protein conserved in bacteria [Function unknown].	1.32377e-99
NZ_CP031991.1\|WP_008941226.1\|523068_523977_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	1.03589e-11
NZ_CP031991.1\|WP_004640968.1\|524004_525255_-\|YihY-family-inner-membrane-protein	gnl\|CDD\|179313	PRK01637, PRK01637, virulence factor BrkB family protein.	3.29727e-73
NZ_CP031991.1\|WP_005086790.1\|522151_522961_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.49359e-22
NZ_CP031991.1\|WP_005086792.1\|521263_522160_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200583	cd10960, CE4_NodB_like_1, Catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases. This family includes many uncharacterized bacterial polysaccharide deacetylases. Although their biological function still remains unknown, members in this family show high sequence homology to the catalytic NodB homology domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily.	3.62507e-73
NZ_CP031991.1\|WP_008941219.1\|501179_503618_-\|ribonuclease-R	gnl\|CDD\|273947	TIGR02063, Ribonuclease_R, ribonuclease R. This family consists of an exoribonuclease, ribonuclease R, also called VacB. It is one of the eight exoribonucleases reported in E. coli and is broadly distributed throughout the bacteria. In E. coli, double mutants of this protein and polynucleotide phosphorylase are not viable. Scoring between trusted and noise cutoffs to the model are shorter, divergent forms from the Chlamydiae, and divergent forms from the Campylobacterales (including Helicobacter pylori) and Leptospira interrogans. [Transcription, Degradation of RNA].	0
NZ_CP031991.1\|WP_008941218.1\|498948_500988_-\|M3-family-metallopeptidase	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	0
NZ_CP031991.1\|WP_004640980.1\|520012_520510_+\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	9.76229e-06
NZ_CP031991.1\|WP_008941222.1\|506714_507158_-\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	4.55106e-07
NZ_CP031991.1\|WP_115736360.1\|526915_527698_+\|NRDE-family-protein	gnl\|CDD\|377554	pfam05742, TANGO2, Transport and Golgi organisation 2. In eukaryotes this family is predicted to play a role in protein secretion and Golgi organisation. In plants this family includes Solanum habrochaites Cwp, which is involved in water permeability in the cuticles of fruit. Mouse Tango2 has been found to be expressed during early embryogenesis in mice. This protein contains a conserved NRDE motif. This gene has been characterized in Drosophila melanogaster and named as transport and Golgi organisation 2, hence the name Tango2.	3.11513e-70
NZ_CP031991.1\|WP_115736359.1\|520551_521193_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	7.21908e-71
NZ_CP031991.1\|WP_005086812.1\|505203_506700_-\|tripartite-tricarboxylate-transporter-permease	gnl\|CDD\|225870	COG3333, COG3333, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP031991.1\|WP_004640990.1\|508769_509879_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	1.41649e-34
NZ_CP031991.1\|WP_004640966.1\|525370_525961_+\|NAD(P)H:quinone-oxidoreductase	gnl\|CDD\|179647	PRK03767, PRK03767, NAD(P)H:quinone oxidoreductase; Provisional.	1.16417e-59
NZ_CP031991.1\|WP_004640964.1\|525996_526809_-\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	7.61158e-125
NZ_CP031991.1\|WP_008941221.1\|504073_505138_-\|AbrB-family-transcriptional-regulator	gnl\|CDD\|377472	pfam05145, AbrB, Transition state regulatory protein AbrB. Bacillus subtilis respond to a multitude of environmental stimuli by using transcription factors called transition state regulators (TSRs). They play an essential role in cell survival by regulating spore formation, competence, and biofilm development. AbrB is one of the most known TSRs, acting as a pleotropic regulator for over 60 different genes where it directly binds to their promoter or regulatory regions. Many other genes are indirectly controlled by AbrB since it is a regulator of other regulatory proteins, including ScoC, Abh, SinR and SigH. Hence, AbrB is considered a global regulatory protein controlling processes such as Bacillus subtilis growth and cell division as well as production of extracellular degradative enzymes, nitrogen utilization and amino acid metabolism, motility, synthesis of antibiotics and their resistant determinants, development of competence, transport systems, oxidative stress response, phosphate metabolism, cell surface components and sporulation. AbrB is a tetramer consisting of identical 94 residue monomers. Its DNA-binding function resides solely in the N-terminal domain (AbrBN) of 53 residues. Although it does not recognize a well-defined DNA base-pairing sequence, instead, it appears to target a very weak pseudo consensus nucleotide sequence, TGGNA-5bp-TGGNA, which allows it to be rather promiscuous in binding. The N-terminal domains of very similar sequences are present in two more Bacillus subtilis proteins, Abh and SpoVT. Mutagenesis studies suggest that the role of the C-terminal domain is in forming multimers.	1.0979e-68
NZ_CP031991.1\|WP_005086820.1\|498703_498910_-\|YheV-family-putative-metal-binding-protein	gnl\|CDD\|312883	pfam09526, DUF2387, Probable metal-binding protein (DUF2387). Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.	3.33363e-10

>NZ_CP031991.1|WP_160140347.1|511799_512321_-|hypothetical-protein
MAVSVALAAMDSPLDLITGIIGGIGGIGGDDGSPLDLITGIIGGIGGIGGDGSPLDLITGIISGIGGIGGDGSPLDLITGIIGGIGGIGGDGSPLDLITGIIGGIGGIGGDGSPLDLITGIIGGIGGGDGGSPLDILTGIIGGIGGGDLGNNPITGVIQTGIDILQGVESLKN
>NZ_CP031991.1|WP_160140346.1|510410_511109_-|hypothetical-protein
MTGIIGGIGGGDLGNNPVTGVIQTGIDILQGVESLKTDLINTGINTVADTILGVFPQAEHPVSDLANLGTLTFETSRDTVNGTLEAISDLAGADFGGALGNATGVIGTLINNGSTAADIIQHIVGDDLLGGGILGSIGGGIGGDGGLLSPITGILGGDILGNLGGLLSINVGDNCGCTSSNGGVDSILDSVLGAASSSQILSASGSTTNFTDNLSIPSLNLSEQLFESTNLF
>NZ_CP031991.1|WP_004640990.1|508769_509879_-|porin
MKVNFLIASILTVITSSAIAAPKIYGEIDASLDYLPENNAAKSDRDVWKVNSNSSFLGIKGEEKLTERLSAIYQIEWSFNADGDGTDWSQRDRFVGLKDQKLGTLKIGKNNSPLKKLSTAVDSFNNYVRNTADITSIMPGENRINNSVVYDSPKFSIGEQGNLEFSALLATGEAQGIRNNQGGVTVDGGGLGDAWSTSLTYSDPIFLAAIAYDKAIPSNLLGQGFLNASDTHIDIDKVFAAANTLRLTARIKPIETLSLKALIQKSEIEEAKGNPASAANIDDSVGWLIGAEYRIPNHDKWNIKAQYSQNTTSFKNNDADYDAQQIMAGVDYAFNKQVRAYGYTGYATFKQADAKDKQPVVGTGLEFKF
>NZ_CP031991.1|WP_005086808.1|507254_508250_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MLRGIILTSTLVTLGFGLTACGKNKGEVGEPKRPECIAPAKPGGGFDLTCKLAQNAFKETKLLNSPMRVTYMPGGVGAVAYNKIVANDPANDNAIVAFSTGSLLNLAQGKFGQYTEKDVRWLAIVGTDYGVVAVNAESPYKNLNDLVAALKKNPKSVSFGAGGSVGGQDWMQTAMLAKAAGVNPKDMTYIALEGGGEAVTSVLGNHIQVVSAGIAEVIPHIKSGKVRALAVFAPERLPNELANIPTAKEQGYDIQWPVVRGYYVGPKVSDEAYQWWKTSFEKMMQDPKFEQSRQQFELLPLSMTGEELDQFVIQQTNQLRALSKEFDLVTK
>NZ_CP031991.1|WP_008941222.1|506714_507158_-|tripartite-tricarboxylate-transporter-TctB-family-protein
MSAERIFSGTLGLVSLGLLYLAWGYVAPIAYDPLGPRPYPVLLLLLLISCCLYLTFRPRKLAEFIDLGYTPSVLKKIGLLMLFMLIYAVTFEFLGFPIATAIMFFLVGTLFGGSLKASLITGIVFGCLLYGLFDYILDVPLPLGFFS
>NZ_CP031991.1|WP_005086812.1|505203_506700_-|tripartite-tricarboxylate-transporter-permease
MDVFEYLMYGFQVALTPQNLFIALIGAFIGTIVGLLPGLGPINGVALLLPFAYALGLPPESALILLAAVYLGCEYGGRISAILINVPGDAAAIMSTMDGYPLAKQGKAGIALSLSAMSSFIGSLIAIIGIVLFAPLLAKWAIVFGPAEYFVLMVFALTCLSGLVGDQPIKTAVAALIGLLFATVGVDAVTGVYRFTFDSVNLSDGVQFTTIVIGFFSISEILIMLEKTAIGQKALGQGKRSLFNLKEFLFTLKTTIRSSLLGFIVGILPGAGATIASAMSYTSERKLAGKDGKFGDGDLRGIAAPEAANNASACGSFIPMLTLGVPGSGTTAVMLGALTLYNITPGPQLFTEQPTIVWGLIASLFIASILLLIMNISLVRFFAKLLSVPNFILLPAIAAVSFVGVYAIHSTVFDLVLMVGLGIFGYILRKLNFPLSALILGFVLGELMESSLRRALSISQGELSILFDGYITKVLWILAGIMIVLPLIRWLRNRHRAI
>NZ_CP031991.1|WP_008941221.1|504073_505138_-|AbrB-family-transcriptional-regulator
MQLYLKYALSLSLAFLGALVAQWLHLPIPWLLGPLFTTALLKINHAPIECHNSARSIGLSIIGLTLGLYFTPEMIHLIASHWLVLLIGLLFALLLGAIGAFILQRWAKVDFKTAWFASAIGGANEMSHLAEHYQARVDQVASAHTLRVLMVVVIVPFFYQFMGWHGFDTDQIAKHLEVNWFGFFSLVLISYIASRIFIQFKLPNPWTFGALLVAIFFTAQDIHLSAIPTPIIHLGQVLLGWSLGNKFKPGFFKTAPRYLSIVALCNLGALFLTGLLAYTLMQWTDLPIATLGLGLAPGGVAEMTITAKVLQLGVPIVTAFHVVRMVGVLGTVGYLYLFFDKILQKKIQTQKNRN
>NZ_CP031991.1|WP_008941219.1|501179_503618_-|ribonuclease-R
MTTNWVDPEAKAEAERYDNPIPSRTLILTTLEQLKTAQSHAELVEHFNIQDQKSIDALNHRLSAMVRDGQLMKDGFKYQPSTDAPSYEATVYINSKGLGTANIAGQDDVLLPERELRLVFNGDRVKVRQTSVDRKGKAWGFITEVVQRRVKQIIGKVAEHQGEYFIQPSNPNQHQPITLEKELIEHANAKVGDMLRVAIDDYPTREELATGHVVQSMADKADTEIIIPQTILEFGLPYEFPEAVIKEAESFKEPSAQDIKNRVDLRDLPLVTIDGEDARDFDDAVYAEKRPGGGYRVVVAIADVSHYVRLESPLNEEAEDRGTSVYFPHFVLPMLPEALSNGLCSLNPHVDRLCMVCDLKLSRAGKVTGYEFYPAVMHSKARLTYTQVGQYFEGATDAIPEDKTIHKSLNTLFQLYQTLKGLRAERHAMEFETIETYMTFDELGGIKEILPRTRNDAHKLIEECMLLANVAAAEYCLEHDIPMLYRVHEAPEFSRIQKVRDFVKLLGLPFPEQPTQADYQRVIEATKDRLDAPSIHAVLLRSMMQAYYGAKNSGHYGLAYEAYTHFTSPIRRYPDLLLHRAIKAYLQQKPYPLSGAALDDAGEHFSQTERRADEASRSVTTWLKCHYMQQHLGDEFVGVISAVTEFGLFVTLKDLYVDGMIHVSQLGEDFFLYDQASQSLIGQNRGQSFSLGDEVKIQVAGVNLEERKIDFQLVQQLTHLGRVIRQKAPRTANPSSSNRASTTEEVFGKAPSSTKAKVSEDGEKPVRKKKDKNKPSSYSKKPAKKASAKPDTKEKAKKKVKKKKSNAKAKAE
>NZ_CP031991.1|WP_008941218.1|498948_500988_-|M3-family-metallopeptidase
MTLQQATLPTPQFNQIQLADLKQQIESTIQNGQNFLNQLNEAPQDIEAQLATLTEVDQLENNMSESWGILSHLNAVMNNAETREVYQSLLPSLSEYYTQLGQHTALYQTYQQIHDSAAFQSLSEAQQSAIKLALRDFKLSGVALEGEAKKRYAEISARLSQLSSDFSNHVLDATQAYFKALTEEQLKGLPQSSIELLKQYGQQRELDQAVATLDFPAYFAIMTYADDRELREELYKAYVTRASEQSDKTEFDNTPVMEEILSLRQEMAQLLGFNNFAEYSLASKMAPNVETVDKFLVDLAEHARTPALAEIAELKAIAQQDGIEELKPWDATYYSEKLKQQQFNLSQEALKPYFPAPKVVDGLFQIVQRLYGIQIVERQAPVWQNDVRYFEIEDQGQVVGGFYFDLYARNGKRGGAWMSGFRSRVQTTNGLQKPICYMVCNFTPPIGDQPALLTHDEVITLFHEFGHGLHHMLTEVDNISVAGTHGVAWDAVELPSQFMEFWAWDNESLDVLSEHIETKQTLPQELLTALLNARFFQSGMQTLRQIEFALFDLTIHRQSPALNSEQIQATLDDIRAKFSVVPTVAYNRFQHSFSHIFAGGYAAGYYSYKWAEVLASDAFDRFENEGIFNTETGKEFRKFILAVGGKDTALDAFRNFRKREPKIDALLRHQGWTKTDKTA
>NZ_CP031991.1|WP_005086820.1|498703_498910_-|YheV-family-putative-metal-binding-protein
MKRQFIAGAKCPKCGALDRVVKIITVDDEWIECIECAYSEKRPTHVEESQPAEPDEIGVIQFKPRHFD
>NZ_CP031991.1|WP_008941224.1|518561_519857_-|hypothetical-protein
MSRFITLFTIFLYCSIQYSFAQLITWSDNIPSAIQPFQNQPKTLASYTQNDIFIYGHPAVKTSVPTLKNNPQPTANFTTAAMIVPVNAQQVEKTLTDFHQYVGLFPTLKSAKTLAQSGNITQMKYRVSIPTPIPVLNFNENIIMQHQLTENSISTLVIDAPIPYGVGKFEWFALDENRTLITLTQWGDLNQPQGFLVKKILAAIPEVKLGIPSSGSAFILESLRTRFNTLTPIALPAGQTPSPQLTPAQLVKIAQLSQAAQQPVSFLHSPTTIAYTHGRESMRFTTTYQFYKQSPQQLQKWLAPVTYKELFPRQIKKVSTTPIQNQSQDADIQVNVSLGVINIPFAFKLQFNYPQTTENNFHANGGDLRYIKGRMQINTVNQGSLFKMTTAMKIDEKAPFLLRAMRSLPYHDTLPAVGGNTVFVQKIRTKL
>NZ_CP031991.1|WP_004640980.1|520012_520510_+|YcxB-family-protein
MSEQRPTISARFYLNLEESQDGFALVTFGKKPITRFLTPAISIAIILWGIYLGFTGVGRYYVALGVFFLIMQAIMRFWLLPLLFKRQFVRYQFGKSEQGIDLYQDYFELYAAGKKQKAQYSEVQSFVIGKLTYMLELKNQTVVIVPKRVFTNPADQNKFENSFKK
>NZ_CP031991.1|WP_115736359.1|520551_521193_+|fumarylacetoacetate-hydrolase-family-protein
MNTQPSKIVCVGRNYAEHAKELGNAVPDRPILFMKPPSSLATLAQGVAWNQALGECHYECEICLQIAHPLSQEIDKNKALEAIGAITLGLDLTLRDLQSELKNKGQPWERAKAFDGACILADWLEADEIGDLQELELVLMINGEQRQHGFSRDMLFDIGALLVEINQSFSLQAGDVIMTGTPAGVGALNPNDQLTMKLITQSGEYDWDTFVKA
>NZ_CP031991.1|WP_005086792.1|521263_522160_+|polysaccharide-deacetylase-family-protein
MKIGLYLTLFLITSFVHAKQLALSFDDGVNPDLNVQALTINQHILEQLHQHRIKSIIYPSVIKIGDYAGVQLVAEWGKQGHQIGNHSEFHLNLNKDSISSQQYIDGIRRAEQVFQPLQGWVARYRYPFLKEGNTQEKRDAVVGYLKQHDYQSGAVSIDASDWFYNQKYLSYQKHHQSDQLEKLKQAYIYHLLDRADYYDQLAIDTIGYSPKHVLLLHVNAINAAFLDDVVLAFQQQGWQWIDSEKAYTDPLYQLSSTVLPAGESIIWSLAKQQGHADLRYPAEDAPYEQENLKRYGLL
>NZ_CP031991.1|WP_005086790.1|522151_522961_-|helix-turn-helix-transcriptional-regulator
MKKSAHRIQDFQELPACDDIPASLWLRIRDAPAETFYPKHAHAWGEFIYTFDGVLEVSIDQIHYLTPPPYGIWLPPHLQHSGINRHEVTHCILYVHENLCQNMPQQAGILLTAPLVPALLEHIRKHPFSEQDPEYLRLLQVLLDALTHAELVGSYLPTTQHPALSKILSHLHAYPADNSTLQQLAEMINMTERTLARYSQKELGMSLHEWRQRLKVMKAMSMLNQGKTIENIALDLGYASSSAFIYMFKRWMHFTPDQFRKLYQGSSLQ
>NZ_CP031991.1|WP_008941226.1|523068_523977_+|DMT-family-transporter
MDERKTLDARASGLMIGLCMIWGLQQVILKMAAPDISPLMQIALRSGLAAILLLPLLYLDKAAELFNRQNLQAGALVAFLFSLEFFLLAQALQWTSASHAVVLLYTAPIFVALGLHWKLPAERLSWLQWSGIALAFIGIVVTFIREQSGTASAIEQQMLWGDLLALAAGIAWAATTITVRLSSLAQAAVTQTLFYQLAGSFILLFGLAVFLGQASIHFTPLVIGSLAFHTLVVSFASFLAWFWLLRNYLASRLGVFSFLTPLFGIIFGVWLLDERIEPNFVLGSILVLAGIVVVSLQGWLRK
>NZ_CP031991.1|WP_004640968.1|524004_525255_-|YihY-family-inner-membrane-protein
MILNRYLKKLNFLEKTWFQFIVFVLRRFEADRCREQAGSLTYTTLFAVVPMLTVFLVIISSIKALEPARQQLQQLIYSNFLPKSTIAFDKALSAFTDKSSNLTIIGILFLFVTTVLMLSSIENVFNRIWRVKETRTGLVGFMRYWTIISLGPILLGSAFVLSSTVASMNILSNNFAGYQLNGAFLLWLISFLLTIIGFFILYWTIPNRNVPIYSAMIAACFSATVFEVLKRLFGWIMSNFTSYEIVYGAFAAVPIFLLWIFLSWNIILLGVEISYALTAFHSGKEQKRHPIMMLLDILELFYKKQQVGNSVSEHELLDIVGRGELGRLPSYILQLEAQNLIKRTDNDEYVLVRNLAQVDFWSFFTALPYPLPLRDDVANVHADDEWMEKIGPALIESNDYLAAKLSIPLSTIFEQK
>NZ_CP031991.1|WP_004640966.1|525370_525961_+|NAD(P)H:quinone-oxidoreductase
MQPYVLVLYYSKYGSTRQMAHLIADGIESAGVNARIRTVPNLATVVTEAQPSIPADGDIYCSLDDLAHCSGLALGSPTRFGNMASEMKYFWDQTTSLWLNGALHNKPACVFTSSGSMHGGQESTLLTMLPPLFHHGMMILGLPNSIPALSNTKTGGTPYGASHVSGPRHDQSLSQDEKILCEAQGKRLGELVKKLI
>NZ_CP031991.1|WP_004640964.1|525996_526809_-|prolipoprotein-diacylglyceryl-transferase
MLTYPNIDPVALSLGPVQVHWYGLMYLLAFLCAWGLASYRAKQRDGWTGDMVSDLVFYGALGVVLGGRVGYVLFYEFGKFLENPLWLFQVWTGGMSFHGGFLGVMIAMLFWCKKYQKTWFQTLDFIAPCVPTGLMFGRIGNFIGGELYGRQVQDPSYPFGMIFPTDPLGLVRHPSQIYQALCEGLLLFIILWWFSSKPRPRMAVSAVFLVGYGVARFFMEFFRQPDADQGFILFGWMTKGQILSFPMIIIGLWMIWYAYRKNIYDWQLKK
>NZ_CP031991.1|WP_115736360.1|526915_527698_+|NRDE-family-protein
MCIVAFAWHVLEDMPLCLISNRDEFYHRPSACLHAWENSSIIAGQDLQSGGTWMGITASGRWAIVTNFRNGRDKNQYQTSRGHLIQTFLESDLTPIRFAQQLELKQQEYAGFNLFVGDREQAVYMSNRGEAPQVLANGVYVVSNGLMSEDWEKTKHLRKRFTQEFLPMLQQSNITETALHSTVWDILEDERKVILDLLPDTGINAEMEALLSSTFIQSPIYGTRCSNFLRMRQQQWLWTEKAQQGEQQGEIVEQKISLLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031991_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031991_3

748304-748401

Orphan

Consensus_repeat	Method
AGTGGCGAGTTAAGAAAAGCAACGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031991_3

>merge|NZ_CP031991|3|748304-748401|CRISPRCasFinder
AGTGGCGAGTTAAGAAAAGCAACGCTCTTGCGGAATATATTCCTCATGCGCAAGACGAGCAGCTATGCTGTGAGTGGCGAGTTAAGAAAAGCAACGCT

>NZ_CP031991|3|1|748304-748401|CRISPRCasFinder
AGTGGCGAGTTAAGAAAAGCAACGCT	CTTGCGGAATATATTCCTCATGCGCAAGACGAGCAGCTATGCTGTG
AGTGGCGAGTTAAGAAAAGCAACGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031991.1\|WP_008941665.1\|746927_747791_-\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
NZ_CP031991.1\|WP_017396355.1\|739813_744895_+\|Hpt-domain-containing-protein	unknown	unknown	gnl\|CDD\|223716
NZ_CP031991.1\|WP_004640629.1\|736174_736558_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP031991.1\|WP_004640626.1\|736579_736942_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP031991.1\|WP_017396358.1\|756152_758333_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP031991.1\|WP_008941657.1\|758475_759687_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP031991.1\|WP_008941660.1\|751537_754075_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|99797
NZ_CP031991.1\|WP_008941668.1\|737574_739656_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP031991.1\|WP_004640625.1\|736990_737527_+\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
NZ_CP031991.1\|WP_008941659.1\|754246_754831_-\|YcxB-family-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP031991.1\|WP_017396360.1\|760868_762209_+\|porin	unknown	unknown	unknown
NZ_CP031991.1\|WP_008941653.1\|762389_763625_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|223857
NZ_CP031991.1\|WP_017396357.1\|750628_751414_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP031991.1\|WP_004640614.1\|746674_746818_-\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|137533
NZ_CP031991.1\|WP_008941656.1\|759736_760444_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP031991.1\|WP_076612069.1\|754998_756089_+\|IS4-like-element-ISAba33-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP031991.1\|WP_008941664.1\|747891_748257_+\|YbaN-family-protein	unknown	unknown	gnl\|CDD\|377291
NZ_CP031991.1\|WP_026070467.1\|745415_746549_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
NZ_CP031991.1\|WP_004640609.1\|748543_749074_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_CP031991.1\|WP_004640619.1\|744911_745367_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP031991.1\|WP_008941665.1\|746927_747791_-\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	1.66104e-39
NZ_CP031991.1\|WP_017396355.1\|739813_744895_+\|Hpt-domain-containing-protein	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	1.31483e-113
NZ_CP031991.1\|WP_004640629.1\|736174_736558_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.09057e-35
NZ_CP031991.1\|WP_004640626.1\|736579_736942_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	6.47572e-38
NZ_CP031991.1\|WP_017396358.1\|756152_758333_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP031991.1\|WP_008941657.1\|758475_759687_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.99194e-94
NZ_CP031991.1\|WP_008941660.1\|751537_754075_-\|PepSY-domain-containing-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.17836e-120
NZ_CP031991.1\|WP_008941668.1\|737574_739656_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	2.25788e-69
NZ_CP031991.1\|WP_004640625.1\|736990_737527_+\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	4.24257e-29
NZ_CP031991.1\|WP_008941659.1\|754246_754831_-\|YcxB-family-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	0.00230079
NZ_CP031991.1\|WP_017396357.1\|750628_751414_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.34354e-41
NZ_CP031991.1\|WP_004640614.1\|746674_746818_-\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|137533	PRK09810, PRK09810, lipoprotein antitoxin entericidin A.	2.2414e-07
NZ_CP031991.1\|WP_008941653.1\|762389_763625_+\|sodium/glutamate-symporter	gnl\|CDD\|223857	COG0786, GltS, Na+/glutamate symporter [Amino acid transport and metabolism].	9.51412e-159
NZ_CP031991.1\|WP_076612069.1\|754998_756089_+\|IS4-like-element-ISAba33-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.21275e-09
NZ_CP031991.1\|WP_008941656.1\|759736_760444_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.6836e-35
NZ_CP031991.1\|WP_026070467.1\|745415_746549_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP031991.1\|WP_004640609.1\|748543_749074_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	2.26559e-25
NZ_CP031991.1\|WP_008941664.1\|747891_748257_+\|YbaN-family-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	5.11216e-36

>NZ_CP031991.1|WP_008941664.1|747891_748257_+|YbaN-family-protein
MKILFWRSLVILFVTLGIIGAILPGMPTTVFLIIAAWAASKGWPQMDAWLLNHPKYGTTLRNWRENGTVPRRAKWFASIMMLISGIIMLFTTAPFGVKVFTNTTMLIVAIWLWFRPEPERG
>NZ_CP031991.1|WP_008941665.1|746927_747791_-|DUF1853-family-protein
MSSVVDSPCFFEPWLKFKNPIVRQLAFAIASPNILSEVPSELIIKNKFCLHDNATWQVLYQNYEKRLYQLDQQPQPLHDFVARLKSTRLGLRFENLLWFWLLDDAYHPYQLLGHSIQKIAGAITLGEIDFLVLNQQTQEIEHWEVALKYYLGEGHLNLARWFGLNREDTLYRKLKHFTDRQFQFSEANGYNIQRKFAVMKGQLYLPAQQLQTLPLPVWINTSRQLGNWGTRIPQQPYYRLQRHEWLCPNQLASSSNAIWWTDGLYHTTEGEPSFYMFRQPALLFNRT
>NZ_CP031991.1|WP_004640614.1|746674_746818_-|entericidin-A/B-family-lipoprotein
MMKKVLVASIMTAFVLTGCNTFKGFGQDVSKAGDKVTQTAEKTQNKM
>NZ_CP031991.1|WP_026070467.1|745415_746549_-|succinyl-diaminopimelate-desuccinylase
MNHSDTLELSLQLLRQPSVTPVDHDCQNIMADRLSKIGFNIEKLRFEDVDNLWARRGTENPVFCFAGHTDVVPTGHLDAWNSDPFQPTIRDGKLYGRGSADMKTALAAMVVASERFVAKHPDHKGSIAFLITSDEEGPSINGTVKVVETLEARNEKMTWCLVGEPSSTNQLGDIVKNGRRGSLNAVLTVNGKQGHVAYPHLAENPIHLASKALNELCETVWDNGNEYFPATSFQISNIQAGTGATNVIPGHLKVTFNFRYSTEVTAEILQQRVLEILDKHKLNYDISWTFSGLPFLTPVGELVNAAKTAIKDVTGVETVLSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVNVDDLEPLAEIYEQILVQLLT
>NZ_CP031991.1|WP_004640619.1|744911_745367_+|hypothetical-protein
MVKKSTNTALGQIDQQELQHLITVSTGFIDAYIIECHQKVPMLLPQNIVLSAMDTPTNVEHIEWHDLKLPVLALHDPMQKQGVALVVEGEDVSQRFALICNEMPESIRLRISEIVDEDGDVEDPKVFKYVKMGEKRYFVPNLQNIETQLGL
>NZ_CP031991.1|WP_017396355.1|739813_744895_+|Hpt-domain-containing-protein
MKEILKTLVETMTLPEDSYLEQDAEILEIFIEELDEIFVELDPLLVQWIEQPNLQNVLTDIRRHFHTLKGSGRMVGAKSSGELGWTVEDTLNRVLAGTIPLTTEIQRYVQAIFNIYRFKLIHDFKAVRAHLIDLRPLVLLGQQLQQQSVEPALSDLLMLADHLVSEDISTGLELVEEALFVDHLTQTEQLALDNADKVLAEDELLAKETLAIFLEEAEEHLATIDQFLQNDHPTNEHYNHLIRALHTLRGSSAMAHIDQIFDASSKVENLFKTLLHDELDSNSNETALLTHYAQFVRDYLYSLRQLETAQRTDEIHATFNTAWDSYDFQLEDSHGENLRPQGLVSQLLELNIQDLLDVESDFDQRARTEFPQYIQQLSQQAEILLQHTHHHATIGMYQYTSLLRSSYQDLIYKPSLLNLEYGFELYDQVHQQFIQLFDTLAAGQRVTLTKEHEQMLNELSTFTQQNIELLEAELIETNLDQAAPLSEAEVVQDSIVDTSDLAARFALDKQQLSTSESNRDFDPDLLDIFLEEADELLVGIDEDLNTWVADLQNVNALKNLMRYLHTLKGGSNMIHAGHIGLIAHELETIYEKLINQQIQATPSLISVIRSVQDDIADRIQTIRDQQVDYPSTHVLDVLTNLMKSTATTAIKIDKFVVSEDEDIEKAVDLDGTTEIEISTHSDVAEPSIDVTSFAAQLALDKQQLQSEQSNRDFDPDLLDIFLEEADELMVGIDADLNTWTTDRHNVNALKNLMRYLHTLKGGSNMIQARHIGLIAHELETIYEKLINQQIQASPQLVAIIRLVQDDIADRIQTIRDQQTDYPSTHVIQLLQHADQDIDVERYATETEIEQTSAELVNADLEVVAASIDNVESESISAETQLDFVETESLLQIVEADSDKDDVTSSLMQDVVEDDTEEDDVRSLVEQTFLEEAEELLGQAQHLLEQWFEQRGNRSLLLQLQRNAHSLKGGARMAEMDAIAIIAYHLENAFEQFGLHHFSSNVYDNLLNTALAWLNDAIFKRQYANFDGLKQSLENMEFVDVAAQLPQKLSARDIFTPEYTMEFVQGDGTEPPSMLGEWESTERIEQNNEMIRVSAEVIEKMIDLSGENAINRSRIEMDLGQLGGTLTEMELAIKRLADQLRRMEGELESQIIARHGGEDARYADFDPLEMDQYSSLNQLSKSLAESASDLVDFKTTLSEKIRDTEGLLLQQSRIQAEIQESLMRTRLVPFSRLLPRLQRIVRQTASTLNRPTELVVNNTEGELDRSILERLVAPFEHMLRNAIDHGIEDREQRLQAKKPETGHIVLNIGRQGTDVVVTFSDDGKGIDVNRIKEKAIQTGLMTKDQKLDQDEILQFIFHPGFSTAAQVTQISGRGVGLDVVQSDIKALGGHVSVGSILGKGTTFTIRVPTTVAVSDALMVKAGDQQFAFPLAQIDRIVRISPMALEQYFESQDDYFKIDQEDYRLRYLSEFVAGQPIPRLTGIVHSLPVLLIKGAQGQMTALLVDQLIGSRGQIVVKPVGQQFSSIGVIAGATILGDGQVCLILDGQNLARQAQSTARSKQADETYTKQRYDERRLIMIVDDSVTVRKVTSRLLERQGYDVVTAKDGVDAMEQLETVKPDLMLLDIEMPRMDGFEVTNLVRHHEIHRDLPIIMITSRTGEKHRERALSLGVSQYMGKPFQEETLLENIESLLAVR
>NZ_CP031991.1|WP_008941668.1|737574_739656_+|methyl-accepting-chemotaxis-protein
MGFKLKKKNGSDGAGSKKGEAFLGKIRTQLDQFSRLFGETEKSKPIIYRALIALVLAVILLIYLFVSLPRSNQLTRSLGELRLLSQMISRQATEATASGTSETMNNLVASEKRFAENLEVVEDVYGKSSDEYKKVNELWTNVSKNIDLIASQQAIINQLYDTNISISETIPEIQAEYNLMVDQMVRENMPSSQVIITKNQVFIAERILRSINSVLVGTDNSNASANDFGADIDTFGIYLNAQLNGSSELGVDRISSPDLRESVDSIKSDYDAVLKLAAETVLKNANQIVHVRQASSEIFTQSDALLSSLNALSDKAEGGWGNVLAGIALILALGVLVFSALQLLALRSNTDKERVIRLQDEYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRITDTSQEVARYTQDTQSITNQLAEASEHQAQEIAGASAAMNEMALSIDQVSANASESAEVAKRSVQIATNGAQVVNRSIEGMDHIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILALNAAIQASMAGEAGRGFAVVADEVQRLAERSASATKQIESLVKTIQTDTNEAVISMEQTTSEVVRGANLAKDAGIALDEIQTVSGDLAKLIASISDAAKLQSASASHIATTMNVVQEITSQTTTATFDTARSVSELANMAESLRESVTDFKLPE
>NZ_CP031991.1|WP_004640625.1|736990_737527_+|purine-binding-chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKQYTATQNEVSRWSGIAFEMLGQYFVAPLGEISEVIYPPKYTPVPNTQAWVRGLANIRGRLLSVTDLSHFISDQRSQFSPTQKVICISHQDHYVGLVVDQVLGIQHFNKKSFFSQSNELDSKLKDYCQGYFHQHNQQWHVFLLSRLLKNPQYMNASIKFIN
>NZ_CP031991.1|WP_004640626.1|736579_736942_+|response-regulator
MARILIVDDSPTETFRFREILTKHGYEVLEATNGADGVTMAQAELPDLVLMDVVMPGMNGFQATRQISKAKDTQHIPVVIVSTKDQATDRVWGKRQGASDYLTKPVDEQQLIDVIKQLLS
>NZ_CP031991.1|WP_004640629.1|736174_736558_+|response-regulator
MEDKFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALSKIAEANPDIVFVDIMMPRLDGYQTCALIKNSLNYQNIPVIMLSSKDGLFDQAKGRVVGSDEYLTKPFSKDELLSAIRNHVSA
>NZ_CP031991.1|WP_004640609.1|748543_749074_+|L,D-transpeptidase
MPYALEQADILIDLAQQTLYLPKHNKFYVISSGKNGIGEQENTGKTPRGWHRIAQKIGDDAPKNSVFIARQATGEIYDQDLAQQFPERDWILSRILWLDGLQAGFNQGDGCDTFKRYIYIHGTPETEPMGIPMSHGCIRMKNDEVIELFELISEQALVYISEHALDESMIKSERSV
>NZ_CP031991.1|WP_017396357.1|750628_751414_-|YdcF-family-protein
MQISSWLRIFFAVIGFILLIDGAVLITLKKIHIGTVLPLLLGLFFCLYSFFYYHLERFFFYHFRLHSIWRFGWLCFWVWLISLGYFFNYLNKNNSQVEVPTSVAAIIVLGSGIENGQPSATLAKRLDRAAPIALTQPNAKLLLTGGVDFGETESEAIVMSRYLQQQHHIPATQIILEDKSTSTELNLKNSHPLLQAHKISLQQPIAIVTSDFHTLRAAAIAKKQGYSNITTIGSTTPLQTRYNAWLREYFAYVSGWLLNEY
>NZ_CP031991.1|WP_008941660.1|751537_754075_-|PepSY-domain-containing-protein
MFKKVFFQIHWFLGITAGLILSLMGITGAIYSYDQQILKWINQESYVVEVVNTPKLTPAQLYQHFNQQQPEIEINSITIAANPAASSTVNIKKEGARRGYNMMVNPYTAEILPEVKGREFFQFIQRLHRNLTAGEYGAQITGASTLMLIFFVLSGLYLRFPKKHSLKQWLFIKPKLKGRNFIWDLHAVVGTWVVAFYLLFACTGLYWSYDWWRAGMFKVMGVEQPQRHQQNHDQNKKEQPDLSNQQVNTILTQAWTGVNANIGREYSSLTLNIPKLADQKIEVTFIDPTPQHERARNQAIYNYQSHQFEKLDLYEDKKLNEKIMSSMLPVHRGSFFGSTYQFIAMLASLTMPLFFVTGWMLYLKRRKQKKLTQSARQTLINQQIDPNATPWLISYASQTGVAEQLAWRTATSLQEAQQPTTVKPIQQLTEQDLQQAQQVLFVVSTYGTGEAPDLATSFSKKLMQQSLDLAHLKYAVLALGSKEYPDSYCRFGYVVDAWLKQCKAQALFDLVEVDNANNEDIQRWNQALSVVTQHELHAMNIEKVFDQWTLTERKLLNPNSLGNAAYNIELRAPYDITWHAGDIAEIQPANSLIEIQNFLIKYQIPAQAEIKSLNLTIEQALWNKNLRIEIDQIDDLETLVAQLPTLPTREYSIASIPSQQLLRLVVRQKYDANGELGLGSGWLTEFAQLKQTIALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLQQRNRQNYTANWLIFGERQHQCDFFYEETIQAWLNMGSLQRLDLAFSRDQEQRRYVQDVLREHADELKNWIEQGAVIYVCGSIEGMATGVDQALNDILGEEAVDELRQTQRYRRDVY
>NZ_CP031991.1|WP_008941659.1|754246_754831_-|YcxB-family-protein
MTAKTPYAYTLQPVPYEVSEVEQRQAQLMIWRSSNKFSRKAWIIMISLVVLSLVAAGLIKYYSTYSTVICWVVIIGVAFYYLTKKFGLEWYVKRKMKEFPVQEIKGIRLGVQPHGLVMRQKVGLQDGTATISWKDIYEWYASPDFILVNFKVKTPKGDEQQGAYILPKRMDSKNFSFKTIRRHLTETVGAPKSI
>NZ_CP031991.1|WP_076612069.1|754998_756089_+|IS4-like-element-ISAba33-family-transposase
MTHFNELYLILNKYLKWNKSHAKCFTLIMLALIVKQTCNLSSASKALPIKCLPQSFYRRIQRFFAGQYFDYRQISQLIFNIFSFDKVQLTLDRTNWKWGKRDINILMLAIVYRGIAIPIVWTLLNKRGNSDTKERIALIQRFISIFGKDRIVNVFADREFIGEKWFTWLIENDINFCIRVKKNFIVTNHLAKNHKISDLFRHLQVGQTECRKRRIWVGRVKLYISALRLEDGELLLVVSPMFNASAIRDYALRWEIETLFSCLKGRGFNLENTRLTDPRRVKKLIAVLAIGFCWCYLTGEWQHDRKKAIKIKKHGRLSVSLFRYGLDYVQMAILRLIGFGKKEEFKKVLAILRKKKPDRTRVL
>NZ_CP031991.1|WP_017396358.1|756152_758333_-|TIGR01666-family-membrane-protein
MNSGLKRLKQATYNTTFMYNVRMLIAFTGTAFVPYLLDHQLATIPLTLGVVAAAISDIDDRFSVRLMNLIYTYIGFFITAASVQLLFPYPIAFAVGLIASCIGWILLGSLGRRYATIAYGCLVISVYTMLGVHLFEEWYQQPALLVVGAAWYGLLSTISFLLFPVRQLQDQLAASYNALGGFLYAKSNLFDVDMTPPSYQQSMIDLSMENSKLIGLFNNLRVALLTRLKGDRGQKDTRRSLQYYFVAQDIHERADSAHIDYQKLTKVFQHSDILFRFQRILSIQGKACQDLAQSILSRTRYTHNKRFKHSFENLRLSLEKLRKDGLYDQVRINALFALYQNLKSIDAQLQNLETERNLVLDNAQQPEHQLKDDDLKGMKDIVVRIKQNLTPESVLFRHAIRLSIVLFIGYVFIQMTNIAYGYWILLTALFVCQPNFNATKRRLYLRIIGTLVGIIVGLAIIYFIPSLEGQLVMLVLSGILFFELRSKQYAQATAFITILALINFNLDGSAFAAGFPRFIDTIIGCALAWFGVSFIWPDWKFRRLPRSIQRALQAQCQYLAEVVTQYHQGRNNALNYRVVRRAAHNTDAEVASLISTLATEPNIDSTQKAQAFEFLCLSHTFLSYIAALGAHREQIQDQEVLDLLDQALDDIQGALLRDEVPDLSAQNMLQTIRQRLTQKESNENDQKSLIILQQLSLMLSILTRLSMLKQSLGHEPSEDGTEFASL
>NZ_CP031991.1|WP_008941657.1|758475_759687_+|multidrug-effflux-MFS-transporter
MQVEQTNQRQYSTTWIMLLALLTALGPLSIDMYLPALPQMADEFGVSTQMVANTLPAYFLGLAIGQLFYGPVSDRIGRKTPLYFGLTLYVIASLACVLVTNEWALIIARIFQALGGCVGVVIARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPIFGAWILIFFPWQSIFVCLAMIGVICGLCVHFFFKESLPVERRLKLSTYQVTTLYAAIFKDQSFRLPMLAGCLTGAALFCYISSASAVFMGQYGLSQQHFSYAFAFNAAGIMLMSSLNKHLNTRMGVFPRLVFGGSIQCFGAVCVVSAGLMVNAPLWFLMSGLFLVVSGIGLTGPNAMALAMSEQGARAGTASAIMGSMQFACGLLGGVILNFLVWKASLNMGLMMLMFTSLGLLMIFKVGRQQRASV
>NZ_CP031991.1|WP_008941656.1|759736_760444_-|nitroreductase
MNMEQVRYVDEAIRSRHSVRAFLDRPVEQQIIKDILDVACRAPSGTNTQPWKVYVITGKKRTEMIDRVCTAQVESFQNPALASQYKETFAYYPETWISPFIDRRRENGWGLYGLLGIQKGEKEKMAAQQLRNFQLFDAPVGLYFTVNKIMGIGAKMDISMMIQNVMVAAKARGLDTCPQAAWNHFHPIVLDVLGAPNDEELVCAIALGYADPEHIVNTFITPREPVENFTVFLDE
>NZ_CP031991.1|WP_017396360.1|760868_762209_+|porin
MSLTLIRKPFVMQSLAIIVATLMMNTAHATSEQEQIQQLRAEVSELRALLEQYVSQPKQENVDSQVVAQPASVTTHNQNIKVVNTEPAKKSPLAIQTASGAQVKLYGFLRGDASYQAKGGDGIFNRINKVDLEGAEKNSDRFYSTATVTRLGLDFKSPVEGTEVGGKLEVDFRGGSNNDTIRIRHAYLTMNDWLFGQTTSTFLATDLQPEMLDFNSPLGIGTYRTPMVRYSNKLNPDISYAIALEKGNDDNRLPALSSKLKYDFAEGKGTTSVRALLTEARSKVAFNKDNMQISRNDSDLGWGVAVGAKYKLTDALQAMVDYSHVKGDSKFLLYTNNAFNVNPNNMGLNLNEFDALTVGTSYQITPKLRSTLAYGAMFADDSNDFAKQAVTDETQNKTLQQGWWNVMYSPVTPITFGLEYIYGERKTFDGQKGKDSRVGAMARYNF
>NZ_CP031991.1|WP_008941653.1|762389_763625_+|sodium/glutamate-symporter
MEFTFNGFYTLISAVIVLLLGRFLVNKIDFLRRYNIPEPVAGGLVAAVLSLLIHSFFGYSVVFSSELQTSFMLIFFASIGLSANFMKLKEGGIGLVIFLVCVASFIVVQNAVGMSLATLLGIDPLIGLIAGSITLTGGHGTAGAWGEILESQHGIQGALALGMASATFGLIIGGIIGGPLAKLLINRHGLARAKTPAQIEDRDTHPDPHPEDLAPFENPHQVRLITADNAITTLGMFAACLAFAEFMTGYSKGTWFELPTFVWALGGGVILRNILESVLKVDIFDRAIDVFGNASLSLYLAMALLSLKLWQLADLAGPLVVILGAQTLTMALYAAFITFRVMGKNYDAAVLAAGHCGFGMGATPTAVANMQAITNMYGPSHKAFLIVPLCGAFFVDLINATVIQIILKFFA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031991_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031991_4

1189485-1189565

Orphan

Consensus_repeat	Method
CATATTCCATAAAATAAGCCTCTTAAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031991_4

>merge|NZ_CP031991|4|1189485-1189565|CRISPRCasFinder
CATATTCCATAAAATAAGCCTCTTAAGGGGTAAACTTATTTCAGGACGGGACACATATTCCATAAAATAAGCCTCTTAAGG

>NZ_CP031991|4|2|1189485-1189565|CRISPRCasFinder
CATATTCCATAAAATAAGCCTCTTAAGG	GGTAAACTTATTTCAGGACGGGACA
CATATTCCATAAAATAAGCCTCTTAAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031991.1\|WP_026070457.1\|1184697_1186299_+\|isocitrate-lyase	unknown	unknown	gnl\|CDD\|180592
NZ_CP031991.1\|WP_017395023.1\|1198724_1199915_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP031991.1\|WP_004639957.1\|1181432_1181696_+\|ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP031991.1\|WP_017396178.1\|1201056_1201656_+\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|224653
NZ_CP031991.1\|WP_004639956.1\|1181735_1183064_-\|HlyC/CorC-family-transporter	unknown	unknown	gnl\|CDD\|224173
NZ_CP031991.1\|WP_017396270.1\|1179057_1180671_+\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|180120
NZ_CP031991.1\|WP_005089714.1\|1195056_1196592_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|273829
NZ_CP031991.1\|WP_005089712.1\|1194120_1194867_+\|LPS-export-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|275199
NZ_CP031991.1\|WP_005084650.1\|1193572_1194121_+\|lipopolysaccharide-transport-periplasmic-protein-LptA	unknown	unknown	gnl\|CDD\|274384
NZ_CP031991.1\|WP_017396269.1\|1176325_1177777_+\|capsule-assembly-Wzi-family-protein	unknown	unknown	gnl\|CDD\|379441
NZ_CP031991.1\|WP_026070458.1\|1187574_1188042_-\|copper-resistance-protein-NlpE-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377235
NZ_CP031991.1\|WP_004639946.1\|1192456_1192996_+\|HAD-IIIA-family-hydrolase	unknown	unknown	gnl\|CDD\|224692
NZ_CP031991.1\|WP_005084639.1\|1183169_1184159_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP031991.1\|WP_076612069.1\|1186455_1187546_+\|IS4-like-element-ISAba33-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP031991.1\|WP_005084648.1\|1193040_1193589_+\|LPS-export-ABC-transporter-periplasmic-protein-LptC	unknown	unknown	gnl\|CDD\|275202
NZ_CP031991.1\|WP_004639959.1\|1180868_1181384_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_118902211.1\|1199922_1200855_-\|IS5-family-transposase	unknown	unknown	gnl\|CDD\|290455
NZ_CP031991.1\|WP_017395019.1\|1189778_1191200_-\|cysteine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234705
NZ_CP031991.1\|WP_017395020.1\|1191475_1192453_+\|KpsF/GutQ-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|182814
NZ_CP031991.1\|WP_005089695.1\|1178103_1179012_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375

Protein	Function_ID	Function_description	E-value
NZ_CP031991.1\|WP_026070457.1\|1184697_1186299_+\|isocitrate-lyase	gnl\|CDD\|180592	PRK06498, PRK06498, isocitrate lyase; Provisional.	0
NZ_CP031991.1\|WP_017395023.1\|1198724_1199915_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	2.0454e-89
NZ_CP031991.1\|WP_004639957.1\|1181432_1181696_+\|ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	2.57979e-06
NZ_CP031991.1\|WP_017396178.1\|1201056_1201656_+\|YigZ-family-protein	gnl\|CDD\|224653	COG1739, COG1739, Uncharacterized conserved protein [Function unknown].	8.4208e-53
NZ_CP031991.1\|WP_004639956.1\|1181735_1183064_-\|HlyC/CorC-family-transporter	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	3.40608e-124
NZ_CP031991.1\|WP_005089714.1\|1195056_1196592_+\|TolC-family-protein	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	1.4942e-54
NZ_CP031991.1\|WP_005089712.1\|1194120_1194867_+\|LPS-export-ABC-transporter-ATP-binding-protein	gnl\|CDD\|275199	TIGR04406, LPS_export_lptB, LPS export ABC transporter ATP-binding protein. Members of this fmaily are LptB, the ATP-binding cassette protein of an ABC transporter involved in lipopolysaccharide export. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	2.42091e-150
NZ_CP031991.1\|WP_005084650.1\|1193572_1194121_+\|lipopolysaccharide-transport-periplasmic-protein-LptA	gnl\|CDD\|274384	TIGR03002, outer_YhbN_LptA, lipopolysaccharide transport periplasmic protein LptA. Members of this protein family include LptA (previously called YhbN). It was shown to be an essential protein in E. coli, implicated in cell envelope integrity, and to play a role in the delivery of LPS to the outer leaflet of the outer membrane. It works with LptB (formerly yhbG), a homolog of ABC transporter ATP-binding proteins, encoded by an adjacent gene. Numerous homologs in other Proteobacteria are found in a conserved location near lipopolysaccharide inner core biosynthesis genes. This family is related to organic solvent tolerance protein (OstA), though distantly. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	1.03169e-40
NZ_CP031991.1\|WP_017396269.1\|1176325_1177777_+\|capsule-assembly-Wzi-family-protein	gnl\|CDD\|379441	pfam14052, Caps_assemb_Wzi, Capsule assembly protein Wzi. Many bacteria are covered in a layer of surface-associated polysaccharide called the capsule. These capsules can be divided into four groups depending upon the organisation of genes responsible for capsule assembly, the assembly pathway and regulation. This family plays a role in group 1 capsule biosynthesis. It is likely to be involved in the later stages of capsule assembly. It is likely to consist of a beta-barrel structure.	1.22162e-121
NZ_CP031991.1\|WP_017396270.1\|1179057_1180671_+\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|180120	PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.	0
NZ_CP031991.1\|WP_004639946.1\|1192456_1192996_+\|HAD-IIIA-family-hydrolase	gnl\|CDD\|224692	COG1778, COG1778, Low specificity phosphatase (HAD superfamily) [General function prediction only].	9.44843e-67
NZ_CP031991.1\|WP_005084639.1\|1183169_1184159_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.78616e-57
NZ_CP031991.1\|WP_076612069.1\|1186455_1187546_+\|IS4-like-element-ISAba33-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.21275e-09
NZ_CP031991.1\|WP_005084648.1\|1193040_1193589_+\|LPS-export-ABC-transporter-periplasmic-protein-LptC	gnl\|CDD\|275202	TIGR04409, LptC_YrbK, LPS export ABC transporter periplasmic protein LptC. Members of this family are LptC, a periplasmic protein tethered to the inner membrane in the lipopolysaccharide (LPS)exporter transenvelope complex (Lpt), which is responsible for conducting LPS to the outer leaflet of the outer membrane in most Gram-negative bacteria. LptC is homologous to LptA, another member of the transenvelope complex. Genes lptC and lptA are often adjacent. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	3.13277e-35
NZ_CP031991.1\|WP_026070458.1\|1187574_1188042_-\|copper-resistance-protein-NlpE-N-terminal-domain-containing-protein	gnl\|CDD\|377235	pfam04170, NlpE, NlpE N-terminal domain. This family represents a bacterial outer membrane lipoprotein that is necessary for signalling by the Cpx pathway. This pathway responds to cell envelope disturbances and increases the expression of periplasmic protein folding and degradation factors. While the molecular function of the NlpE protein is unknown, it may be involved in detecting bacterial adhesion to abiotic surfaces. In Escherichia coli and Salmonella typhi, NlpE is also known to confer copper tolerance in copper-sensitive strains of Escherichia coli, and may be involved in copper efflux and delivery of copper to copper-dependent enzymes.	2.06446e-34
NZ_CP031991.1\|WP_118902211.1\|1199922_1200855_-\|IS5-family-transposase	gnl\|CDD\|290455	pfam13737, DDE_Tnp_1_5, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	8.41563e-49
NZ_CP031991.1\|WP_017395019.1\|1189778_1191200_-\|cysteine--tRNA-ligase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	0
NZ_CP031991.1\|WP_017395020.1\|1191475_1192453_+\|KpsF/GutQ-family-sugar-phosphate-isomerase	gnl\|CDD\|182814	PRK10892, PRK10892, arabinose-5-phosphate isomerase KdsD.	2.86056e-136
NZ_CP031991.1\|WP_005089695.1\|1178103_1179012_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0

>NZ_CP031991.1|WP_026070458.1|1187574_1188042_-|copper-resistance-protein-NlpE-N-terminal-domain-containing-protein
MKKSIIALSLASVFLVACSKNDNTKNEEQMPTTAASEAIAADNAHTAENSLDWNGTYKGVLPCADCEGIETELELNSDKTYELKETYLGKGDGKPFESKGSFTFNSANTSIIELDQSGDERKYFVAEGYLKALDLEGNEITGELADKYQLKKEAE
>NZ_CP031991.1|WP_076612069.1|1186455_1187546_+|IS4-like-element-ISAba33-family-transposase
MTHFNELYLILNKYLKWNKSHAKCFTLIMLALIVKQTCNLSSASKALPIKCLPQSFYRRIQRFFAGQYFDYRQISQLIFNIFSFDKVQLTLDRTNWKWGKRDINILMLAIVYRGIAIPIVWTLLNKRGNSDTKERIALIQRFISIFGKDRIVNVFADREFIGEKWFTWLIENDINFCIRVKKNFIVTNHLAKNHKISDLFRHLQVGQTECRKRRIWVGRVKLYISALRLEDGELLLVVSPMFNASAIRDYALRWEIETLFSCLKGRGFNLENTRLTDPRRVKKLIAVLAIGFCWCYLTGEWQHDRKKAIKIKKHGRLSVSLFRYGLDYVQMAILRLIGFGKKEEFKKVLAILRKKKPDRTRVL
>NZ_CP031991.1|WP_026070457.1|1184697_1186299_+|isocitrate-lyase
MMTYQSALEHVRAVKEKLGGTWGAIRPEDAARMMVQNRFHTGLDIAKYTAAIMRKDMAEYDADNSKYTQSLGCWHGFIAQQKMIANKKYFGTTNKRYIYLSGWMVAALRSEFGPLPDQSMHEKTSVPKLIAEIYTFLRQADAKELNDLFRALQKAEAAGDSAKAAEIISQIDNFESHVVPIIADIDAGFGNEEATYLLTKQMIEAGACAIQIENQVSDAKQCGHQAGKVTVPHEDFLAKINAVRYAFLELGVDEGVIVARTDSEGADLTQKIPVSKEKGDLASQYISYLDTKEIDISEAADDEILIKRDGKLHRPTRLASGLYQFREGTQHDRVVLDCVTSLQNGADMIWIETPTPDVAGIAGFVNDIKKQVPNAKLVYNNSPSFNWTLNFRQQAYDRWVAEGKDVSAYDRAKLMSAEYDNSELAADADEKIRTFQADAAREAGVFHHLITLPTYHTAALSTHELAKGYFGDEGMLAYVAGVQRKEIRGGIACVKHQAMAGSDIGDDHKEIFAGENALKAGDASKNTMNQFGG
>NZ_CP031991.1|WP_005084639.1|1183169_1184159_-|LysR-family-transcriptional-regulator
MNLERVDLNLLIYLDVLLREKNVTRAAEQLGVTQPAMSNILRRLRNLFNDPLLIRSSEGMTPTERALELQPRIRDALSDLSMILEPRTEFRPYTSNRVFRIMTSDYAEATLVPRLVKALRSEAPNVVLDFLTPSDVSYRDMEQGKVDLAINRFNEIPQSFHQVLVWRDSFSCILNDKHPAVQHLNLKSYLDAQHIWVSKTGMGVGFGVNPDKQAGLGWIDQALERIGQRRKISVFTRHYQMPALLAQNVDLIATLPTRMAQLQTQNPRLVIKDPPFYIPEFELKMAWCPLLHHHPAHRWLRQLILFVARQMIEEENREFLLNNSQFSQY
>NZ_CP031991.1|WP_004639956.1|1181735_1183064_-|HlyC/CorC-family-transporter
MSLVQNIIIIAMLIIAAGFLSLTEIALAGARKVKLKILAESGEHRAQKVLDLQEQSADFFAASQIGLNAVAILGGILGEAAFRPFFVDLIGRFYTGAWLETIGFALSFTFVTSLFILFADLMPKRLAMIAPEKIAISVIEPIQIFIKVCKPLAWGINAIANLLFRLFKVNTTRDDNITFDDISAVMDAGAQAGVLQKQEHHFIENVFELEERTVPSSMTTRENVVYFTLKENESSIRQKLAEYPYSKFLVCNEHIDQVIGYVDTKDILVRILNNQSLLQLNESTIRNVLIIPDTLTLSELLDRFRSTKEKFAVVINEYALVVGVITLSDIMITVMGDWVTPMEEDQQIIKRDNHSWLIDGSTPIEDVKHVLEIEEFPENENYETIAGFIMYRLRKIPRPADAVEYAGFKFEVVDIDHYKIDQLLVTQILPSQESDSPAIKEE
>NZ_CP031991.1|WP_004639957.1|1181432_1181696_+|ribosomal-protein-L7/L12
MNLPHKIPPEALQMLRDGQLIHAIKITREQTGLGLKESKDLIDQYLNDHPQEQTRIQEQLTQRSRSGLKVFVVIFLILVILIWFVMQ
>NZ_CP031991.1|WP_004639959.1|1180868_1181384_+|hypothetical-protein
MTEQSPESLSDIEILDILQSMKKDELDVEAKEIIRNGGKAGRQEAHKLALVALNTSFEEKFVEAVTLALGLNAGQAKKIRYKKDRIRILKVRGIDYLAIDGAETAQVLAQIAQAITREDAIVTEGLHNIFPFWKEGWPMVQFDNAYKILAEDILIHYQATLDELISLYGGN
>NZ_CP031991.1|WP_017396270.1|1179057_1180671_+|sulfate-adenylyltransferase-subunit-CysN
MSHQSDLISQDILAYLKQHENKDLLRFLTCGNVDDGKSTLIGRLLYDSKLIYEDQLQAVTRDSKKVGTTGEAPDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTADLAIILIDARYGVQTQTRRHTFIASLLGIKNIVVAINKMDLVEFSEARFNEIQVEYDAFVNQLGNRRPENIVFVPISALNGDNVVNSSVSTPWYKGQTLMDILESVEIKRESNKHEFRFPVQYVNRPNLDFRGFAGTIALGEINVGDEIVALPSGKKSTVKEIVTFDGNLEKAGAGQAVTLTLNDEIDISRGNVLVRTGEQPLISRSVRASVVWMTEHPLVKGKLYNVKIGTQTVPAKVTAINFRVNVNTLEHTQVEELELNAIADVVIEFDAPVVFDQYQDSRYTGSFIFIDRLSNVTVGAGMVEAAVEWAAHSNPVTAEDRAARLGQKPAVIGVSAQLIENAQALESLLIQQGVVAIAKANLTADQINLLRETGVVVITTIVDGTDTDIAAETAEEAADQIVELVRL
>NZ_CP031991.1|WP_005089695.1|1178103_1179012_+|sulfate-adenylyltransferase-subunit-CysD
MTENRLTHLKQLEAESIHIIREVAAEFENPVMLYSIGKDSAVMLHLALKAFYPAKLPFPLLHVDTGWKFKDMIAFRDNMAKTHGFDLIVHQNVEGREAGINPFDHGSSKYTDIMKTQGLKQALDKYQFDAAFGGARRDEEKSRAKERVYSFRDTKHRWDPKNQRPELWNLYNGKVNKGESIRVFPLSNWTELDIWQYIYLENIQIVPLYFSAVRPVVERSGTLIMVDDERMRLKEGEVPQMKSVRFRTLGCYPLTGAVESEADTLPEIIQEMLLATSSERQGRMIDHDEAGSMEKKKQEGYF
>NZ_CP031991.1|WP_017396269.1|1176325_1177777_+|capsule-assembly-Wzi-family-protein
MFLKKSLYVALFASLSSAVFAQGIVLNDENLRTDLNWLNQQGVIQISTSTWPMSGDEIKRALSQAQVTNKAQQNVIDSVMHAIAADNATAKVGLHAGTDLKTVPQAFGDSQKSQYQAALEFNAGSENWDAKIRVNGEKDPLIDNGNDVNVEGSYIAGKLWNQWVIAGQIPTYWGPGHDGSLIRGDASRPVYGVTVQRAVQNAFETKWLSWIGPWQYQAFAGQLDDYEAIPDTKLIGLRFTARPFQALEIGASRAIQWGGDGRPESFSSLWDAMLGTRDNGGRDKPDPANQIAGFDARLFLQPLWDVPISVYTQFVGEDEAGGLPAKYLYLGGADFSSSYKNMPYQLYAEWADTRTNGEAKGISYSHTTYKDGYYQHGFPLGHAMGGDGQMYSVGGDIRFDTMNRLSGRVMYANVSQTQRVELNNAAFPKSDKIKGIDITWTHYVKPTIPLKVNGWVSDSDVNGSDGGVSVGVEIPLEKNMFRF
>NZ_CP031991.1|WP_017395019.1|1189778_1191200_-|cysteine--tRNA-ligase
MQPFVLYNSEQRKKVEFVPRNEGQIDIYVCGMTVYDYCHIGHARVMVAFDYIIRFLRSQGWKVRYIRNITDIDDKIIARANENGESIQQLTARFIDAMNEDAANLGCVAPDEAPKATEYIDQMQNMISTLVNKGAAYPASNGDVYFEVSKFEKYGRLSGRKLDDMQAGASERVDVEVEKKHPFDFVLWKHAKENEPAWASPWGKGRPGWHIECSAMSTCCLGNHFDIHGGGSDLMFPHHENEIAQSEATTGEQYVNYWMHVGFINVDGEKMSKSLGNFFTIRDVMEKFHPEVIRYFIVSSHYRSPVNFSDVALKEAKTALSRFYHSFKAYQQVYGQKTVDVLEQSFVERFNNAMCDDFNTAEAMAVLFELNKELNRAVKEEQAEQATVLYSTLRQLTNILGLVQHNVDEFLKSDIGQDALALSDTDIEDLIQQRVDAKKAKDFAKADGIRQSLLDQGVVLEDTRQGTIWRRAD
>NZ_CP031991.1|WP_017395020.1|1191475_1192453_+|KpsF/GutQ-family-sugar-phosphate-isomerase
MSQAINFQKSALETLRIEQQAIEVLATQVDERFDRACEILLQCSGRVVVTGMGKSGHIGRKMAATFASTGTPSFFMHPGEAGHGDLGMLVRGDVLIAISNSGKSDEIMMLMPLIKHLGVPLITISRDNKGPMPQNADVALTLGLADEACPLGLAPTSSTTATLVLGDALAVALLEARGFTADDFARSHPAGALGKRLLLHVKHLMHTGSELPKVKPDTPMNKVLYEISDKRLGLTTIVDEQDTLLGIFTDGDLRRMIDRQQGFDVTAVVADVMTADPLTISQEARAVEALEKMHEKKINQFVVVDDAKKVIGVISMHDLIEAGVN
>NZ_CP031991.1|WP_004639946.1|1192456_1192996_+|HAD-IIIA-family-hydrolase
MASYALQEQARHLQALVLDVDGILSDGFVTLTNSGDEIKSFDIRDGLGMKLVQKAGMKVIIITGRKSNIVEKRMSDLGVDLVFQGREDKGVALREACAQFNILPEDCLYMGDDWPDLSAFSISGMCVTVPNGHEEVRRRAHLVTQAMGGRGAVREVCDMLLTAKGVYQELLEKYLAVPH
>NZ_CP031991.1|WP_005084648.1|1193040_1193589_+|LPS-export-ABC-transporter-periplasmic-protein-LptC
MDTKVLYVIAIAVASVSGGFYYFSGKAKKLDVDTAKNMTYSAHGVHLTQTDEQGNLYVRAEIKQLQQDMQQKTSQIDQLSAVMYKQGKADATFSARQANGYDDNHKIILTGDVVVTNLSDQGNMEFRTDEITGYPKTRELETQHQVIIQSPSSEFISQGLKANLNDGQYEFFKVRGKYAPNS
>NZ_CP031991.1|WP_005084650.1|1193572_1194121_+|lipopolysaccharide-transport-periplasmic-protein-LptA
MRQTLNFNNRFTSLKQFTCMAVIALSSATSFALPSDRNQQLTLVADRATYNDKTGVTTYTGNVVIEQGTMKLQADSIVATLNSKREIQTITAKGQLAKFQQQIDANRGLARGEAQQIVYNADTGILTLTGRAYLYQDGSSIRGESLKYSMNKGDVEAQGSSSNRVQIIIPPSSSKSFPGARD
>NZ_CP031991.1|WP_005089712.1|1194120_1194867_+|LPS-export-ABC-transporter-ATP-binding-protein
MEQSLQQPQTLCIKHLAKNYSKRWVVKDVSFTMQSGQIVGLLGPNGAGKTTSFYMVVGLVRMDKGEIHLDDLDLSDLAMHERARKGIGYLPQEASIFRKLTIAENIMAILETRKDLNKQQRQQRLNELLGDFKISHIKDSLGMSVSGGERRRAEIARALAADPKFMLLDEPFAGVDPISVGDIKEIIQTLKNRGIGVLITDHNVRETLAICEKAYIVSEGSVIAEGTPQEILDNEQVRKVYLGDDFVV
>NZ_CP031991.1|WP_005089714.1|1195056_1196592_+|TolC-family-protein
MSINKDIDEGTRKACMDFKWLFCVATLSSVPVTQASTPSEQYHSLKNNVSQLFSPKSSDEFKTANMQKLSNFSVNSTVTELPVVGSGRPMDTSAPAVVWQNQNKTLKDAIQLAVQRNPEISQTLATLAAQNANIDVAKAGYYPQISGGVNTGDLTRKGERGRQILALNATQMLYDFGKVKSGVSTEEAKLLLEQANVLVKVDDISLDVAQTIINIQRQQRLIRIANQQIAGIKRIQEMANLRANAGISSQADPVQAQSYVQSAQSALIAQQSILSQLQQRLYTLLGFDARSVQWAIPQDFVQQSDLYVEPEFNTIPQMIAAYAGIEVAKNQKRQTQVSNYPTLSVKGEVSQALHGRNPNNDKRGGFDSAIMLEASSQFYQGGATTSRLRAASFAEEAAKAQVNAVYLRVLDQIRTSREQIESKQRQLQVLAGQQATTVRTKELYQEQYKLGTRTLVDLLNAEQAIHSANSEVEIARYDIYSSIAQYIAATGRSRQAYDLNNIKIQGFEVQP
>NZ_CP031991.1|WP_017395023.1|1198724_1199915_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MSDQEQTSSRPMNVTYKEPKLPSSSIIVWLIGIGLVVLLVWAWVFSLEEVSTGTGKVIPSSKEQIIQSLEGGILTKLDVKEGDIVERGQILAQLDPTRFASNVGESQSLLMSAMATAARLRAEVNGTALTFPEEVLKEPKLVKEETALYYSRRANLEESIAGNQQALRLVQQELAMTEPLVAKGAASEVEVLRLRREANDLQNRINDIRNQYYVKAREELSKANTDIQTQQQVVKGRADSLQRAVFRAPVRGIVKEIDVTTLGGVVPQNSKLMTIVPLEDKLLIEARISPRDIAFIRPNQEALVKITAYDYAIYGGLEGKVTVISPDTIRDEVKQDQFYYRVYIRTDSDRLYNKSGKEFSITPGMVATVDIRTGQKTVLDYLGFVAQRFERQSAPN
>NZ_CP031991.1|WP_118902211.1|1199922_1200855_-|IS5-family-transposase
MKKPTHKIYRTTNWPAYNRALMSRGNIAIWFDPATQWYAPSKGKQGRNQTYSDAAIQCCLMIKSLFRLSLRMVTGFVQSLIKLCGLNWTAPDYSTLCRRQKHIDIAISYQKSSDGLHLLVDSTGMKFLGEGEWKRKKHGAEYRRQWRKLHIGIDAKTLQIRAIQLTTNNVSDSQVLGDLLNQIPQDEQIDSVYTDGAYDTKQCRQVIADRQAHAVIPPRKNAKPWKDTKSSSLERNELLRTIKRLGRTLWKKWSGYHRRSLVETKMHCIKLLGDKLSARSFDSQVNEVHARVAVLNRFTELGRPLTQVTP
>NZ_CP031991.1|WP_017396178.1|1201056_1201656_+|YigZ-family-protein
MHFTIATSVTFEEEIKKSRFQAIAAIVENEQQVKNFLEENKDLSTTHQCWAWKIGHNVRFNDDGEPSGTAGRPILATIEGNDLTNVIVLVNRWYGGIKLGTGGLVRAYGGCTGQCLMLAEKIELIQKKQIQFACWFNEWAILQYELVQHQVEYVESYNETGVLVEARLQVHQIDALKNKLQDITRGREQLKIIEEQNDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031991_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031991_5

2026229-2026497

Orphan

I-F

Consensus_repeat	Method
TGTTCACTGCCGCATAGGCAGCTTAGAAA	CRISPRCasFinder
GTTCACTGCCGCATAGGCAGCTTAGAAA	PILER-CR
GTTCACTGCCGCATAGGCAGCTTAGAAA	CRT

4 spacers

The CRISPR arrays of NZ_CP031991_5

>merge|NZ_CP031991|5|2026229-2026497|CRISPRCasFinder,PILER-CR,CRT
TGTTCACTGCCGCATAGGCAGCTTAGAAAAATTCATGATTGATAAGTTTAAAGAAGAAGATGTTCACTGCCGCATAGGCAGCTTAGAAACAACACATACTCATCAAGAATTACTTTTAATTGTTCACTGCCGCATAGGCAGCTTAGAAAAGTACCCGAACAACACACGATCACATTATCGGGTTCACTGCCGCATAGGCAGCTTAGAAATAACTTTGTAGCTGTATCTGTAGCCATTGTTGGTTCACTGACGCATAGGCAGCTCATAAT

>NZ_CP031991|5|3|2026229-2026497|CRISPRCasFinder
TGTTCACTGCCGCATAGGCAGCTTAGAAA	AATTCATGATTGATAAGTTTAAAGAAGAAGA
TGTTCACTGCCGCATAGGCAGCTTAGAAA	CAACACATACTCATCAAGAATTACTTTTAAT
TGTTCACTGCCGCATAGGCAGCTTAGAAA	AGTACCCGAACAACACACGATCACATTATCG
GGTTCACTGCCGCATAGGCAGCTTAGAAA	TAACTTTGTAGCTGTATCTGTAGCCATTGTT
GGTTCACTGACGCATAGGCAGCTCATAAT

>NZ_CP031991|5|2|2026230-2026437|PILER-CR
GTTCACTGCCGCATAGGCAGCTTAGAAA	AATTCATGATTGATAAGTTTAAAGAAGAAGAT
GTTCACTGCCGCATAGGCAGCTTAGAAA	CAACACATACTCATCAAGAATTACTTTTAATT
GTTCACTGCCGCATAGGCAGCTTAGAAA	AGTACCCGAACAACACACGATCACATTATCGG
GTTCACTGCCGCATAGGCAGCTTAGAAA

>NZ_CP031991|5|2|2026230-2026497|CRT
GTTCACTGCCGCATAGGCAGCTTAGAAA	AATTCATGATTGATAAGTTTAAAGAAGAAGAT
GTTCACTGCCGCATAGGCAGCTTAGAAA	CAACACATACTCATCAAGAATTACTTTTAATT
GTTCACTGCCGCATAGGCAGCTTAGAAA	AGTACCCGAACAACACACGATCACATTATCGG
GTTCACTGCCGCATAGGCAGCTTAGAAA	TAACTTTGTAGCTGTATCTGTAGCCATTGTTG
GTTCACTGACGCATAGGCAGCTCATAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031991.1\|WP_004638639.1\|2022977_2023412_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|376515
NZ_CP031991.1\|WP_005081129.1\|2026599_2027370_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238487
NZ_CP031991.1\|WP_005081141.1\|2034555_2035188_+\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225366
NZ_CP031991.1\|WP_004638628.1\|2033480_2034539_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
NZ_CP031991.1\|WP_004678526.1\|2031921_2032623_+\|IS1-family-transposase	unknown	unknown	gnl\|CDD\|224576
NZ_CP031991.1\|WP_004638640.1\|2022386_2022938_-\|DUF2799-domain-containing-protein	unknown	unknown	gnl\|CDD\|378521
NZ_CP031991.1\|WP_005081125.1\|2023854_2025153_-\|AarF/ABC1/UbiB-kinase-family-protein	unknown	unknown	gnl\|CDD\|223733
NZ_CP031991.1\|WP_005081120.1\|2017514_2020220_-\|outer-membrane-protein-assembly-factor	unknown	unknown	gnl\|CDD\|223801
NZ_CP031991.1\|WP_017394407.1\|2029864_2030884_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP031991.1\|WP_005081137.1\|2030953_2031637_-\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|223678
NZ_CP031991.1\|WP_004638645.1\|2012406_2012793_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031991.1\|WP_004638638.1\|2023368_2023749_-\|dihydroneopterin-aldolase	unknown	unknown	gnl\|CDD\|376737
NZ_CP031991.1\|WP_004638641.1\|2021709_2022345_+\|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase	unknown	unknown	gnl\|CDD\|153101
NZ_CP031991.1\|WP_026057242.1\|2025198_2025984_-\|HesA/MoeB/ThiF-family-protein	unknown	unknown	gnl\|CDD\|238386
NZ_CP031991.1\|WP_005081130.1\|2027453_2028488_-\|lipase-secretion-chaperone	unknown	unknown	gnl\|CDD\|234937
NZ_CP031991.1\|WP_005081118.1\|2012959_2017468_-\|translocation/assembly-module-TamB-domain-containing-protein	unknown	unknown	gnl\|CDD\|225463
NZ_CP031991.1\|WP_151800481.1\|2032615_2033338_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187629
NZ_CP031991.1\|WP_005081145.1\|2035184_2036006_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
NZ_CP031991.1\|WP_005081122.1\|2020383_2021706_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|235865
NZ_CP031991.1\|WP_005081133.1\|2028567_2029587_-\|triacylglycerol-lipase	unknown	unknown	gnl\|CDD\|224001

Protein	Function_ID	Function_description	E-value
NZ_CP031991.1\|WP_004638639.1\|2022977_2023412_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|376515	pfam01288, HPPK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK).	1.67007e-12
NZ_CP031991.1\|WP_005081129.1\|2026599_2027370_+\|hypothetical-protein	gnl\|CDD\|238487	cd00987, PDZ_serine_protease, PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.	1.66182e-06
NZ_CP031991.1\|WP_005081141.1\|2034555_2035188_+\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|225366	COG2808, PaiB, Transcriptional regulator [Transcription].	5.34499e-77
NZ_CP031991.1\|WP_004638628.1\|2033480_2034539_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.00308e-29
NZ_CP031991.1\|WP_004638640.1\|2022386_2022938_-\|DUF2799-domain-containing-protein	gnl\|CDD\|378521	pfam10973, DUF2799, Protein of unknown function (DUF2799). Some members in this family of proteins are annotated as yfiL which has no known function.	4.63083e-21
NZ_CP031991.1\|WP_005081125.1\|2023854_2025153_-\|AarF/ABC1/UbiB-kinase-family-protein	gnl\|CDD\|223733	COG0661, AarF, Predicted unusual protein kinase [General function prediction only].	8.80366e-91
NZ_CP031991.1\|WP_005081120.1\|2017514_2020220_-\|outer-membrane-protein-assembly-factor	gnl\|CDD\|223801	COG0729, COG0729, Outer membrane protein [Cell envelope biogenesis, outer membrane].	1.99622e-63
NZ_CP031991.1\|WP_017394407.1\|2029864_2030884_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.12081e-15
NZ_CP031991.1\|WP_005081137.1\|2030953_2031637_-\|superoxide-dismutase	gnl\|CDD\|223678	COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism].	4.13068e-104
NZ_CP031991.1\|WP_004678526.1\|2031921_2032623_+\|IS1-family-transposase	gnl\|CDD\|224576	COG1662, InsB, Transposase and inactivated derivatives, IS1 family [DNA replication, recombination, and repair].	1.70188e-26
NZ_CP031991.1\|WP_004638638.1\|2023368_2023749_-\|dihydroneopterin-aldolase	gnl\|CDD\|376737	pfam02152, FolB, Dihydroneopterin aldolase. This enzyme EC:4.1.2.25 catalyzes the conversion of 7,8-dihydroneopterin to 6-hydroxymethyl-7,8-dihydropterin in the biosynthetic pathway of tetrahydrofolate.	2.14425e-34
NZ_CP031991.1\|WP_004638641.1\|2021709_2022345_+\|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase	gnl\|CDD\|153101	cd01042, DMQH, Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain. Demethoxyubiquinone hydroxylases (DMQH) are members of the ferritin-like, diiron-carboxylate family which are present in eukaryotes (the CLK-1/CAT5 family) and prokaryotes (the Coq7 family). DMQH participates in one of the last steps of ubiquinone biosysnthesis and is responsible for DMQ hydroxylation, resulting in the formation of hydroxyubiquinone, a precursor of ubiquinone. CLK-1 is a mitochondrial inner membrane protein and Coq7 is a proposed interfacial integral membrane protein. Mutations in the Caenorhabditis elegans gene clk-1 affect biological timing and extend longevity. The conserved residues of a diiron center are present in this domain.	1.0496e-74
NZ_CP031991.1\|WP_026057242.1\|2025198_2025984_-\|HesA/MoeB/ThiF-family-protein	gnl\|CDD\|238386	cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). .	2.25895e-97
NZ_CP031991.1\|WP_005081130.1\|2027453_2028488_-\|lipase-secretion-chaperone	gnl\|CDD\|234937	PRK01294, PRK01294, lipase secretion chaperone.	1.33208e-66
NZ_CP031991.1\|WP_005081118.1\|2012959_2017468_-\|translocation/assembly-module-TamB-domain-containing-protein	gnl\|CDD\|225463	COG2911, COG2911, Uncharacterized protein conserved in bacteria [Function unknown].	2.46938e-114
NZ_CP031991.1\|WP_151800481.1\|2032615_2033338_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187629	cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs. HSD10, also known as amyloid-peptide-binding alcohol dehydrogenase (ABAD), was previously identified as a L-3-hydroxyacyl-CoA dehydrogenase, HADH2. In fatty acid metabolism, HADH2 catalyzes the third step of beta-oxidation, the conversion of a hydroxyl to a keto group in the NAD-dependent oxidation of L-3-hydroxyacyl CoA. In addition to alcohol dehydrogenase and HADH2 activites, HSD10 has steroid dehydrogenase activity. Although the mechanism is unclear, HSD10 is implicated in the formation of amyloid beta-petide in the brain (which is linked to the development of Alzheimer's disease). Although HSD10 is normally concentrated in the mitochondria, in the presence of amyloid beta-peptide it translocates into the plasma membrane, where it's action may generate cytotoxic aldehydes and may lower estrogen levels through its use of 17-beta-estradiol as a substrate. HSD10 is a member of the SRD family, but differs from other SDRs by the presence of two insertions of unknown function. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.82737e-110
NZ_CP031991.1\|WP_005081145.1\|2035184_2036006_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	9.53773e-119
NZ_CP031991.1\|WP_005081122.1\|2020383_2021706_+\|MFS-transporter	gnl\|CDD\|235865	PRK06814, PRK06814, acyl-[ACP]--phospholipid O-acyltransferase.	6.35634e-138
NZ_CP031991.1\|WP_005081133.1\|2028567_2029587_-\|triacylglycerol-lipase	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	8.25434e-44

>NZ_CP031991.1|WP_026057242.1|2025198_2025984_-|HesA/MoeB/ThiF-family-protein
MSDHLEHTFELTDDEMHLYSRQILLDGWDIEAQEKLKLANVLIVGAGGIGCTSAELLARAGVGKITIVDADTIEVSNLQRQIAFTSNDLGQYKAETLAKHLQEINPHIQVSYQNKRFDETNADELVQHQDVVLDGCDNFTTRYLVNAVCKTHQVPLISASAIGFEGQMFMVESDSACYECLFPKENQTNEGLRCAESGVLATTPVMVASLQAHHTLLFLGLGLTPLKQKLLLWNGLNLTQRILQFEKDVNCPVCQASASVN
>NZ_CP031991.1|WP_005081125.1|2023854_2025153_-|AarF/ABC1/UbiB-kinase-family-protein
MKRNILVDGLRSVARIGETVIVAAQAGVKYATEKPSNAKLMRETFESLGSTYIKLGQFIASTPSLFPREYVQEFQGCLDQTPTLPFSYIQQVLAEEFEGKDLNSIFSFIDENPLASASIAQVHAAKLVTGEDVVLKVQKPGVETILYTDLNVVHWATKLLEKAVPKIKFASLSEIVDEIKTRMVREVDFIEEAQNLDDFVQYLNISGNQAATAPKVYHQFSTRRVLTMQRLYGVPLTDFDVVKQYAKDPTQVLITAMNTWFGSLMLCKSFHADLHAGNLMLLEDGRVGFIDFGIVGQLNPEVWTACMAFMDALQHTNYIAMAENMLKMGMTNQKIDTQVLAADLERLFSGVLLADPQEILSSNPADLNDIMMDMVAVGERHGIKFPRDFALLFKQMLYFDRFMRVLAPYTDIYADQRLKMVHNIEPASLLKH
>NZ_CP031991.1|WP_004638638.1|2023368_2023749_-|dihydroneopterin-aldolase
MDAIIIEGLKVDTVIGCFNWERQIIQPLMLDLTIHNDLSQAARSDELEDTLNYAQICEIAAQVIQDAKPKLIEHAAQLVLEVLFNTFPSIDSISITIRKPAIIAQANAVGIRLDRNRNDFCARAGE
>NZ_CP031991.1|WP_004638639.1|2022977_2023412_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MIATETIFALALASNVQQLENFNFAYAQIMSLGTVEFSSIYEIPCRDGVGADYWNSACLLKSHLSVDEIVDILKKLEQQSGRVRPSHHISLDIDVIAWGESLDQMQFNPKKLPLALDVKIPLYELWPNQILQYDQNRKYPIITL
>NZ_CP031991.1|WP_004638640.1|2022386_2022938_-|DUF2799-domain-containing-protein
MKTLVSISIMAVLLSGCAAMSVEQCKTANWLSVGEKDGSAGYESRLDKYYSSCQKANVVPNQALYEKGYQKGLGYYCRPESIFNEALEGRGDYRVCSIEKRETLRPYYQVAHEYYQANSEFNRSQSDVSHYLRELERKDLSAKDRDEYKKRLSDLRSNRNRVQFRYQDAVRNLERFKAEHGLP
>NZ_CP031991.1|WP_004638641.1|2021709_2022345_+|2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone-monooxygenase
MRHYTGLDQLINSFDQALRSLVPGATTSQRSNPANDEASQLCVSDARHVAGLMRVNHSGEVCAQALYHGQALTAKLPHVREEMQQAAVEEQDHLAWCEDRLKELDSHTSVLNPIWYGLSYGMGAIAGIAGDKYSLGFVAETERQVSQHLQEHLQQLPEQDQRSRKILEQMNEDELHHRDTALKAGGVDLPVPVRITMTAISKLMTKTSYYI
>NZ_CP031991.1|WP_005081122.1|2020383_2021706_+|MFS-transporter
MMKQDEQLMTSRRFAPMFFTQFFGALNDNVYKQALLLVITYGWIQQQSAAVSTLNNLAALLFILPYFFFSATAGQVADKYERSQLVRFLKLLEIVIMMIGTAGFLLGNLWLLLFALFLMGTHSTCFGPIKYAILPEILKPQELMSGNALFQSGTSIAILFGMILGGAVIASSAGNLLWISITVLIIACLGYLASRFILPQKVAAPDLKIDWNFFRTSFQTIKYAKSIPIVFTVLLGNSWYWFYGATYLTQIPQLTQQNLHASENVVSLLLTFFSVGIGIGSLLCRRIGGSEINIKMVPYGAIGLTVFAFYLAASLTFVPERTGELLSLGDVFSEGAVYYHVMLAVTLLGISGGFYIVPLYAMMQAYSPRSHRARVVAANNILNAVFMVSSAIFSILILSILKIDIKILFSITAVLSAIFSFWLLTRLKPLLKNAPTTLED
>NZ_CP031991.1|WP_005081120.1|2017514_2020220_-|outer-membrane-protein-assembly-factor
MPSKSKFKQSTLVHSMHLIFKMQSFPKLICSGFLISYCISVAYADEEAVVVAENSTIERMKDQVKSIPSPEIPYETFNLSSEYYNPAQDSVAALKQQEEAPSQIDTLKPIQLDENLEHLPVIAVDQNMANEIFQIAEEAKNDALAYRENVAKNPELVVNEATQSELTEISNPPVNIDRLMQEIQADSQIIVEANESGRTLADLQSKTEQVEEKAGFFKRIVNRFRPENLLGAERVPRISADVSGAPPALATNIKAKLSSFTQEAFEDFNVALPQLRSLTNQAAQAVGYYDARFSFEKLSDSRVKVTVEPNEPVKIDKQNIEFTGEGENAPQFQVIRLIPEQDEGDIFNHGKYEATKTKITNAASDNGYFDAYWRLHDVKISQPEKTAEINLKYDTGERYKLKAVEYKMSDPSKPLPLTQKVLDSLAPWKDGDDYAFWRVNVLANNLTNTRYFNYTLVDTIKPDAIQPPLDLPPDLQALVDQQRVEQSQLFSAQQKADIARQQVVSAEEVTQDVVDESQFSGSEPTPAYSLARSMPNIQNDETERQALEEQARLEKKIPVVVTLNADRLNTIETGVGYGTDTGARIRSQYRRAFVNKHGHSFDANIEVSEIRQSIDGRYSIPYKHPLNDYFNLVGGYERETRDNIGPNVELLVESAVVGGERVIKNPLGDWQHTFGLRYRLDRLTGKGDVDVSELPDAFRAAGTNSEQESLLLGYEISKTNSNTRLNPTKGFKQTYKVELGTESILSDANMAILTAGWRFIYSLGENDNHQFVGRGDASYIFTDDFDKVPYNLRFFTGGDQSLRGFDYKSLSPEEDGYKIGGQALGVGSLEYNYQFKDGWRAAVFSDFGNAFDKQFSNPTEYSVGVGIRWRSPIGPIRLDVASGISNDNRPIRLHFFIGPQL
>NZ_CP031991.1|WP_005081118.1|2012959_2017468_-|translocation/assembly-module-TamB-domain-containing-protein
MTEEVEQQQTPSTGPKRERRILRSILLMVLIILLLLVSSLLVMMSTDKGSRFLLDRVLQTQKIIHYEYESGNLLRGIILKNVLVQLEAVDVSLDRADVSLGWRAILKKEIHLSHADVANLKIINKKPPSGEPFGFDPIKLPFILRIDEASLDHLEIQTATAKINFDDIYLKDALWSETKLKFKDSRMDMGYLAVKDATGQIDFSGKYPLNAKADLIIPALNSIDIETIKVVATGSLDTLRAGVATLTPDLLTGWAVLHPVRDQVPMQGELFFRNYHLPILKEQKLFAKDGIARFKGNIEKLVLSLDTDLKGEQIPEGKYNALMETDLTDQLNIQDFNGQLMGGSVSLKGLVNWKDHVSWDLKGRLDRLNAKDETLPQIAQDFLPPSLDANISSTGMLKNGMSVNAQLAFDKYETWQVKLNQSEQKNNQPEPMLLDVAWQGIDRAVPYIGWLSSAEGHTNITLKDDQQDIYVATTVRPHEQGLLPAGKYDAHIDLKGSLLNVENFSYVAEKGRLDGQAKVKLPTDKQQLAWQAQLKAKDFNPQTVALAAPVNLLNGEILASGFAKPNQQIIQFERIDLQGQLAQANQKETVVLQGKATTALMFDDVQAGGGFKSFAVDYDGSLNALNQGNGLLKINIAGTPTNIKINELKHDGVAGKLFATGTVDLQDKIGWNIETSLVRFKPQYFVSSLKGEVSGHVKTQGVWSDKVKRIDIRQLNAAGFLNNRPVRGRGNLSLLLDSNQTGFLPQQFEANDLFFAYGQNQLQATGNAQSLRFKVNAPALYELYPGLRGRAYGSLNVQSQPRLSATANLVVDGFAFNDLASVKSLRIQGQLPTSETTPTKLTATIDQLRSGKRELENATLNLTGTRRAHLLKLETKNARTNFYVQLAGGFNQNNDWLGQIQKGKFSSRRVSLVQNQNTPVIYTTARTELYVGQHCWQSAESQLCLDQPARISPEKGNFSFVTKDLDLKDFAAFMPEGIAVTGQLNGYAKASWAKGTRPKLDSRLVTRKGEIGLAAEDPQDPATTVTYDELSLIAKSISDGLLFRVDMKTPDIGTGYANVVIDPFQTGMPMRGEIAFDDVQLKVFKPFIKDVRSMAGTLALAGKINGTLTQPQFTGEMRLKNGAISMISLPVNLTNMQLYSSIRQDTASIDGAFNSGQGVGRIKGRFDWKDNPHLSLTLKGDNLLVRQAPMITAIVQPDLSLDVYPFDQRLSLRGTIDVPRARISMPESSATVVNVSPDVRVVHQGQDLLATLRAAKPWDIRADMTVTLGNQVIFQGFESNIPLVGRLHLSQRGLETAMRANGAIGVSQKVKIEAYGQSLDLNRAIARFNGPLANPTLDIDANKSVQGSMVGVRVAGTATVPNVQIYNDAGLSEQEALNALLTGRINEGGSGLSNTEGFKSDVNNTIAAAGISMGLGGTRALTNQIGRTFGLSGLALDAQGTGDDTQVSLTGYITPDLFIRYGVGVFTPVNKLTLRYQMNRRLYLEASQSLERAIDVFYNWRF
>NZ_CP031991.1|WP_004638645.1|2012406_2012793_-|hypothetical-protein
MHQINRSMMMKKVLLIAIGLVLVGCADKKPLTPEEKWHGFCVSVGNAARSITLDRQNAIEKQQAIEHAGKIEDKTIHKFILQIIDEVYEIPVDQLKSDPSAIRDEMKQKFTEQCLATPHDELPNYKSF
>NZ_CP031991.1|WP_005081129.1|2026599_2027370_+|hypothetical-protein
MEKTLLKFICLITLLVSTNPNIYANVYIPIPSLKKPKISPHIKAQALKTDEFDVSTKQLLEKGYIPIKSQTFNGRDDFRGYEHVVAALEKRADQMGAQIVLFTNEKPTGSVDYYSFTTPFPQKSTIQSNFDNSNNNPYASSNSSLIQTAPRYNAQKEYIVSYFYKFESITGIYPIDLSDLDKSKTGQLEGIKAKVIYKDSPAFGTILEDDIILKINGNTIRDVSNFVDISNYLNSGTVEFEILRKGQKLNKEISIK
>NZ_CP031991.1|WP_005081130.1|2027453_2028488_-|lipase-secretion-chaperone
MSVQNFNNKKIILIATICLIIFLAFIYWVFKPSVHDQSPLNNSHSQRGINSVSVENNSQAQLSGKLPILAPSLQGTEIDCPLQVDGDGKLILTIGIRSCFDYFFSSLGEKTETELIGDIRQYLRATLPETAANYGIYLLDQYVAYTHALKNLKTSTHFKKDEIDKFQNIVDQMSKLQQQFFNAAEIQAFFGNERNFNQFSIDQMRIHANKTLTAQQKATELAKLIDQLPPTLADGVRVSMQFAELQQLTQEIKEKGGSAQELRNMRESLLGVEAADRLEKVDQEEAVWQNQVNNYLSQRDQILKSDVDDASKQRALNQLRNNSFATKEELLRAQTYEMMHDRKR
>NZ_CP031991.1|WP_005081133.1|2028567_2029587_-|triacylglycerol-lipase
MKKKYLNAIVLTTGMLISGGSVVHAGLFSFLSPKASWQNCDVKSCSVGGSTNVTSSYAKTKYPIVLAHGMSGFSAVGPLQYWHGITEDLVSNGANVFVTQQAAFNSSEVRGEQLLLQTKQILAISGAEKVNLVGHSHGTHSIRYVAGLMPDKVASVTAVAGPGKGSNVADVVYDFTQSPVGPIAAPVISAGVNAFGALIGIGSGNYYDQDSLAGLWSLTTAGAAEFNQRFPAGIPTAACGSGRELESNGVRYYSWTGISPFTNALDPFDYALTATSLLIPGDSDGLVPRCSSHLGTVIRDNYAFNHLDEVNQVLGLVGFLQNPVTPFRLQANRLKNLNL
>NZ_CP031991.1|WP_017394407.1|2029864_2030884_+|AraC-family-transcriptional-regulator
MSIPRLHHPHFISSSYVHLLSEVVARWNISAEELFWGTGVEIEKLHDINYKISLTSFKKVIARTIDLTQEQGIGFYASTQLKISSHGLLGFTVAIAKNPLDAIQTINQFVSLQCSFVDLHFVVENELAYYNIIYDKSVMDFNDPCDLQAYEFSCVFFLTGFVHLVRFFIPDFKPSIDLQCKCPEYFSRFKHILASSFTEIHYEQPHTRLISSAKFLEKPLSMSDPLTSEKFKLLCQKELDELVATQNILHRVKNLIDDQHQGLLNIDQVAQKLNLTKRTLQRMLQEQNVSFQILYDQVRKAKAQKLLLNPFITKDEIARNLGYSSLSSFNRAYKRWENQ
>NZ_CP031991.1|WP_005081137.1|2030953_2031637_-|superoxide-dismutase
MRYLNKGLLTLLVCSSVSISAFANFTQAPLPYKSDALEPAIDQQTMEIHYGKHHKAYVDNLNAQIKTYPELDKLNIEQIQQQISKYNAAVRNNGGGHFNHAFFWESLAPTDKTGKVSPKLLKQINQDFGSFKAFQEQFNQAATSRFGSGWAWLIVNPQGKLEITSTPNQDNPLMDIAEKKGQPLLGLDVWEHAYYLKYQNRRADYTNAFWSVVNWNKVNDRYQKASK
>NZ_CP031991.1|WP_004678526.1|2031921_2032623_+|IS1-family-transposase
MRITLEIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHALSYLGCNSGITRKILQLMVRGSGIRDIAEVERISIGKVLRTLTESTYQIQPKQSHYESLEVDEFWTFVGNKNNKQWLIYAYHRETGEIVAYVWGKRDLATVQRLKTKLKQLGIHYTRIASDHWDSFITAFKNCEQSIGKFFTVGIEGNNCKIRHRIRRGFRRSCNFSKKIENHFKAFDLTFFYINNGFI
>NZ_CP031991.1|WP_151800481.1|2032615_2033338_-|SDR-family-NAD(P)-dependent-oxidoreductase
MKIQGKHFVITGGGSGLGAATAEYLVEKGASVTLVDMNAEVGEQQAKAIGDQAEFVKLDVTDEQAAEQFFKEVVEKHGSLHGLINCAGVGPSAKVVGKDGVHDLAMFSKVLHINVTGTFNMLRYAADAMSKNSVEEGDEDRGVIVNTASVAAFDGQIGQAAYSASKGAVVAMTLPIARELARHSIRIMTIAPGIMETPMLKGLPQNVQDALGQMVPYPSRLGRPEEFARWWCFKKYADIK
>NZ_CP031991.1|WP_004638628.1|2033480_2034539_+|AraC-family-transcriptional-regulator
MSKNPPLDLNSAKDTISNALIREALSVAASRGLNIVNIANRAGISAELLTSAKARIPVTQCAQLWVELAESMNDEFLGMDSHPMRRGSYKLLAKLAFEADTLEQAIREILKFLSLVLDDIHGELVQNGSKAYLILHDRDQPKRMFTYSTFLMLVHSLMCWLSDQRIVFLKMSFKCHQPVEIQDYRIRFCENIQFHATQNCIEFDAHYLKHKIKKDKQALNDFLRHTPYNLIVRFKNENSLSLQIRRQLLLQPPSEWAELKDIAQQLNMSTATIQRRLKHEGVSYQQLKNDIRCDIAIERLSKTNDSIQSISDDLNFHDPSAFHRAFKKWSGVSPGSYRKSAPNKQNRLHHLG
>NZ_CP031991.1|WP_005081141.1|2034555_2035188_+|FMN-binding-negative-transcriptional-regulator
MYIPQIFKETRQDVLHDLIRQYPFATLITQNNAGLDAMHLPIELLVNDEQNATLVAHIAKNNPLHTQIDNGAEVLVIFQGQQGYISPNWYPSKQQHHQHVPTWNYQVVHVKGKIYFSQDEKVLRGILARLTRTHEAKQDKPWKMSDAPSEYIAEELRHIVAVEIQVSEMVGQFKMSQNRDPIDAIGIVEGLEQQGNTELAQVVKHSTQSN
>NZ_CP031991.1|WP_005081145.1|2035184_2036006_-|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MNIAQALEIKGEIDSYERQEAAWLLEHILGVNSLELKLRLEQELTEIQEQAYLDGLARIEQGEPLAYVTGSQPFWTLDLKVTHDTLVPRPDTEILVETVLKLSLDPQANIVDLGTGTGAIALALASERPQWSVTATDIYQPTLDVAQENALKHGFSQVKFACGAWFQALVEQQQFDLIVSNPPYIDPDDVHMQKLKSEPERALIAANHGLADIEIIIAQGKAWLKAKGWIVLEHGYDQGRAVREIFELHGFVQIQTIKDYGGNDRVSLAQKAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	512909-512931	0	1.0
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	512966-512988	0	1.0
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	513020-513042	0	1.0
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	513074-513096	0	1.0
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	513128-513150	0	1.0
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	511477-511499	1	0.957
NZ_CP031991_2	2.1\|513251\|23\|NZ_CP031991\|CRT	513251-513273	23	NZ_CP031991.1	510665-510687	2	0.913
NZ_CP031991_2	2.2\|513308\|20\|NZ_CP031991\|CRT	513308-513327	20	NZ_CP031991.1	512909-512928	0	1.0
NZ_CP031991_2	2.2\|513308\|20\|NZ_CP031991\|CRT	513308-513327	20	NZ_CP031991.1	512966-512985	0	1.0
NZ_CP031991_2	2.2\|513308\|20\|NZ_CP031991\|CRT	513308-513327	20	NZ_CP031991.1	513020-513039	0	1.0
NZ_CP031991_2	2.2\|513308\|20\|NZ_CP031991\|CRT	513308-513327	20	NZ_CP031991.1	513074-513093	0	1.0
NZ_CP031991_2	2.2\|513308\|20\|NZ_CP031991\|CRT	513308-513327	20	NZ_CP031991.1	513128-513147	0	1.0
NZ_CP031991_2	2.3\|513362\|20\|NZ_CP031991\|CRT	513362-513381	20	NZ_CP031991.1	512909-512928	0	1.0
NZ_CP031991_2	2.3\|513362\|20\|NZ_CP031991\|CRT	513362-513381	20	NZ_CP031991.1	512966-512985	0	1.0
NZ_CP031991_2	2.3\|513362\|20\|NZ_CP031991\|CRT	513362-513381	20	NZ_CP031991.1	513020-513039	0	1.0
NZ_CP031991_2	2.3\|513362\|20\|NZ_CP031991\|CRT	513362-513381	20	NZ_CP031991.1	513074-513093	0	1.0
NZ_CP031991_2	2.3\|513362\|20\|NZ_CP031991\|CRT	513362-513381	20	NZ_CP031991.1	513128-513147	0	1.0
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511297-511322	0	1.0
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511976-512001	1	0.962
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	512400-512425	1	0.962
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	512460-512485	1	0.962
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511177-511202	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511237-511262	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511357-511382	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	511417-511442	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	512036-512061	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	512096-512121	2	0.923
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP031991.1	512156-512181	2	0.923
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	511976-511995	0	1.0
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	511297-511316	1	0.95
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	511357-511376	1	0.95
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	511417-511436	1	0.95
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	512036-512055	1	0.95
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	512156-512175	1	0.95
NZ_CP031991_2	2.5\|513476\|20\|NZ_CP031991\|CRT	513476-513495	20	NZ_CP031991.1	512400-512419	2	0.9
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511357-511382	0	1.0
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511417-511442	0	1.0
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	512036-512061	0	1.0
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	512156-512181	0	1.0
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511976-512001	1	0.962
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	512400-512425	1	0.962
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511177-511202	2	0.923
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511237-511262	2	0.923
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	511297-511322	2	0.923
NZ_CP031991_2	2.6\|513530\|26\|NZ_CP031991\|CRT	513530-513555	26	NZ_CP031991.1	512096-512121	2	0.923
NZ_CP031991_2	2.7\|513590\|20\|NZ_CP031991\|CRT	513590-513609	20	NZ_CP031991.1	512460-512479	2	0.9
NZ_CP031991_2	2.8\|513644\|26\|NZ_CP031991\|CRT	513644-513669	26	NZ_CP031991.1	511237-511262	1	0.962
NZ_CP031991_2	2.8\|513644\|26\|NZ_CP031991\|CRT	513644-513669	26	NZ_CP031991.1	512096-512121	1	0.962
NZ_CP031991_2	2.8\|513644\|26\|NZ_CP031991\|CRT	513644-513669	26	NZ_CP031991.1	511297-511322	2	0.923
NZ_CP031991_2	2.8\|513644\|26\|NZ_CP031991\|CRT	513644-513669	26	NZ_CP031991.1	512400-512425	2	0.923

1. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 512909-512931, mismatch: 0, identity: 1.0

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccacca	Protospacer
***********************

2. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 512966-512988, mismatch: 0, identity: 1.0

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccacca	Protospacer
***********************

3. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 513020-513042, mismatch: 0, identity: 1.0

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccacca	Protospacer
***********************

4. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 513074-513096, mismatch: 0, identity: 1.0

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccacca	Protospacer
***********************

5. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 513128-513150, mismatch: 0, identity: 1.0

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccacca	Protospacer
***********************

6. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 511477-511499, mismatch: 1, identity: 0.957

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccgtcaccgcca	Protospacer
*******************.***

7. spacer 2.1|513251|23|NZ_CP031991|CRT matches to position: 510665-510687, mismatch: 2, identity: 0.913

ttaataaaccgccgtcaccacca	CRISPR spacer
ttaataaaccgccatcaccgcca	Protospacer
*************.*****.***

8. spacer 2.2|513308|20|NZ_CP031991|CRT matches to position: 512909-512928, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

9. spacer 2.2|513308|20|NZ_CP031991|CRT matches to position: 512966-512985, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

10. spacer 2.2|513308|20|NZ_CP031991|CRT matches to position: 513020-513039, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

11. spacer 2.2|513308|20|NZ_CP031991|CRT matches to position: 513074-513093, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

12. spacer 2.2|513308|20|NZ_CP031991|CRT matches to position: 513128-513147, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

13. spacer 2.3|513362|20|NZ_CP031991|CRT matches to position: 512909-512928, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

14. spacer 2.3|513362|20|NZ_CP031991|CRT matches to position: 512966-512985, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

15. spacer 2.3|513362|20|NZ_CP031991|CRT matches to position: 513020-513039, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

16. spacer 2.3|513362|20|NZ_CP031991|CRT matches to position: 513074-513093, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

17. spacer 2.3|513362|20|NZ_CP031991|CRT matches to position: 513128-513147, mismatch: 0, identity: 1.0

ttaataaaccgccgtcacca	CRISPR spacer
ttaataaaccgccgtcacca	Protospacer
********************

18. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511297-511322, mismatch: 0, identity: 1.0

caagaggactaccatcaccgccaatg	CRISPR spacer
caagaggactaccatcaccgccaatg	Protospacer
**************************

19. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511976-512001, mismatch: 1, identity: 0.962

caagaggactaccatcaccgccaatg	CRISPR spacer
caagaggactaccgtcaccgccaatg	Protospacer
*************.************

20. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 512400-512425, mismatch: 1, identity: 0.962

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccatcaccgccaatg	Protospacer
**** *********************

21. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 512460-512485, mismatch: 1, identity: 0.962

caagaggactaccatcaccgccaatg	CRISPR spacer
caagaggactaccatcaccaccaatg	Protospacer
*******************.******

22. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511177-511202, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcgggctaccatcaccgccaatg	Protospacer
**** **.******************

23. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511237-511262, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
**** ***********.*********

24. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511357-511382, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**** ********.************

25. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 511417-511442, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**** ********.************

26. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 512036-512061, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**** ********.************

27. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 512096-512121, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
**** ***********.*********

28. spacer 2.4|513416|26|NZ_CP031991|CRT matches to position: 512156-512181, mismatch: 2, identity: 0.923

caagaggactaccatcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**** ********.************

29. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 511976-511995, mismatch: 0, identity: 1.0

caagaggactaccgtcaccg	CRISPR spacer
caagaggactaccgtcaccg	Protospacer
********************

30. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 511297-511316, mismatch: 1, identity: 0.95

caagaggactaccgtcaccg	CRISPR spacer
caagaggactaccatcaccg	Protospacer
*************.******

31. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 511357-511376, mismatch: 1, identity: 0.95

caagaggactaccgtcaccg	CRISPR spacer
caagcggactaccgtcaccg	Protospacer
**** ***************

32. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 511417-511436, mismatch: 1, identity: 0.95

caagaggactaccgtcaccg	CRISPR spacer
caagcggactaccgtcaccg	Protospacer
**** ***************

33. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 512036-512055, mismatch: 1, identity: 0.95

caagaggactaccgtcaccg	CRISPR spacer
caagcggactaccgtcaccg	Protospacer
**** ***************

34. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 512156-512175, mismatch: 1, identity: 0.95

caagaggactaccgtcaccg	CRISPR spacer
caagcggactaccgtcaccg	Protospacer
**** ***************

35. spacer 2.5|513476|20|NZ_CP031991|CRT matches to position: 512400-512419, mismatch: 2, identity: 0.9

caagaggactaccgtcaccg	CRISPR spacer
caagcggactaccatcaccg	Protospacer
**** ********.******

36. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511357-511382, mismatch: 0, identity: 1.0

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**************************

37. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511417-511442, mismatch: 0, identity: 1.0

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**************************

38. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 512036-512061, mismatch: 0, identity: 1.0

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**************************

39. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 512156-512181, mismatch: 0, identity: 1.0

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccgtcaccgccaatg	Protospacer
**************************

40. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511976-512001, mismatch: 1, identity: 0.962

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagaggactaccgtcaccgccaatg	Protospacer
**** *********************

41. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 512400-512425, mismatch: 1, identity: 0.962

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccatcaccgccaatg	Protospacer
*************.************

42. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511177-511202, mismatch: 2, identity: 0.923

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcgggctaccatcaccgccaatg	Protospacer
*******.*****.************

43. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511237-511262, mismatch: 2, identity: 0.923

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
*************.**.*********

44. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 511297-511322, mismatch: 2, identity: 0.923

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagaggactaccatcaccgccaatg	Protospacer
**** ********.************

45. spacer 2.6|513530|26|NZ_CP031991|CRT matches to position: 512096-512121, mismatch: 2, identity: 0.923

caagcggactaccgtcaccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
*************.**.*********

46. spacer 2.7|513590|20|NZ_CP031991|CRT matches to position: 512460-512479, mismatch: 2, identity: 0.9

caagagggttaccatcacca	CRISPR spacer
caagaggactaccatcacca	Protospacer
*******..***********

47. spacer 2.8|513644|26|NZ_CP031991|CRT matches to position: 511237-511262, mismatch: 1, identity: 0.962

caagtggactaccatcgccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
****.*********************

48. spacer 2.8|513644|26|NZ_CP031991|CRT matches to position: 512096-512121, mismatch: 1, identity: 0.962

caagtggactaccatcgccgccaatg	CRISPR spacer
caagcggactaccatcgccgccaatg	Protospacer
****.*********************

49. spacer 2.8|513644|26|NZ_CP031991|CRT matches to position: 511297-511322, mismatch: 2, identity: 0.923

caagtggactaccatcgccgccaatg	CRISPR spacer
caagaggactaccatcaccgccaatg	Protospacer
**** ***********.*********

50. spacer 2.8|513644|26|NZ_CP031991|CRT matches to position: 512400-512425, mismatch: 2, identity: 0.923

caagtggactaccatcgccgccaatg	CRISPR spacer
caagcggactaccatcaccgccaatg	Protospacer
****.***********.*********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031991_4	4.1\|1189513\|25\|NZ_CP031991\|CRISPRCasFinder	1189513-1189537	25	NZ_CP018261	Acinetobacter haemolyticus strain XH900 plasmid pXH901, complete sequence	44736-44760	2	0.92
NZ_CP031991_4	4.1\|1189513\|25\|NZ_CP031991\|CRISPRCasFinder	1189513-1189537	25	NZ_CP031985	Acinetobacter haemolyticus strain AN3 plasmid pAhaemAN3c, complete sequence	21095-21119	2	0.92
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NC_015156	Vibrio nigripulchritudo plasmid VIBNI_pA, complete genome	112721-112746	4	0.846
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	579034-579059	5	0.808
NZ_CP031991_2	2.4\|513416\|26\|NZ_CP031991\|CRT	513416-513441	26	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	579072-579097	5	0.808
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	28190-28220	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP026969	Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1	960-990	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	30603-30633	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	33802-33832	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	28113-28143	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	28197-28227	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	29608-29638	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	5238-5268	5	0.839
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	10753-10783	5	0.839
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	LC383633	Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence	28190-28221	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP026969	Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1	960-991	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NC_010077	Staphylococcus aureus plasmid EDINA, complete sequence	30603-30634	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NC_018952	Staphylococcus aureus plasmid pWBG747, complete sequence	29607-29638	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP014063	Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence	5237-5268	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NC_013326	Staphylococcus aureus plasmid pWBG746, complete sequence	10752-10783	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NC_013348	Staphylococcus aureus plasmid pSK156, complete sequence	33802-33833	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_AP020312	Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence	28113-28144	5	0.844
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_AP014922	Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence	28197-28228	5	0.844
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_LN906635	Lactobacillus reuteri plasmid p53608_1, complete genome, strain ATCC 53608	99646-99676	6	0.806
NZ_CP031991_1	1.2\|70274\|33\|NZ_CP031991\|PILER-CR	70274-70306	33	KU686211	Synechococcus phage S-WAM2 isolate 0810PA29, complete genome	69533-69565	7	0.788
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	68423-68453	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	724867-724897	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	493539-493569	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	493588-493618	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_AP019717	Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence	762235-762265	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	HQ634195	Vibrio phage eugene 12A10 genomic sequence	100420-100450	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	233862-233892	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	MK250021	Prevotella phage Lak-B2, complete genome	500532-500562	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	MK250023	Prevotella phage Lak-B4, complete genome	499763-499793	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	MK250027	Prevotella phage Lak-B8, complete genome	500294-500324	7	0.774
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	MK250026	Prevotella phage Lak-B7, complete genome	499331-499361	7	0.774
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NC_019526	Enterobacteria phage vB_KleM-RaK2, complete genome	133453-133483	7	0.774
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	MT708547	Klebsiella phage Muenster, complete genome	256187-256217	7	0.774
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	AB897757	Klebsiella phage K64-1 DNA, complete genome	133404-133434	7	0.774
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	MN693967	Marine virus AFVG_250M992, complete genome	26161-26191	7	0.774
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_AP014817	Geminocystis sp. NIES-3708 plasmid pGM02, complete sequence	28663-28694	7	0.781
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	MK250021	Prevotella phage Lak-B2, complete genome	500531-500562	7	0.781
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	MK250023	Prevotella phage Lak-B4, complete genome	499762-499793	7	0.781
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	MK250027	Prevotella phage Lak-B8, complete genome	500293-500324	7	0.781
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	MK250026	Prevotella phage Lak-B7, complete genome	499330-499361	7	0.781
NZ_CP031991_1	1.2\|70274\|33\|NZ_CP031991\|PILER-CR	70274-70306	33	MK448750	Streptococcus phage Javan393, complete genome	40047-40079	8	0.758
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	6203-6233	8	0.742
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NZ_LN868945	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 3, complete sequence	2178-2208	8	0.742
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	NZ_CP028268	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence	16655-16685	8	0.742
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MF042360	Pseudomonas phage Phabio, complete genome	227106-227136	8	0.742
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	NC_021529	Vibrio phage nt-1, complete genome	193448-193478	8	0.742
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP039706	Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence	724866-724897	8	0.75
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	493538-493569	8	0.75
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	493587-493618	8	0.75
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_AP019717	Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence	762234-762265	8	0.75
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	233862-233893	8	0.75
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NC_012782	[Eubacterium] eligens ATCC 27750 plasmid unnamed, complete sequence	48498-48529	8	0.75
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	NC_019526	Enterobacteria phage vB_KleM-RaK2, complete genome	133452-133483	8	0.75
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	MT708547	Klebsiella phage Muenster, complete genome	256186-256217	8	0.75
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	AB897757	Klebsiella phage K64-1 DNA, complete genome	133403-133434	8	0.75
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	105874-105905	8	0.75
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	MN693967	Marine virus AFVG_250M992, complete genome	26160-26191	8	0.75
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NZ_CP033935	Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence	17595-17625	9	0.71
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NZ_CP023514	Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence	105875-105905	9	0.71
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NC_048015	Cyanophage S-TIM4, complete genome	145349-145379	9	0.71
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	MH512890	Cyanophage S-TIM4	145349-145379	9	0.71
NZ_CP031991_5	5.2\|2026318\|31\|NZ_CP031991\|CRISPRCasFinder	2026318-2026348	31	NC_015283	Prochlorococcus phage P-RSM4, complete genome	145282-145312	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MN693397	Marine virus AFVG_25M279, complete genome	27311-27341	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MN693087	Marine virus AFVG_25M280, complete genome	25316-25346	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MN693388	Marine virus AFVG_25M277, complete genome	3618-3648	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MN693389	Marine virus AFVG_25M278, complete genome	1147-1177	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	MN693389	Marine virus AFVG_25M278, complete genome	31527-31557	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	KX349253	Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome	31364-31394	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	KX349251	Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome	31367-31397	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	KX349268	Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome	31370-31400	9	0.71
NZ_CP031991_5	5.4\|2026438\|31\|NZ_CP031991\|CRISPRCasFinder	2026438-2026468	31	KX349230	Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome	31711-31741	9	0.71
NZ_CP031991_5	5.5\|2026258\|32\|NZ_CP031991\|PILER-CR,CRT	2026258-2026289	32	NZ_KP342511	Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence	6202-6233	9	0.719
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	NZ_CP033935	Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence	17595-17626	9	0.719
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	NC_048015	Cyanophage S-TIM4, complete genome	145348-145379	9	0.719
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	MH512890	Cyanophage S-TIM4	145348-145379	9	0.719
NZ_CP031991_5	5.6\|2026318\|32\|NZ_CP031991\|PILER-CR,CRT	2026318-2026349	32	NC_015283	Prochlorococcus phage P-RSM4, complete genome	145281-145312	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	NZ_CP028268	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence	16654-16685	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	NC_021529	Vibrio phage nt-1, complete genome	193447-193478	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	KX349253	Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome	31363-31394	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	KX349251	Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome	31366-31397	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	KX349268	Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome	31369-31400	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	KX349230	Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome	31710-31741	9	0.719
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MF042360	Pseudomonas phage Phabio, complete genome	227106-227137	9	0.719
NZ_CP031991_1	1.2\|70274\|33\|NZ_CP031991\|PILER-CR	70274-70306	33	NZ_CP028560	Acinetobacter sp. WCHA45 plasmid pNDM1_010045, complete sequence	154638-154670	10	0.697
NZ_CP031991_1	1.2\|70274\|33\|NZ_CP031991\|PILER-CR	70274-70306	33	MK170447	Methanosarcina virus MetMV, complete genome	36281-36313	10	0.697
NZ_CP031991_5	5.1\|2026258\|31\|NZ_CP031991\|CRISPRCasFinder	2026258-2026288	31	NC_014563	Pantoea vagans C9-1 plasmid pPag2, complete sequence	127329-127359	10	0.677
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MN693397	Marine virus AFVG_25M279, complete genome	27311-27342	10	0.688
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MN693087	Marine virus AFVG_25M280, complete genome	25316-25347	10	0.688
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MN693388	Marine virus AFVG_25M277, complete genome	3618-3649	10	0.688
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MN693389	Marine virus AFVG_25M278, complete genome	1147-1178	10	0.688
NZ_CP031991_5	5.8\|2026438\|32\|NZ_CP031991\|CRT	2026438-2026469	32	MN693389	Marine virus AFVG_25M278, complete genome	31527-31558	10	0.688

1. spacer 4.1|1189513|25|NZ_CP031991|CRISPRCasFinder matches to NZ_CP018261 (Acinetobacter haemolyticus strain XH900 plasmid pXH901, complete sequence) position: , mismatch: 2, identity: 0.92

ggtaaacttatttcaggacgggaca	CRISPR spacer
tgtatacttatttcaggacgggaca	Protospacer
 *** ********************

2. spacer 4.1|1189513|25|NZ_CP031991|CRISPRCasFinder matches to NZ_CP031985 (Acinetobacter haemolyticus strain AN3 plasmid pAhaemAN3c, complete sequence) position: , mismatch: 2, identity: 0.92

ggtaaacttatttcaggacgggaca	CRISPR spacer
tgtatacttatttcaggacgggaca	Protospacer
 *** ********************

3. spacer 2.4|513416|26|NZ_CP031991|CRT matches to NC_015156 (Vibrio nigripulchritudo plasmid VIBNI_pA, complete genome) position: , mismatch: 4, identity: 0.846

caagaggactaccatcaccgccaatg	CRISPR spacer
tatcaggactatcatcaccgccaatg	Protospacer
.*  *******.**************

4. spacer 2.4|513416|26|NZ_CP031991|CRT matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.808

caagaggactaccatcaccgccaatg	CRISPR spacer
atagagaacaaccatcaccgccaatt	Protospacer
  ****.** ***************

5. spacer 2.4|513416|26|NZ_CP031991|CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.808

caagaggactaccatcaccgccaatg	CRISPR spacer
atagagaacaaccatcaccgccaatt	Protospacer
  ****.** ***************

6. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

7. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP026969 (Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

8. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

9. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

10. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

11. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

12. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

13. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

14. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 5, identity: 0.839

--aattcatgattgataagtttaaagaagaaga	CRISPR spacer
caagttc--gaatgataagtttaaagaagacga	Protospacer
  *.***  ** ****************** **

15. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to LC383633 (Staphylococcus aureus SI1 plasmid pWSI1 DNA, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

16. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP026969 (Staphylococcus aureus strain FDAARGOS_1 plasmid unnamed1) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

17. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NC_010077 (Staphylococcus aureus plasmid EDINA, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

18. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NC_018952 (Staphylococcus aureus plasmid pWBG747, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

19. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP014063 (Staphylococcus aureus strain FDAARGOS_159 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

20. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NC_013326 (Staphylococcus aureus plasmid pWBG746, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

21. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NC_013348 (Staphylococcus aureus plasmid pSK156, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

22. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_AP020312 (Staphylococcus aureus strain KUH140013 plasmid p01KUH140013, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

23. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_AP014922 (Staphylococcus aureus strain JH4899 plasmid pJSA01, complete sequence) position: , mismatch: 5, identity: 0.844

--aattcatgattgataagtttaaagaagaagat	CRISPR spacer
caagttc--gaatgataagtttaaagaagacgat	Protospacer
  *.***  ** ****************** ***

24. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_LN906635 (Lactobacillus reuteri plasmid p53608_1, complete genome, strain ATCC 53608) position: , mismatch: 6, identity: 0.806

---aattcatgattgataagtttaaagaagaaga	CRISPR spacer
ccaaa---atgattgaaaagtttaaagatgaaaa	Protospacer
   **   ******** *********** ***.*

25. spacer 1.2|70274|33|NZ_CP031991|PILER-CR matches to KU686211 (Synechococcus phage S-WAM2 isolate 0810PA29, complete genome) position: , mismatch: 7, identity: 0.788

gctttatcatttcttccatttttacttttcatc	CRISPR spacer
ggattatcatttcttccatctttacttgttaca	Protospacer
*  ****************.******* *.*.

26. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
gatggatggttgataagtttaaagaagttgg	Protospacer
.**  ***.******************  *.

27. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aagaattgattgatgagtttaaagaaaaagg	Protospacer
**    ********.***********.***.

28. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aagaattgattgatgagtttaaagaaaaagg	Protospacer
**    ********.***********.***.

29. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aagaattgattgatgagtttaaagaaaaagg	Protospacer
**    ********.***********.***.

30. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_AP019717 (Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aagaattgattgatgagtttaaagaaaaagg	Protospacer
**    ********.***********.***.

31. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to HQ634195 (Vibrio phage eugene 12A10 genomic sequence) position: , mismatch: 7, identity: 0.774

---aattcatgattgataagtttaaagaagaaga	CRISPR spacer
ttgaa---aagattaataagtttaaagaagaact	Protospacer
   **   * ****.*****************

32. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
attttttgattgatgagtttaaagatgaaat	Protospacer
* **. ********.********** ***.

33. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aatttatgattgatatgtttaaaactgaatt	Protospacer
****.********** *******.  ***

34. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aatttatgattgatatgtttaaaactgaatt	Protospacer
****.********** *******.  ***

35. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aatttatgattgatatgtttaaaactgaatt	Protospacer
****.********** *******.  ***

36. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.774

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aatttatgattgatatgtttaaaactgaatt	Protospacer
****.********** *******.  ***

37. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NC_019526 (Enterobacteria phage vB_KleM-RaK2, complete genome) position: , mismatch: 7, identity: 0.774

caacacatactcatcaagaattacttttaat	CRISPR spacer
aaaataatacttttcaagaattacttttaaa	Protospacer
 **   *****. *****************

38. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to MT708547 (Klebsiella phage Muenster, complete genome) position: , mismatch: 7, identity: 0.774

caacacatactcatcaagaattacttttaat	CRISPR spacer
aaaataatacttttcaagaattacttttaaa	Protospacer
 **   *****. *****************

39. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 7, identity: 0.774

caacacatactcatcaagaattacttttaat	CRISPR spacer
aaaataatacttttcaagaattacttttaaa	Protospacer
 **   *****. *****************

40. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to MN693967 (Marine virus AFVG_250M992, complete genome) position: , mismatch: 7, identity: 0.774

caacacatactcatcaagaattacttttaat-----	CRISPR spacer
caacacatactcatccaggatta-----aatacttg	Protospacer
*************** **.****     ***

41. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_AP014817 (Geminocystis sp. NIES-3708 plasmid pGM02, complete sequence) position: , mismatch: 7, identity: 0.781

aattcatga--ttgataagtttaaagaagaagat	CRISPR spacer
--ttagtaacgttgatcagttaaaagaagaagat	Protospacer
  ** .*.*  ***** **** ************

42. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 7, identity: 0.781

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aatttatgattgatatgtttaaaactgaattt	Protospacer
****.********** *******.  ***  *

43. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.781

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aatttatgattgatatgtttaaaactgaattt	Protospacer
****.********** *******.  ***  *

44. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.781

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aatttatgattgatatgtttaaaactgaattt	Protospacer
****.********** *******.  ***  *

45. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.781

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aatttatgattgatatgtttaaaactgaattt	Protospacer
****.********** *******.  ***  *

46. spacer 1.2|70274|33|NZ_CP031991|PILER-CR matches to MK448750 (Streptococcus phage Javan393, complete genome) position: , mismatch: 8, identity: 0.758

gctttatcatttcttccatttttacttttcatc	CRISPR spacer
atttaatcatttcttccatttttacttgttgag	Protospacer
..** ********************** *..

47. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 8, identity: 0.742

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
aaaatcgaattgttaattttaaagaagaaga	Protospacer
**  .  .**** *** **************

48. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NZ_LN868945 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 3, complete sequence) position: , mismatch: 8, identity: 0.742

caacacatactcatcaagaattacttttaat	CRISPR spacer
aataacatactcatcaagaattaattcttcc	Protospacer
 *  ******************* **.*  .

49. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP028268 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
tccaattgtagctgtatcagtagccactgaa	Protospacer
*    ************* *******.**

50. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 8, identity: 0.742

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
aaactttgaagctgtatttgtagctacccct	Protospacer
 ******* ********.******.*.. .*

51. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to NC_021529 (Vibrio phage nt-1, complete genome) position: , mismatch: 8, identity: 0.742

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
aatctttgtagatgtatttgtagccaaattc	Protospacer
 * ******** *****.********   *.

52. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP039706 (Clostridium butyricum strain 4-1 plasmid p-butyl_plas_4-1, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aagaattgattgatgagtttaaagaaaaaggc	Protospacer
**    ********.***********.***..

53. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aagaattgattgatgagtttaaagaaaaaggc	Protospacer
**    ********.***********.***..

54. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aagaattgattgatgagtttaaagaaaaaggc	Protospacer
**    ********.***********.***..

55. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_AP019717 (Clostridium butyricum strain NBRC 13949 plasmid pCBU1, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aagaattgattgatgagtttaaagaaaaaggc	Protospacer
**    ********.***********.***..

56. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
attttttgattgatgagtttaaagatgaaata	Protospacer
* **. ********.********** ***.

57. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NC_012782 ([Eubacterium] eligens ATCC 27750 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
tagctaagtttgataagtttatagaagaaaat	Protospacer
 * ..* * ************ *******.**

58. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to NC_019526 (Enterobacteria phage vB_KleM-RaK2, complete genome) position: , mismatch: 8, identity: 0.75

caacacatactcatcaagaattacttttaatt	CRISPR spacer
aaaataatacttttcaagaattacttttaaac	Protospacer
 **   *****. ***************** .

59. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to MT708547 (Klebsiella phage Muenster, complete genome) position: , mismatch: 8, identity: 0.75

caacacatactcatcaagaattacttttaatt	CRISPR spacer
aaaataatacttttcaagaattacttttaaac	Protospacer
 **   *****. ***************** .

60. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 8, identity: 0.75

caacacatactcatcaagaattacttttaatt	CRISPR spacer
aaaataatacttttcaagaattacttttaaac	Protospacer
 **   *****. ***************** .

61. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

caacacatactcatcaagaattacttttaatt--	CRISPR spacer
ttacacctactcatcaagaatt--tctgaaataa	Protospacer
. **** ***************  *.* ** *

62. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to MN693967 (Marine virus AFVG_250M992, complete genome) position: , mismatch: 8, identity: 0.75

caacacatactcatcaagaattacttttaatt-----	CRISPR spacer
caacacatactcatccaggatta-----aatacttgg	Protospacer
*************** **.****     ***

63. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP033935 (Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

caacacatactcatcaagaattacttttaat	CRISPR spacer
gtggtcatactcatcaagaattttttttgtt	Protospacer
  .  ***************** .****. *

64. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NZ_CP023514 (Enterococcus sp. FDAARGOS_375 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

caacacatactcatcaagaattacttttaat	CRISPR spacer
ttacacctactcatcaagaatttctgaaata	Protospacer
. **** *************** **   *

65. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NC_048015 (Cyanophage S-TIM4, complete genome) position: , mismatch: 9, identity: 0.71

caacacatactcatcaagaattacttttaat	CRISPR spacer
gttttcatactcatcatgatttacttttctt	Protospacer
   . *********** ** ********  *

66. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to MH512890 (Cyanophage S-TIM4) position: , mismatch: 9, identity: 0.71

caacacatactcatcaagaattacttttaat	CRISPR spacer
gttttcatactcatcatgatttacttttctt	Protospacer
   . *********** ** ********  *

67. spacer 5.2|2026318|31|NZ_CP031991|CRISPRCasFinder matches to NC_015283 (Prochlorococcus phage P-RSM4, complete genome) position: , mismatch: 9, identity: 0.71

caacacatactcatcaagaattacttttaat	CRISPR spacer
gttttcatactcatcatgatttacttttctt	Protospacer
   . *********** ** ********  *

68. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MN693397 (Marine virus AFVG_25M279, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
gccacttgtacctgtaactgtagccatttta	Protospacer
    .***** ***** *********** *

69. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MN693087 (Marine virus AFVG_25M280, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
gccacttgtacctgtaactgtagccatttta	Protospacer
    .***** ***** *********** *

70. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MN693388 (Marine virus AFVG_25M277, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
gccacttgtacctgtaactgtagccatttta	Protospacer
    .***** ***** *********** *

71. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
gccacttgtacctgtaactgtagccatttta	Protospacer
    .***** ***** *********** *

72. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
gccacttgtacctgtaactgtagccattttg	Protospacer
    .***** ***** *********** *

73. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to KX349253 (Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaact	Protospacer
.** ******* ************    ..*

74. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to KX349251 (Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaact	Protospacer
.** ******* ************    ..*

75. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to KX349268 (Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaact	Protospacer
.** ******* ************    ..*

76. spacer 5.4|2026438|31|NZ_CP031991|CRISPRCasFinder matches to KX349230 (Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome) position: , mismatch: 9, identity: 0.71

taactttgtagctgtatctgtagccattgtt	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaact	Protospacer
.** ******* ************    ..*

77. spacer 5.5|2026258|32|NZ_CP031991|PILER-CR,CRT matches to NZ_KP342511 (Enterococcus faecium isolate N12-493 plasmid pEfm12493, complete sequence) position: , mismatch: 9, identity: 0.719

aattcatgattgataagtttaaagaagaagat	CRISPR spacer
aaaatcgaattgttaattttaaagaagaagaa	Protospacer
**  .  .**** *** **************

78. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to NZ_CP033935 (Chryseobacterium balustinum strain KC_1863 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

caacacatactcatcaagaattacttttaatt	CRISPR spacer
gtggtcatactcatcaagaattttttttgttt	Protospacer
  .  ***************** .****. **

79. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to NC_048015 (Cyanophage S-TIM4, complete genome) position: , mismatch: 9, identity: 0.719

caacacatactcatcaagaattacttttaatt	CRISPR spacer
gttttcatactcatcatgatttacttttcttt	Protospacer
   . *********** ** ********  **

80. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to MH512890 (Cyanophage S-TIM4) position: , mismatch: 9, identity: 0.719

caacacatactcatcaagaattacttttaatt	CRISPR spacer
gttttcatactcatcatgatttacttttcttt	Protospacer
   . *********** ** ********  **

81. spacer 5.6|2026318|32|NZ_CP031991|PILER-CR,CRT matches to NC_015283 (Prochlorococcus phage P-RSM4, complete genome) position: , mismatch: 9, identity: 0.719

caacacatactcatcaagaattacttttaatt	CRISPR spacer
gttttcatactcatcatgatttacttttcttt	Protospacer
   . *********** ** ********  **

82. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to NZ_CP028268 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
tccaattgtagctgtatcagtagccactgaaa	Protospacer
*    ************* *******.**  .

83. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to NC_021529 (Vibrio phage nt-1, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
aatctttgtagatgtatttgtagccaaattca	Protospacer
 * ******** *****.********   *..

84. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to KX349253 (Synechococcus phage S-RIM2 isolate Np_33_0912, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaactg	Protospacer
.** ******* ************    ..**

85. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to KX349251 (Synechococcus phage S-RIM2 isolate Np_24_1112, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaactg	Protospacer
.** ******* ************    ..**

86. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to KX349268 (Synechococcus phage S-RIM2 isolate RW_30_0905, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaactg	Protospacer
.** ******* ************    ..**

87. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to KX349230 (Synechococcus phage S-RIM2 isolate LIS_02_1013, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
caagtttgtagatgtatctgtagcgtgaactg	Protospacer
.** ******* ************    ..**

88. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MF042360 (Pseudomonas phage Phabio, complete genome) position: , mismatch: 9, identity: 0.719

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
aaactttgaagctgtatttgtagctaccccta	Protospacer
 ******* ********.******.*.. .*.

89. spacer 1.2|70274|33|NZ_CP031991|PILER-CR matches to NZ_CP028560 (Acinetobacter sp. WCHA45 plasmid pNDM1_010045, complete sequence) position: , mismatch: 10, identity: 0.697

gctttatcatttcttccatttttacttttcatc	CRISPR spacer
gctttatcatttcgtccgtttttaacgaggagg	Protospacer
************* ***.****** .    *

90. spacer 1.2|70274|33|NZ_CP031991|PILER-CR matches to MK170447 (Methanosarcina virus MetMV, complete genome) position: , mismatch: 10, identity: 0.697

gctttatcatttcttccatttttacttttcatc-------	CRISPR spacer
cctttatcttttcttccgtttttac-------cggggtaa	Protospacer
 ******* ********.*******       *

91. spacer 5.1|2026258|31|NZ_CP031991|CRISPRCasFinder matches to NC_014563 (Pantoea vagans C9-1 plasmid pPag2, complete sequence) position: , mismatch: 10, identity: 0.677

aattcatgattgataagtttaaagaagaaga	CRISPR spacer
cgaatatgattgataactttaaagaagttac	Protospacer
 .  .*********** **********  .

92. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MN693397 (Marine virus AFVG_25M279, complete genome) position: , mismatch: 10, identity: 0.688

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
gccacttgtacctgtaactgtagccattttat	Protospacer
    .***** ***** *********** *

93. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MN693087 (Marine virus AFVG_25M280, complete genome) position: , mismatch: 10, identity: 0.688

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
gccacttgtacctgtaactgtagccattttat	Protospacer
    .***** ***** *********** *

94. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MN693388 (Marine virus AFVG_25M277, complete genome) position: , mismatch: 10, identity: 0.688

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
gccacttgtacctgtaactgtagccattttat	Protospacer
    .***** ***** *********** *

95. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 10, identity: 0.688

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
gccacttgtacctgtaactgtagccattttat	Protospacer
    .***** ***** *********** *

96. spacer 5.8|2026438|32|NZ_CP031991|CRT matches to MN693389 (Marine virus AFVG_25M278, complete genome) position: , mismatch: 10, identity: 0.688

taactttgtagctgtatctgtagccattgttg	CRISPR spacer
gccacttgtacctgtaactgtagccattttgt	Protospacer
    .***** ***** *********** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

74612 : 126260

Faecalibacterium_phage(23.08%)

tRNA,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010326927.1\|74612_75638_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_160140320.1\|76243_77333_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004683633.1\|78102_79707_-	hypothetical protein	NA	NA	NA	NA
WP_004683632.1\|79699_81223_-	TniQ family protein	NA	NA	NA	NA
WP_004683630.1\|81236_82883_-	AAA family ATPase	NA	NA	NA	NA
WP_010326927.1\|84161_85187_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_004683627.1\|86044_86878_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_008942100.1\|87031_88870_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7J689	Paramecium_bursaria_Chlorella_virus	5.4e-127	44.5
WP_008942101.1\|88882_90247_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L821	Tupanvirus	1.0e-29	33.5
WP_008942102.1\|90269_90791_-	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_008942103.1\|90768_91686_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_004679125.1\|91700_92150_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_004637206.1\|92153_92624_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.1e-31	52.0
WP_008942104.1\|92635_93757_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.4e-56	36.2
WP_004637204.1\|94041_95316_-	hypothetical protein	NA	NA	NA	NA
WP_005087273.1\|95402_96623_+	phosphoserine phosphatase SerB	NA	NA	NA	NA
WP_004637201.1\|97030_97366_+	hypothetical protein	NA	NA	NA	NA
WP_004637199.1\|97508_97988_+	hypothetical protein	NA	NA	NA	NA
WP_008942106.1\|98093_98534_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_008942107.1\|98687_99893_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.1e-43	33.8
WP_008942108.1\|99995_100844_+	sulfurtransferase	NA	NA	NA	NA
WP_008942109.1\|100840_101692_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_079283381.1\|102756_103782_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_008942111.1\|104013_104313_-	hypothetical protein	NA	NA	NA	NA
WP_004641656.1\|104685_104895_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.5e-17	61.4
WP_004641653.1\|105411_106302_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017396432.1\|106396_106849_+	PACE efflux transporter	NA	NA	NA	NA
WP_004641648.1\|106915_108271_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	7.0e-31	32.1
WP_004641646.1\|108279_108990_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	2.3e-33	36.7
WP_008942114.1\|109240_109918_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005088723.1\|110222_111050_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_008942115.1\|111096_112464_-	MATE family efflux transporter	NA	NA	NA	NA
WP_008942116.1\|112564_113719_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_008942117.1\|114038_114479_+	hypothetical protein	NA	NA	NA	NA
WP_008942118.1\|114578_115886_-	DUF445 domain-containing protein	NA	NA	NA	NA
WP_004641631.1\|115903_116461_-	hypothetical protein	NA	NA	NA	NA
WP_004641629.1\|116487_117027_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	3.1e-22	36.4
WP_017396323.1\|117210_118788_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_005088717.1\|118859_119357_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_004641622.1\|119415_120762_-	hypothetical protein	NA	NA	NA	NA
WP_160140321.1\|121024_121633_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_004641617.1\|121629_123513_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	6.4e-99	35.6
WP_160140322.1\|123737_125078_+	MATE family efflux transporter	NA	NA	NA	NA
WP_076612069.1\|125170_126260_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

132227 : 184456

Bacillus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160140320.1\|132227_133318_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_160140324.1\|133796_134729_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	7.1e-59	41.2
WP_160140325.1\|135274_136012_-	hypothetical protein	NA	NA	NA	NA
WP_160140326.1\|136092_136641_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017396331.1\|136965_137691_-	ion channel protein Tsx	NA	NA	NA	NA
WP_004641598.1\|138059_138419_+	HPF/RaiA family ribosome-associated protein	NA	NA	NA	NA
WP_004641595.1\|138558_139104_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_171502757.1\|139134_139902_+	transporter	NA	NA	NA	NA
WP_160140328.1\|139979_141833_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_160140329.1\|141835_142531_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_017396427.1\|142572_143760_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-21	34.9
WP_005087216.1\|144042_144954_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_005087215.1\|145143_145581_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004641582.1\|145644_145995_-	arsenate reductase	NA	NA	NA	NA
WP_008942133.1\|146434_147259_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_004641579.1\|147300_147951_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_160140331.1\|148543_149263_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_125316763.1\|149541_150706_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_160140332.1\|150657_151356_-	hypothetical protein	NA	NA	NA	NA
WP_160140449.1\|151358_152261_-	DUF4747 family protein	NA	NA	NA	NA
WP_005087201.1\|152483_152936_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_160140333.1\|153115_153598_+	redoxin domain-containing protein	A0A1S7DM81	Molluscum_contagiosum_virus	1.7e-11	31.2
WP_160140334.1\|153823_154768_+	glutathione synthase	NA	NA	NA	NA
WP_160140335.1\|155019_156117_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_005088688.1\|156130_157576_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_160140336.1\|157615_158542_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_005087191.1\|158546_159404_+	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_004641555.1\|159469_160732_+	cell division protein FtsA	NA	NA	NA	NA
WP_076612069.1\|160875_161966_-\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_151211472.1\|162186_163362_+	cell division protein FtsZ	NA	NA	NA	NA
WP_004641551.1\|163528_164431_+	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_004641549.1\|164529_164970_-	hypothetical protein	NA	NA	NA	NA
WP_004641547.1\|165076_165760_+	M23 family metallopeptidase	G3MBP9	Bacillus_virus	2.4e-19	40.1
WP_005087187.1\|165965_168683_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_160140337.1\|168685_170653_+	2-oxo acid dehydrogenase subunit E2	NA	NA	NA	NA
WP_005087184.1\|170792_171074_+	hypothetical protein	NA	NA	NA	NA
WP_008942147.1\|171335_171911_+	TMEM165/GDT1 family protein	NA	NA	NA	NA
WP_160140338.1\|172014_174138_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_004641535.1\|174359_175166_+	FprA family A-type flavoprotein	NA	NA	NA	NA
WP_160140339.1\|175290_175656_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_004641532.1\|175795_177262_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.7e-89	39.4
WP_004641530.1\|177388_178726_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_160140340.1\|178738_179395_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
WP_160140341.1\|179395_181096_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	9.3e-65	30.9
WP_160140342.1\|181167_182545_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.7e-75	53.9
WP_160140343.1\|182612_183533_-	putative porin	NA	NA	NA	NA
WP_017395860.1\|183621_184026_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_017395859.1\|184117_184456_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

212262 : 263994

Acinetobacter_phage(25.0%)

integrase,transposase

attL 233370:233384|attR 269299:269313

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_125316763.1\|212262_213428_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_160140344.1\|214554_216030_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_076612069.1\|216436_217526_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_125316907.1\|219339_219756_+	hypothetical protein	NA	NA	NA	NA
WP_017396150.1\|219891_220050_+	hypothetical protein	NA	NA	NA	NA
WP_125316908.1\|220024_220399_+	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_125316909.1\|220465_220645_+	hypothetical protein	NA	NA	NA	NA
WP_125316763.1\|220726_221891_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_151800621.1\|223527_228471_+	DEAD/DEAH box helicase family protein	A0A2H4UTW8	Bodo_saltans_virus	1.1e-36	26.7
WP_151800620.1\|229184_230384_+	reverse transcriptase	NA	NA	NA	NA
WP_107908897.1\|230392_230944_-	recombinase family protein	E5FFF9	Burkholderia_phage	3.1e-46	52.2
233370:233384	attL	NA	NA	NA	NA
WP_125316797.1\|234395_235391_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_125316798.1\|235399_236686_+	DegT/DnrJ/EryC1/StrS family aminotransferase	NA	NA	NA	NA
WP_160140345.1\|236734_237916_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_125316800.1\|237917_239075_+	hypothetical protein	NA	NA	NA	NA
WP_118903275.1\|239283_240231_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_118903277.1\|240310_240487_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_118903279.1\|240643_242212_+\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	4.5e-21	26.5
WP_118903281.1\|242204_242942_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.2e-19	28.6
WP_100223916.1\|243553_244719_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.4e-50	39.2
WP_017396719.1\|245343_246777_+	amino acid permease	NA	NA	NA	NA
WP_008941075.1\|246834_248337_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	9.2e-16	26.6
WP_008941076.1\|248491_249784_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.3e-26	28.6
WP_008941077.1\|249780_251229_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_171057917.1\|251291_252272_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004641467.1\|252295_252922_-	hydrolase	NA	NA	NA	NA
WP_005088628.1\|253207_254068_+	pirin family protein	NA	NA	NA	NA
WP_005088626.1\|254503_255802_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008941079.1\|255803_256631_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_125316763.1\|257927_259093_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_005088612.1\|259641_260079_-	hypothetical protein	NA	NA	NA	NA
WP_005088610.1\|260075_261938_-	DEAD/DEAH box helicase family protein	A0A0K1LKN7	Rhodobacter_phage	2.5e-10	22.8
WP_160124150.1\|262041_262527_-	hypothetical protein	NA	NA	NA	NA
WP_017396498.1\|262794_263994_-\|integrase	tyrosine-type recombinase/integrase	B7SYF8	Stenotrophomonas_phage	4.7e-79	41.7
269299:269313	attR	NA	NA	NA	NA

DBSCAN-SWA_4

543630 : 594485

Bacillus_virus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008941235.1\|543630_544941_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-126	53.5
WP_004640925.1\|545101_545818_+	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_008941237.1\|545886_547143_-	hypothetical protein	NA	NA	NA	NA
WP_008941238.1\|547293_548820_-	fumarate hydratase	NA	NA	NA	NA
WP_008941239.1\|549002_549863_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004640918.1\|550042_550951_+	DMT family transporter	NA	NA	NA	NA
WP_017396528.1\|550981_551587_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_008941241.1\|551682_553002_-	MFS transporter	NA	NA	NA	NA
WP_008941242.1\|553025_555158_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_004640913.1\|555184_556360_-	acetate kinase	NA	NA	NA	NA
WP_004640911.1\|556662_557928_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	7.6e-96	47.3
WP_076612069.1\|558280_559370_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_161412355.1\|559488_560775_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_005086744.1\|560846_561689_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_005086742.1\|561977_563000_-	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_004640902.1\|563248_565432_+	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.5e-176	47.7
WP_115736073.1\|565532_566757_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1
WP_004640900.1\|566821_567265_-	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004640897.1\|567353_568022_-	LrgB family protein	NA	NA	NA	NA
WP_004640895.1\|568032_568395_-	hypothetical protein	NA	NA	NA	NA
WP_008941244.1\|568469_569807_-	GTPase HflX	NA	NA	NA	NA
WP_004640892.1\|569881_570022_-	hypothetical protein	NA	NA	NA	NA
WP_005088259.1\|570221_571052_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_005088257.1\|571044_572673_-	phospholipase D family protein	NA	NA	NA	NA
WP_005088255.1\|572774_573785_+	metallophosphoesterase	NA	NA	NA	NA
WP_005088253.1\|573841_574321_-	OmpA family protein	NA	NA	NA	NA
WP_005086724.1\|574329_575553_-	diguanylate cyclase	NA	NA	NA	NA
WP_005088251.1\|575558_576020_-	YfiR family protein	NA	NA	NA	NA
WP_005089101.1\|582067_583144_+	AI-2E family transporter	NA	NA	NA	NA
WP_005089103.1\|583346_584510_+	acyl-CoA dehydrogenase family protein	NA	NA	NA	NA
WP_005089105.1\|584523_584928_-	hypothetical protein	NA	NA	NA	NA
WP_005089107.1\|584993_585503_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004669660.1\|585499_586099_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_115736361.1\|586290_588096_+	DUF1446 domain-containing protein	NA	NA	NA	NA
WP_115736362.1\|588114_589041_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_160140349.1\|589670_590459_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.4e-42	40.2
WP_004678526.1\|590445_591147_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_115736364.1\|592469_593306_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_160140320.1\|593394_594485_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

824514 : 936752

Enterobacteria_phage(22.22%)

protease,integrase,tRNA,transposase

attL 903286:903301|attR 941813:941828

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160140324.1\|824514_825447_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	7.1e-59	41.2
WP_017396747.1\|825454_826222_-	hypothetical protein	NA	NA	NA	NA
WP_017394993.1\|826281_829179_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	5.3e-145	36.9
WP_017394992.1\|829430_830111_+	hypothetical protein	NA	NA	NA	NA
WP_017394991.1\|830235_830898_+	hypothetical protein	NA	NA	NA	NA
WP_017394990.1\|830910_831717_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_171502758.1\|831912_832095_+	hypothetical protein	NA	NA	NA	NA
WP_017394988.1\|832140_832581_-	heavy metal-binding domain-containing protein	NA	NA	NA	NA
WP_005083051.1\|832590_832941_-	YbjQ family protein	NA	NA	NA	NA
WP_004640437.1\|833051_834509_-	multidrug efflux RND transporter AdeIJK outer membrane channel subunit AdeK	NA	NA	NA	NA
WP_004640435.1\|834508_837685_-	multidrug efflux RND transporter permease subunit AdeJ	NA	NA	NA	NA
WP_005083049.1\|837697_838921_-	AdeA/AdeI family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005083047.1\|838907_839558_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_004640429.1\|839719_841762_-	site-specific recombinase	NA	NA	NA	NA
WP_005083044.1\|841775_842753_-	polyprenyl synthetase family protein	NA	NA	NA	NA
WP_005083041.1\|843200_843512_+	50S ribosomal protein L21	NA	NA	NA	NA
WP_004640422.1\|843530_843785_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_026070327.1\|843850_844720_-	pirin family protein	NA	NA	NA	NA
WP_017394986.1\|845012_845708_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_017394985.1\|845826_846591_+	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_004640409.1\|846693_847965_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-93	45.8
WP_017394984.1\|848032_849409_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_005083031.1\|849555_850026_+\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_004640404.1\|850039_850420_-	VOC family protein	NA	NA	NA	NA
WP_004640401.1\|850435_850816_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004640399.1\|850932_851490_+	flavodoxin family protein	NA	NA	NA	NA
WP_005089425.1\|851551_852964_-	APC family permease	NA	NA	NA	NA
WP_017394982.1\|853249_854434_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_005083027.1\|854436_854970_-	hypothetical protein	NA	NA	NA	NA
WP_017394981.1\|855052_855706_-	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_005083022.1\|855878_856166_-	DUF493 domain-containing protein	NA	NA	NA	NA
WP_004640390.1\|856304_858185_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.1e-39	34.1
WP_004640386.1\|858528_858735_+	hypothetical protein	NA	NA	NA	NA
WP_004640385.1\|858807_859332_+	YecA family protein	NA	NA	NA	NA
WP_017394980.1\|859459_860065_-	LysE family translocator	NA	NA	NA	NA
WP_017394979.1\|860167_861043_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005089432.1\|861114_861765_-	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_005083015.1\|861780_862401_-	DedA family protein	NA	NA	NA	NA
WP_004640374.1\|862538_863471_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_005089435.1\|863581_864070_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_004640370.1\|864136_865411_-	citrate (Si)-synthase	NA	NA	NA	NA
WP_004640364.1\|866313_866715_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_005083003.1\|866714_867080_+	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_026056325.1\|867089_868985_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_005083000.1\|868999_869710_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_004640354.1\|870405_873258_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
WP_004640352.1\|873257_874445_+	2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
WP_004640350.1\|874504_875938_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-40	26.5
WP_004640348.1\|876074_877241_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_004640347.1\|877253_878144_+	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	4.9e-17	31.6
WP_076612069.1\|878527_879617_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_005091342.1\|880030_881071_+\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	7.7e-171	82.7
WP_005089440.1\|881352_883065_-	flotillin family protein	NA	NA	NA	NA
WP_017395176.1\|883099_883744_-	YqiJ family protein	NA	NA	NA	NA
WP_079283381.1\|883856_884882_+\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_004640323.1\|885248_886262_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_004640320.1\|886430_887348_+	DUF808 domain-containing protein	NA	NA	NA	NA
WP_017395177.1\|887391_888282_+	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	2.9e-33	37.3
WP_005064486.1\|890695_891628_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.0e-60	41.9
WP_020846310.1\|891910_892843_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_017394871.1\|893190_893892_+	hypothetical protein	NA	NA	NA	NA
WP_017394872.1\|893907_894645_-\|protease	metalloprotease	NA	NA	NA	NA
WP_017394873.1\|894727_895042_+	MGMT family protein	NA	NA	NA	NA
WP_004640302.1\|895221_895659_-	universal stress protein	NA	NA	NA	NA
WP_004640300.1\|895884_896511_-	CatB-related O-acetyltransferase	NA	NA	NA	NA
WP_125316763.1\|896774_897939_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_004640296.1\|898166_898643_-	transcription elongation factor GreA	NA	NA	NA	NA
WP_005084359.1\|898735_901969_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_004640293.1\|901983_903123_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	NA	NA	NA	NA
903286:903301	attL	NA	NA	NA	NA
WP_004640291.1\|903483_904026_+	hypothetical protein	NA	NA	NA	NA
WP_004640289.1\|904074_904611_-	DOMON-like domain-containing protein	NA	NA	NA	NA
WP_004640287.1\|904616_904943_-	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_008941571.1\|905207_905858_+	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_004640283.1\|905995_907891_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	2.6e-108	46.8
WP_017394875.1\|908024_908915_+	dihydropteroate synthase	NA	NA	NA	NA
WP_076612069.1\|908994_910085_-\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_017394876.1\|910189_910948_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_008941568.1\|911066_912677_+	VWA domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|913351_914284_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_017395170.1\|917458_918172_-	DMT family transporter	NA	NA	NA	NA
WP_026070343.1\|918620_919223_+	nicotinamide mononucleotide transporter	A0A0S1S1B4	Klebsiella_phage	5.7e-09	26.9
WP_017395172.1\|919272_920412_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_017395173.1\|920618_922232_-	phosphoethanolamine transferase	NA	NA	NA	NA
WP_008941561.1\|922573_925675_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_004640257.1\|925954_927292_+	magnesium transporter	NA	NA	NA	NA
WP_004640255.1\|927368_927947_+	DUF4112 domain-containing protein	NA	NA	NA	NA
WP_004640254.1\|928010_928916_-\|protease	protease HtpX	NA	NA	NA	NA
WP_161414322.1\|929133_929910_-	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	9.2e-36	53.7
WP_004640251.1\|930493_931399_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.1e-91	64.2
WP_076612069.1\|931524_932614_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_004640249.1\|932784_933168_+	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_005084391.1\|933214_934324_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_008941558.1\|934698_935175_+	transcription elongation factor GreB	NA	NA	NA	NA
WP_005089480.1\|935540_936752_+\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.7e-65	39.0
941813:941828	attR	NA	NA	NA	NA

DBSCAN-SWA_6

981139 : 1016990

Enterobacteria_phage(40.0%)

integrase,transposase

attL 985893:985909|attR 1004890:1004906

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076612069.1\|981139_982230_-\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_171061200.1\|982271_982610_+	restriction endonuclease subunit S	NA	NA	NA	NA
985893:985909	attL	NA	NA	NA	NA
WP_005324694.1\|985947_986880_+\|transposase	IS5-like element ISAba13 family transposase	Q1MVF0	Enterobacteria_phage	1.4e-54	39.6
WP_005324696.1\|987109_987340_+	AlpA family transcriptional regulator	NA	NA	NA	NA
WP_005324697.1\|987643_988516_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_005324702.1\|988531_989884_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	4.9e-149	67.1
WP_100223928.1\|989915_990506_-	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	4.9e-21	54.2
WP_005324707.1\|990572_990956_-	pyrimidine utilization protein C	NA	NA	NA	NA
WP_005324717.1\|991002_991755_-	pyrimidine utilization protein B	NA	NA	NA	NA
WP_005064337.1\|991751_992870_-	pyrimidine utilization protein A	NA	NA	NA	NA
WP_005324718.1\|993229_993817_-	malonic semialdehyde reductase	NA	NA	NA	NA
WP_005324720.1\|993813_994620_-	pyrimidine utilization protein D	NA	NA	NA	NA
WP_100223929.1\|995746_996475_+	ATP-binding protein	NA	NA	NA	NA
WP_017395975.1\|996725_998003_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	8.3e-74	38.1
WP_160140450.1\|998212_998587_-\|transposase	transposase	Q8W6R2	Burkholderia_virus	2.9e-11	41.2
WP_125316763.1\|998675_999841_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_160140351.1\|999876_1000392_-	hypothetical protein	NA	NA	NA	NA
WP_004640153.1\|1000322_1000715_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_017395511.1\|1001215_1002520_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_118902211.1\|1003920_1004853_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.5e-59	41.2
WP_004640243.1\|1006172_1007132_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
1004890:1004906	attR	NA	NA	NA	NA
WP_008941712.1\|1007134_1007902_+	OmpA family protein	NA	NA	NA	NA
WP_004640238.1\|1007931_1008195_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_008941713.1\|1008315_1009086_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008941714.1\|1009082_1009778_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_008941715.1\|1009774_1010392_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.4e-16	32.8
WP_008941716.1\|1010404_1011739_-	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	1.5e-30	67.4
WP_171057901.1\|1011964_1013005_+	taurine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_008941718.1\|1013014_1013806_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.6e-30	37.3
WP_005084443.1\|1013802_1014684_+	taurine ABC transporter permease TauC	NA	NA	NA	NA
WP_005084445.1\|1014714_1015560_+	taurine dioxygenase	NA	NA	NA	NA
WP_160140320.1\|1015900_1016990_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1052995 : 1086752

Enterobacteria_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020846310.1\|1052995_1053928_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_004777298.1\|1054168_1055248_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	9.1e-90	49.2
WP_004757630.1\|1055322_1055466_-	hypothetical protein	NA	NA	NA	NA
WP_017395188.1\|1055501_1056440_-	hypothetical protein	NA	NA	NA	NA
WP_004640146.1\|1056648_1057119_+	YaiI/YqxD family protein	NA	NA	NA	NA
WP_017395187.1\|1057126_1058020_+	EamA family transporter	NA	NA	NA	NA
WP_004640143.1\|1058034_1058619_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_005084477.1\|1058644_1059880_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_004640139.1\|1059872_1060559_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	2.9e-33	37.8
WP_026070345.1\|1060642_1063081_+	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	8.8e-16	45.9
WP_017395185.1\|1063069_1064026_-	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_005089605.1\|1064165_1065188_+	signal peptide peptidase SppA	A0A2I6UH21	Salinibacter_virus	5.0e-13	27.2
WP_017395184.1\|1065333_1066125_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_171061179.1\|1066164_1066794_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.8e-29	38.4
WP_017395182.1\|1066790_1067861_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	1.6e-78	46.7
WP_005089613.1\|1067994_1069191_+	AI-2E family transporter	NA	NA	NA	NA
WP_004640121.1\|1069211_1069910_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_020846310.1\|1070367_1071300_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_080596003.1\|1071310_1072435_+	rhombotarget A	NA	NA	NA	NA
WP_160140352.1\|1072464_1073397_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.7e-58	41.2
WP_151800552.1\|1073438_1073732_+	hypothetical protein	NA	NA	NA	NA
WP_121533679.1\|1073693_1074260_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_004973749.1\|1074249_1074705_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_004640116.1\|1076888_1077278_-	DUF3106 domain-containing protein	NA	NA	NA	NA
WP_004640114.1\|1077267_1077591_-	hypothetical protein	NA	NA	NA	NA
WP_004640112.1\|1077583_1078195_-	RNA polymerase sigma factor	NA	NA	NA	NA
WP_004640110.1\|1078353_1079130_-	RNA methyltransferase	NA	NA	NA	NA
WP_005089620.1\|1079181_1080156_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	7.3e-46	35.5
WP_004640107.1\|1080332_1080521_+	hypothetical protein	NA	NA	NA	NA
WP_004641816.1\|1080561_1081125_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_004641814.1\|1081147_1082431_-	Tol-Pal system beta propeller repeat protein TolB	NA	NA	NA	NA
WP_151800549.1\|1082530_1083679_-	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_004640103.1\|1083682_1084135_-	protein TolR	NA	NA	NA	NA
WP_004640101.1\|1084134_1084833_-	protein TolQ	NA	NA	NA	NA
WP_004640100.1\|1084852_1085266_-	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
WP_017395859.1\|1085917_1086256_-\|transposase	transposase	NA	NA	NA	NA
WP_017395860.1\|1086347_1086752_-\|transposase	transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_8

1096090 : 1224835

115

Streptococcus_phage(12.12%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160140320.1\|1096090_1097180_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_125316763.1\|1097241_1098407_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_171057131.1\|1098994_1099288_+	NGG1p interacting factor NIF3	NA	NA	NA	NA
WP_151800641.1\|1099289_1100054_-	nitroreductase family protein	NA	NA	NA	NA
WP_076612069.1\|1100168_1101259_-\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_017394935.1\|1101434_1103156_-	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_017394934.1\|1103142_1104093_-	1-phosphofructokinase	NA	NA	NA	NA
WP_017394933.1\|1104085_1106938_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.0e-10	28.7
WP_005089648.1\|1107226_1108027_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_161401498.1\|1108135_1108711_+	nicotinate-nicotinamide nucleotide adenylyltransferase	A0A0X8WP26	Ralstonia_phage	4.5e-19	31.3
WP_005089651.1\|1108728_1109649_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017394932.1\|1109774_1109993_+	2-hydroxymuconate tautomerase family protein	NA	NA	NA	NA
WP_017394931.1\|1109994_1110372_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_004640067.1\|1110381_1110744_-	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
WP_017394928.1\|1111446_1112604_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004640063.1\|1112732_1113197_-	peroxiredoxin	NA	NA	NA	NA
WP_017394927.1\|1113200_1113893_-	diphthine--ammonia ligase	NA	NA	NA	NA
WP_026070319.1\|1113990_1114413_-	hypothetical protein	NA	NA	NA	NA
WP_026070318.1\|1114443_1115124_-	7-cyano-7-deazaguanine synthase QueC	M1PKZ7	Cellulophaga_phage	1.7e-30	37.9
WP_017394497.1\|1115187_1115898_-	7-carboxy-7-deazaguanine synthase QueE	J9PV61	Bacillus_phage	2.7e-34	36.1
WP_004640056.1\|1116054_1116876_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_017394924.1\|1117171_1117924_+	ornithine uptake porin CarO type 5	NA	NA	NA	NA
WP_005084556.1\|1118020_1118944_-	CysB family HTH-type transcriptional regulator	NA	NA	NA	NA
WP_004640050.1\|1119100_1120174_-	sulfate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-31	37.1
WP_005084559.1\|1120178_1121063_-	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
WP_171055805.1\|1121059_1121872_-	sulfate ABC transporter permease subunit CysT	NA	NA	NA	NA
WP_008941789.1\|1121964_1122567_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_017394923.1\|1122603_1123605_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017394921.1\|1123855_1124668_+	aminodeoxychorismate lyase	NA	NA	NA	NA
WP_017394920.1\|1124669_1125746_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_017394919.1\|1125746_1126352_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.6e-35	42.1
WP_026070317.1\|1126447_1127287_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_017394917.1\|1127283_1127982_+	hypothetical protein	NA	NA	NA	NA
WP_100223934.1\|1129525_1129861_+	hypothetical protein	NA	NA	NA	NA
WP_100223933.1\|1130158_1130500_+	hypothetical protein	NA	NA	NA	NA
WP_171061211.1\|1130577_1131213_+	hypothetical protein	NA	NA	NA	NA
WP_171061212.1\|1131331_1132969_-	L-aspartate oxidase	NA	NA	NA	NA
WP_017396379.1\|1133312_1134689_+	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.6e-25	27.7
WP_017396378.1\|1134799_1135255_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_004640031.1\|1135408_1137226_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	2.2e-19	25.9
WP_017396377.1\|1137300_1138164_+	signal peptidase I	NA	NA	NA	NA
WP_004640026.1\|1138191_1138569_+	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_004640024.1\|1138537_1139233_+	ribonuclease III	A0A2K9R4Y7	Dishui_lake_phycodnavirus	6.8e-22	33.2
WP_005089671.1\|1139237_1140263_+	GTPase Era	NA	NA	NA	NA
WP_017396375.1\|1140488_1141196_+	DNA repair protein RecO C-terminal domain-containing protein	NA	NA	NA	NA
WP_017396374.1\|1141246_1141975_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_017396373.1\|1141979_1142636_+\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_017396372.1\|1143048_1143480_+	hypothetical protein	NA	NA	NA	NA
WP_004640010.1\|1143841_1144261_+	GFA family protein	NA	NA	NA	NA
WP_004640008.1\|1144340_1145567_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_160140320.1\|1145799_1146889_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004640006.1\|1146968_1147148_+	hypothetical protein	NA	NA	NA	NA
WP_017396371.1\|1147203_1148364_-	S8 family peptidase	A0A2K9L570	Tupanvirus	4.8e-28	37.9
WP_017396370.1\|1148481_1149276_-	hypothetical protein	A0A127KNK1	Pseudomonas_phage	1.5e-25	48.7
WP_035370230.1\|1149343_1150963_-	S8 family peptidase	A0A2K9L1P3	Tupanvirus	9.9e-32	38.6
WP_020846163.1\|1151387_1153421_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_026056254.1\|1153571_1154318_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.4e-11	31.6
WP_017396261.1\|1154382_1154967_+	lipocalin family protein	A0A2K9L662	Tupanvirus	5.0e-18	34.1
WP_160140320.1\|1155110_1156200_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_004639993.1\|1157449_1158907_+	glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_017396262.1\|1159045_1159789_+	hypothetical protein	NA	NA	NA	NA
WP_017396263.1\|1159794_1160469_+	hypothetical protein	NA	NA	NA	NA
WP_008942049.1\|1160584_1161805_+	Obg family GTPase CgtA	NA	NA	NA	NA
WP_004639988.1\|1161884_1163018_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.4e-69	41.7
WP_005089685.1\|1163088_1164726_-	iron ABC transporter permease	NA	NA	NA	NA
WP_004639985.1\|1164814_1165831_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_004639983.1\|1165855_1166977_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-28	34.0
WP_017396264.1\|1167028_1167721_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_017396265.1\|1167687_1168896_-	DUF1615 domain-containing protein	NA	NA	NA	NA
WP_017396266.1\|1168978_1170004_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_004639978.1\|1170060_1170966_-	hydrogen peroxide-inducible genes activator	NA	NA	NA	NA
WP_171061207.1\|1170972_1171872_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_017396268.1\|1172004_1173186_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000760495.1\|1173531_1173696_-	rubredoxin	NA	NA	NA	NA
WP_005084625.1\|1174048_1174486_+	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_004639969.1\|1174646_1176173_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	2.9e-89	39.4
WP_017396269.1\|1176325_1177777_+	capsule assembly Wzi family protein	NA	NA	NA	NA
WP_005089695.1\|1178103_1179012_+	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_017396270.1\|1179057_1180671_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	5.8e-40	27.4
WP_004639959.1\|1180868_1181384_+	hypothetical protein	NA	NA	NA	NA
WP_004639957.1\|1181432_1181696_+	ribosomal protein L7/L12	NA	NA	NA	NA
WP_004639956.1\|1181735_1183064_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_005084639.1\|1183169_1184159_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_026070457.1\|1184697_1186299_+	isocitrate lyase	NA	NA	NA	NA
WP_076612069.1\|1186455_1187545_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_026070458.1\|1187574_1188042_-	copper resistance protein NlpE N-terminal domain-containing protein	NA	NA	NA	NA
WP_115736073.1\|1188268_1189494_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1
WP_017395019.1\|1189778_1191200_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-54	31.7
WP_017395020.1\|1191475_1192453_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	3.1e-36	32.1
WP_004639946.1\|1192456_1192996_+	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_005084648.1\|1193040_1193589_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_005084650.1\|1193572_1194121_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_005089712.1\|1194120_1194867_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-21	26.9
WP_005089714.1\|1195056_1196592_+	TolC family protein	NA	NA	NA	NA
WP_017395023.1\|1198724_1199915_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_118902211.1\|1199922_1200855_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.5e-59	41.2
WP_017396178.1\|1201056_1201656_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.5e-21	39.7
WP_017396177.1\|1201648_1202263_+	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	8.1e-11	52.4
WP_017396176.1\|1202379_1203222_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	3.4e-36	33.9
WP_026070448.1\|1203341_1204010_-	O-methyltransferase	W8CYT3	Bacillus_phage	2.7e-23	40.2
WP_171061203.1\|1204145_1204802_-	peptidase M15	NA	NA	NA	NA
WP_004639922.1\|1204977_1205307_-	ferredoxin family protein	NA	NA	NA	NA
WP_017396173.1\|1205555_1206095_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017396172.1\|1206204_1208844_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	4.9e-36	22.0
WP_100223916.1\|1210009_1211175_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.4e-50	39.2
WP_076612069.1\|1211912_1213002_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_017395466.1\|1215046_1215724_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_017395465.1\|1215754_1216879_-	Fic family protein	NA	NA	NA	NA
WP_017395464.1\|1217807_1218026_+	hypothetical protein	NA	NA	NA	NA
WP_026056278.1\|1219494_1219722_+	hypothetical protein	NA	NA	NA	NA
WP_004639899.1\|1219866_1220097_-	hypothetical protein	NA	NA	NA	NA
WP_004639896.1\|1220387_1220999_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.8e-48	55.3
WP_017395461.1\|1221003_1222302_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	2.2e-106	46.4
WP_017395460.1\|1222468_1223569_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_100223916.1\|1223670_1224835_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.4e-50	39.2

DBSCAN-SWA_9

1285379 : 1344411

uncultured_Caudovirales_phage(22.22%)

integrase,transposase

attL 1283028:1283045|attR 1299772:1299789

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1283028:1283045	attL	NA	NA	NA	NA
WP_008941997.1\|1285379_1286402_+\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	6.4e-69	43.8
WP_008941996.1\|1286426_1286729_-	hypothetical protein	NA	NA	NA	NA
WP_008941995.1\|1286982_1287678_-	hypothetical protein	NA	NA	NA	NA
WP_017395550.1\|1288180_1289128_+	MobA/MobL family protein	NA	NA	NA	NA
WP_008941993.1\|1289220_1290075_-	hypothetical protein	A0A2H4JC99	uncultured_Caudovirales_phage	3.5e-28	32.2
WP_016541972.1\|1290058_1290406_-	hypothetical protein	NA	NA	NA	NA
WP_016653653.1\|1290909_1291263_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_017395552.1\|1292111_1292720_+	hypothetical protein	NA	NA	NA	NA
WP_017395553.1\|1292750_1294331_+	CAP domain-containing protein	NA	NA	NA	NA
WP_004682117.1\|1294347_1295589_+	sel1 repeat family protein	NA	NA	NA	NA
WP_004682116.1\|1295736_1296009_+	hypothetical protein	NA	NA	NA	NA
WP_008941961.1\|1296012_1296285_+	hypothetical protein	NA	NA	NA	NA
WP_004678526.1\|1296409_1297111_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_171402605.1\|1297101_1297959_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_017394803.1\|1298064_1298847_+	NRDE family protein	A0A0M3ZEJ9	Turkeypox_virus	7.2e-20	27.3
WP_017394804.1\|1298989_1300582_+	alkaline phosphatase	NA	NA	NA	NA
1299772:1299789	attR	NA	NA	NA	NA
WP_005088296.1\|1300602_1302138_+	alkaline phosphatase	NA	NA	NA	NA
WP_017394805.1\|1302216_1302867_+	hypothetical protein	NA	NA	NA	NA
WP_076612069.1\|1304434_1305524_+\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_080591920.1\|1306228_1306405_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_008941952.1\|1307678_1309604_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_002058090.1\|1309822_1310305_+	MSMEG_0572 family nitrogen starvation response protein	NA	NA	NA	NA
WP_002058125.1\|1310329_1311322_+	Nit6803 family nitriliase	NA	NA	NA	NA
WP_002058083.1\|1311357_1312437_+	MSMEG_0568 family radical SAM protein	NA	NA	NA	NA
WP_016541979.1\|1312447_1313011_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016541980.1\|1313010_1314057_+	sll0787 family AIR synthase-like protein	NA	NA	NA	NA
WP_008941947.1\|1314049_1314340_+	MSMEG_0570 family nitrogen starvation response protein	NA	NA	NA	NA
WP_016541981.1\|1314350_1315652_+	MSMEG_0569 family flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_017396274.1\|1315734_1315977_-	hypothetical protein	NA	NA	NA	NA
WP_076612069.1\|1319342_1320433_-\|transposase	IS4-like element ISAba33 family transposase	NA	NA	NA	NA
WP_008941939.1\|1320867_1321353_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	4.1e-42	55.4
WP_008941938.1\|1321537_1321693_-	hypothetical protein	NA	NA	NA	NA
WP_008941937.1\|1321978_1322221_-	hypothetical protein	NA	NA	NA	NA
WP_008941936.1\|1322314_1322521_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_008941935.1\|1322618_1324100_+	SAM-dependent DNA methyltransferase	J7I0U9	Acinetobacter_phage	1.3e-33	31.5
WP_008941934.1\|1324099_1325299_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_017395925.1\|1325383_1326529_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_008941922.1\|1329088_1329538_-	cyanase	NA	NA	NA	NA
WP_008303564.1\|1329818_1330628_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_008941921.1\|1330679_1332404_+	bifunctional protein-serine/threonine kinase/phosphatase	D7F602	Apocheima_cinerarium_nucleopolyhedrovirus	6.9e-07	23.0
WP_005089862.1\|1334163_1334340_-	hypothetical protein	NA	NA	NA	NA
WP_125316763.1\|1334669_1335834_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_004639604.1\|1335955_1336165_+	hypothetical protein	NA	NA	NA	NA
WP_161403048.1\|1336654_1336774_-	hypothetical protein	NA	NA	NA	NA
WP_004639601.1\|1337549_1338233_-	pirin family protein	NA	NA	NA	NA
WP_004639599.1\|1338425_1339769_-	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	7.6e-54	79.4
WP_004639597.1\|1339999_1340389_-	hypothetical protein	NA	NA	NA	NA
WP_004639596.1\|1340558_1342589_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_160140320.1\|1343321_1344411_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1640151 : 1662984

uncultured_Mediterranean_phage(11.11%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005080553.1\|1640151_1640565_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	9.0e-14	47.1
WP_004639237.1\|1640777_1640900_+\|protease	ATP-dependent Clp protease adaptor ClpS	NA	NA	NA	NA
WP_115736404.1\|1640996_1643282_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.0e-163	43.2
WP_115736405.1\|1643281_1643644_+	YnfA family protein	A0A218MNG8	uncultured_virus	1.2e-25	58.5
WP_005080559.1\|1644035_1645079_+	3-deoxy-7-phosphoheptulonate synthase	A0A1Z1LZD8	Serratia_phage	7.9e-83	45.7
WP_115736406.1\|1645137_1646058_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_115736407.1\|1646078_1646618_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_115736408.1\|1646693_1648766_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_017396081.1\|1648838_1649255_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_125316763.1\|1649433_1650598_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9
WP_160140451.1\|1650620_1651280_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_115736409.1\|1651301_1652390_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_115736410.1\|1652461_1652902_-	internalin	NA	NA	NA	NA
WP_115736411.1\|1653270_1654908_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.8e-151	51.8
WP_004639225.1\|1654940_1655798_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.1e-50	42.4
WP_004639224.1\|1655889_1657179_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.1e-137	60.5
WP_004639223.1\|1657308_1657674_+	cell division protein FtsB	NA	NA	NA	NA
WP_115736412.1\|1657663_1658371_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_005090442.1\|1658497_1658974_+	hypothetical protein	NA	NA	NA	NA
WP_017396077.1\|1659032_1659797_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_004639219.1\|1659793_1660165_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_020846310.1\|1660402_1661335_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_005080585.1\|1661428_1661842_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_160140320.1\|1661893_1662984_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1680174 : 1717164

Escherichia_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004678526.1\|1680174_1680876_+\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_008942430.1\|1681825_1682701_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_008942429.1\|1682708_1683713_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_161412296.1\|1683813_1684698_+	protein deglycase HchA	NA	NA	NA	NA
WP_008942427.1\|1684845_1685847_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_005080626.1\|1685908_1686784_-	bile acid:sodium symporter family protein	NA	NA	NA	NA
WP_160140320.1\|1687040_1688131_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_008942425.1\|1688654_1689722_+	HlyD family secretion protein	NA	NA	NA	NA
WP_004639199.1\|1689747_1691295_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_079283381.1\|1691420_1692446_-\|transposase	IS30-like element ISAba125 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_008942423.1\|1694613_1696200_+	GH3 auxin-responsive promoter family protein	NA	NA	NA	NA
WP_125316793.1\|1696266_1697485_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.5e-77	52.6
WP_161417935.1\|1697613_1698837_+	TolC family protein	NA	NA	NA	NA
WP_008942421.1\|1698848_1700018_+	hypothetical protein	NA	NA	NA	NA
WP_115736415.1\|1700322_1702527_+	OsmC domain/YcaO domain-containing protein	NA	NA	NA	NA
WP_115736416.1\|1702862_1703936_+	amidohydrolase family protein	NA	NA	NA	NA
WP_004961928.1\|1703951_1704782_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_115736417.1\|1704857_1705496_-	LysE family translocator	NA	NA	NA	NA
WP_004639193.1\|1705626_1706106_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_115736418.1\|1706377_1707115_+	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_008942416.1\|1707132_1707786_+	DUF1989 domain-containing protein	NA	NA	NA	NA
WP_115736419.1\|1707789_1711401_+	urea carboxylase	NA	NA	NA	NA
WP_160140357.1\|1711432_1712473_-\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	6.1e-168	82.4
WP_020846310.1\|1714183_1715116_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_160140320.1\|1716074_1717164_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

2126672 : 2194765

Burkholderia_virus(21.43%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004638533.1\|2126672_2127407_-\|protease	proteasome-type protease	NA	NA	NA	NA
WP_125316774.1\|2127423_2128203_-	transglutaminase family protein	NA	NA	NA	NA
WP_005082082.1\|2128199_2128802_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_005082080.1\|2128874_2130425_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_171057159.1\|2131076_2131643_+	WYL domain-containing protein	NA	NA	NA	NA
WP_005082076.1\|2131747_2132725_+	hypothetical protein	NA	NA	NA	NA
WP_005082071.1\|2133101_2134421_-	adenylosuccinate synthase	A0A2P1EKE7	Megavirus	1.1e-68	36.5
WP_005082069.1\|2134481_2135648_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_005082067.1\|2136003_2136372_-	hypothetical protein	NA	NA	NA	NA
WP_005082064.1\|2136452_2136767_-	hypothetical protein	NA	NA	NA	NA
WP_005082062.1\|2136800_2137826_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_171057157.1\|2138081_2140730_+\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	2.0e-77	38.1
WP_004638520.1\|2140793_2142074_+	aspartate kinase	NA	NA	NA	NA
WP_005082058.1\|2142306_2142570_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	9.1e-12	66.7
WP_005082056.1\|2142621_2143188_-	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	2.8e-26	44.7
WP_004642122.1\|2143227_2143608_-	hypothetical protein	NA	NA	NA	NA
WP_004638518.1\|2143824_2144379_+	cytochrome b	NA	NA	NA	NA
WP_005082053.1\|2144422_2145421_-	adenosine deaminase	NA	NA	NA	NA
WP_004638516.1\|2145499_2146819_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.1e-60	37.0
WP_115736073.1\|2147025_2148251_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1
WP_005082051.1\|2148461_2148647_-	hypothetical protein	NA	NA	NA	NA
WP_005082048.1\|2148834_2151015_-	TonB-dependent receptor	NA	NA	NA	NA
WP_005091002.1\|2151331_2151604_+	hypothetical protein	NA	NA	NA	NA
WP_005082046.1\|2151780_2153838_+	TonB-dependent receptor	NA	NA	NA	NA
WP_115736073.1\|2153928_2155153_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1
WP_125269079.1\|2155482_2156701_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.4e-78	52.9
WP_160140452.1\|2156751_2157666_+	AraC family transcriptional regulator ligand-binding domain-containing protein	NA	NA	NA	NA
WP_005082042.1\|2157761_2158385_+	sterol desaturase family protein	NA	NA	NA	NA
WP_005082041.1\|2159143_2159476_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_017394626.1\|2159577_2161458_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_160140363.1\|2161709_2162096_+	hypothetical protein	NA	NA	NA	NA
WP_005082037.1\|2162294_2163197_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_005091003.1\|2163211_2164075_+	DUF3426 domain-containing protein	NA	NA	NA	NA
WP_001086304.1\|2164451_2164721_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
WP_005082034.1\|2164803_2166378_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	9.2e-67	47.0
WP_004638502.1\|2166483_2167770_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_005082033.1\|2168373_2169246_+	hypothetical protein	NA	NA	NA	NA
WP_005082032.1\|2169314_2170340_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.5e-30	39.0
WP_004638497.1\|2170336_2171032_+	ABC transporter permease	NA	NA	NA	NA
WP_005082029.1\|2171945_2172932_-	hypothetical protein	NA	NA	NA	NA
WP_004638494.1\|2173301_2174033_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_004638493.1\|2174331_2174538_+	hypothetical protein	NA	NA	NA	NA
WP_004638491.1\|2174853_2176236_+	adenosylhomocysteinase	S4W1G4	Pandoravirus	4.5e-41	31.4
WP_005082028.1\|2176310_2177147_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_005082027.1\|2177169_2177889_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_085945696.1\|2178028_2179248_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.4e-78	52.9
WP_005082026.1\|2179313_2182163_+	EAL domain-containing protein	NA	NA	NA	NA
WP_005082025.1\|2182381_2184652_+	NADP-dependent malic enzyme	NA	NA	NA	NA
WP_005082023.1\|2184745_2185975_+	multifunctional CCA addition/repair protein	A0A0S1S197	Klebsiella_phage	8.8e-81	42.7
WP_005082022.1\|2186030_2186906_-	elongation factor Ts	NA	NA	NA	NA
WP_005082020.1\|2187045_2187798_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_005082019.1\|2188298_2189123_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_004638481.1\|2189315_2190374_+	OmpW family protein	NA	NA	NA	NA
WP_005082017.1\|2190764_2192111_+	MFS transporter	NA	NA	NA	NA
WP_017394374.1\|2192193_2193405_+	alginate export family protein	NA	NA	NA	NA
WP_115736073.1\|2193539_2194765_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.5e-21	33.1

DBSCAN-SWA_13

2206080 : 2228168

Acinetobacter_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160140324.1\|2206080_2207013_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	7.1e-59	41.2
WP_164743271.1\|2207077_2207335_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_160140453.1\|2207426_2207783_+\|transposase	transposase	NA	NA	NA	NA
WP_005091018.1\|2207979_2209341_+	L-cystine transporter	NA	NA	NA	NA
WP_005091019.1\|2209434_2210229_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_005082005.1\|2210509_2211559_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	4.3e-169	88.0
WP_160140366.1\|2211568_2212375_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	9.3e-132	89.2
WP_001055585.1\|2212702_2213086_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_000618091.1\|2213082_2213418_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_005080957.1\|2213492_2215076_+\|transposase	IS66-like element ISAba25 family transposase	A0A218MNE7	uncultured_virus	9.4e-144	54.0
WP_100607972.1\|2215705_2216835_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_026056331.1\|2218039_2218729_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	1.2e-98	82.1
WP_017394508.1\|2218819_2219368_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	6.4e-92	94.5
WP_004638451.1\|2219382_2219745_+	DUF861 domain-containing protein	NA	NA	NA	NA
WP_160140367.1\|2221532_2221937_+\|transposase	transposase family protein	NA	NA	NA	NA
WP_160140453.1\|2222028_2222385_+\|transposase	transposase	NA	NA	NA	NA
WP_160140368.1\|2222695_2223166_-	DUF3015 family protein	NA	NA	NA	NA
WP_008940950.1\|2223355_2224120_-	DUF817 family protein	NA	NA	NA	NA
WP_005091031.1\|2224205_2225279_-	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_004638446.1\|2225476_2226715_+	murein L,D-transpeptidase	NA	NA	NA	NA
WP_100607972.1\|2227038_2228168_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2269102 : 2330705

Escherichia_phage(30.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160140372.1\|2269102_2270322_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	6.9e-78	52.6
WP_017395805.1\|2270563_2271910_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_005091071.1\|2272424_2273180_-	hypothetical protein	NA	NA	NA	NA
WP_008940937.1\|2273182_2274343_-	hypothetical protein	NA	NA	NA	NA
WP_160140453.1\|2274473_2274830_-\|transposase	transposase	NA	NA	NA	NA
WP_160140367.1\|2274921_2275326_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_160140373.1\|2275373_2276852_-	hypothetical protein	NA	NA	NA	NA
WP_005091075.1\|2276844_2277762_-	hypothetical protein	NA	NA	NA	NA
WP_160140453.1\|2277775_2278132_-\|transposase	transposase	NA	NA	NA	NA
WP_160140367.1\|2278223_2278628_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_160140374.1\|2278713_2281323_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	7.4e-287	53.4
WP_005091082.1\|2281495_2282293_+	RnfABCDGE type electron transport complex subunit B	NA	NA	NA	NA
WP_162920335.1\|2282309_2282981_+	endonuclease III	NA	NA	NA	NA
WP_005091085.1\|2282977_2283160_-	hypothetical protein	NA	NA	NA	NA
WP_171055741.1\|2283221_2283884_-	adenylate kinase	NA	NA	NA	NA
WP_004638396.1\|2283957_2285271_-	hypothetical protein	NA	NA	NA	NA
WP_005081912.1\|2285332_2285851_-	hypothetical protein	NA	NA	NA	NA
WP_004638394.1\|2286092_2288078_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_004638393.1\|2288077_2288626_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_160140375.1\|2288605_2289022_-	hypothetical protein	NA	NA	NA	NA
WP_100607972.1\|2289262_2290392_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_160140376.1\|2291216_2291864_+	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_160140377.1\|2291893_2294080_-	BapA prefix-like domain-containing protein	NA	NA	NA	NA
WP_160140378.1\|2294324_2295287_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	2.7e-21	25.4
WP_171055781.1\|2295555_2296422_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-14	28.7
WP_171502763.1\|2296481_2297855_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_075315912.1\|2297875_2299255_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_115736533.1\|2299353_2300385_-	substrate-binding domain-containing protein	A0A1B1IWY0	uncultured_Mediterranean_phage	2.5e-65	40.1
WP_125269079.1\|2300832_2302052_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.4e-78	52.9
WP_017394961.1\|2302248_2303301_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_160140380.1\|2303375_2304908_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_160140381.1\|2304911_2306282_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	4.5e-25	27.3
WP_005091100.1\|2306749_2307451_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_075315916.1\|2307500_2308133_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005081881.1\|2308247_2308715_+	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_005091108.1\|2308761_2309856_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_005091110.1\|2309870_2310938_-	ferredoxin reductase	NA	NA	NA	NA
WP_004638372.1\|2311078_2311774_+	HTH-type transcriptional repressor FabR	NA	NA	NA	NA
WP_005081876.1\|2311796_2312885_-	DUF389 domain-containing protein	NA	NA	NA	NA
WP_004638370.1\|2313132_2313627_+	DNA starvation/stationary phase protection protein Dps	A0A222Z0F3	Streptomyces_phage	5.4e-05	28.7
WP_005091112.1\|2313682_2316511_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	2.5e-22	36.6
WP_171057914.1\|2316697_2317342_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_005081869.1\|2317484_2317901_-	heme-binding protein	NA	NA	NA	NA
WP_004638366.1\|2318250_2319549_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_005091118.1\|2319633_2320245_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_005081836.1\|2320397_2320769_-	DUF962 domain-containing protein	NA	NA	NA	NA
WP_005091120.1\|2320967_2322416_+	CYTH and CHAD domain-containing protein	NA	NA	NA	NA
WP_005091123.1\|2322681_2323314_-	hypothetical protein	NA	NA	NA	NA
WP_004638360.1\|2323417_2323804_+	DUF3144 domain-containing protein	NA	NA	NA	NA
WP_005091128.1\|2323864_2324830_-	calcium/sodium antiporter	NA	NA	NA	NA
WP_005091130.1\|2324995_2327764_-	insulinase family protein	NA	NA	NA	NA
WP_005091132.1\|2327903_2328722_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_160140382.1\|2328947_2329466_-	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_087486619.1\|2329486_2330705_+\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5

DBSCAN-SWA_15

2335137 : 2392444

Enterobacteria_phage(27.27%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020846310.1\|2335137_2336070_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_008940922.1\|2336323_2338555_-	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_004638351.1\|2339032_2339431_+	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_008940921.1\|2339588_2341292_-	M61 family metallopeptidase	NA	NA	NA	NA
WP_017396684.1\|2341458_2342775_+	D-alanyl-D-alanine carboxypeptidase PBP6B	B6DZZ7	Stx2-converting_phage	3.2e-36	38.2
WP_008940919.1\|2342868_2344155_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_004638347.1\|2344276_2344759_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_008940918.1\|2344877_2346308_+	deoxyribodipyrimidine photo-lyase	A0A2H4UV63	Bodo_saltans_virus	3.0e-56	32.6
WP_160132048.1\|2346465_2347215_+	hypothetical protein	NA	NA	NA	NA
WP_008940916.1\|2347214_2348120_+	hypothetical protein	NA	NA	NA	NA
WP_004638342.1\|2348106_2349357_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_125316787.1\|2349357_2351205_+	hypothetical protein	NA	NA	NA	NA
WP_004638340.1\|2351182_2352064_+	hypothetical protein	NA	NA	NA	NA
WP_004638339.1\|2352099_2353314_-	hypothetical protein	NA	NA	NA	NA
WP_004638338.1\|2353534_2354236_+	VIT family protein	NA	NA	NA	NA
WP_075315936.1\|2354442_2354901_+	DUF2946 domain-containing protein	NA	NA	NA	NA
WP_005081790.1\|2355054_2356488_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_017395778.1\|2356489_2357494_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_125316789.1\|2357770_2358814_+	nitronate monooxygenase	NA	NA	NA	NA
WP_005091161.1\|2358862_2360941_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_004638331.1\|2361096_2361768_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_004638330.1\|2361866_2362670_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_017395776.1\|2362931_2363360_+	VOC family protein	NA	NA	NA	NA
WP_125316790.1\|2363440_2365927_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_004638327.1\|2365923_2366628_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-33	38.2
WP_171287615.1\|2366671_2367295_+	arylesterase	NA	NA	NA	NA
WP_153568177.1\|2367316_2367754_-	AAC(6')-Ighjkrstuvwx family aminoglycoside N-acetyltransferase	NA	NA	NA	NA
WP_005081763.1\|2367838_2368453_-	carbonic anhydrase	NA	NA	NA	NA
WP_005091172.1\|2368714_2369722_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_005091177.1\|2369746_2370754_+	hypothetical protein	NA	NA	NA	NA
WP_005091179.1\|2370788_2372828_-	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.3e-09	30.7
WP_005091180.1\|2373002_2373641_-	Fe-S biogenesis protein NfuA	NA	NA	NA	NA
WP_004638319.1\|2373794_2374412_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_005081751.1\|2374627_2374807_+	hypothetical protein	NA	NA	NA	NA
WP_008940900.1\|2374855_2375842_-	EF-P lysine aminoacylase GenX	A0A1V0SAC0	Catovirus	5.5e-25	27.8
WP_008940899.1\|2375838_2376906_-	4-phosphoerythronate dehydrogenase	A0A285PXZ1	Cedratvirus	1.7e-19	31.4
WP_005081744.1\|2377097_2377472_+	diacylglycerol kinase	NA	NA	NA	NA
WP_005091188.1\|2377527_2378265_-	hypothetical protein	NA	NA	NA	NA
WP_160140453.1\|2379541_2379898_-\|transposase	transposase	NA	NA	NA	NA
WP_160140367.1\|2379989_2380394_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_160140385.1\|2381002_2382109_+	AAA family ATPase	NA	NA	NA	NA
WP_160140386.1\|2382102_2382702_+	DUF4276 family protein	NA	NA	NA	NA
WP_020846310.1\|2383717_2384650_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.8e-57	40.9
WP_004638311.1\|2385093_2386728_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.1e-175	60.6
WP_004652030.1\|2386785_2387076_-	co-chaperone GroES	A0A221S322	uncultured_virus	2.2e-14	42.4
WP_004638309.1\|2387267_2388020_-	metallophosphoesterase	NA	NA	NA	NA
WP_160140388.1\|2388000_2388939_-	diacylglycerol kinase	NA	NA	NA	NA
WP_004638306.1\|2389335_2391165_+	phosphoenolpyruvate carboxykinase (GTP)	NA	NA	NA	NA
WP_160140389.1\|2391511_2392444_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	3.0e-57	40.5

DBSCAN-SWA_16

2499719 : 2559065

uncultured_virus(20.0%)

transposase,integrase,tRNA

attL 2506147:2506163|attR 2530248:2530264

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005091373.1\|2499719_2500451_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_005091376.1\|2500479_2501295_+	arginyltransferase	NA	NA	NA	NA
WP_005091378.1\|2501280_2501730_-	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_004638188.1\|2501834_2502719_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_160140393.1\|2502925_2503816_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_005081540.1\|2504017_2505208_-	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	6.2e-15	27.6
WP_004638187.1\|2505300_2507439_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.4e-49	24.7
2506147:2506163	attL	NA	NA	NA	NA
WP_004638185.1\|2507616_2508087_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_004638184.1\|2508247_2508622_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_005091386.1\|2508793_2510131_-	EcsC family protein	NA	NA	NA	NA
WP_004638181.1\|2510421_2511651_+	3-oxoacyl-ACP synthase	NA	NA	NA	NA
WP_005091388.1\|2511683_2512136_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_005081534.1\|2512210_2512735_+	hypothetical protein	NA	NA	NA	NA
WP_005081532.1\|2512790_2512955_-	hypothetical protein	NA	NA	NA	NA
WP_005091392.1\|2513799_2515425_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	4.8e-95	36.7
WP_005091394.1\|2515417_2516449_+	hypothetical protein	NA	NA	NA	NA
WP_005081519.1\|2517385_2517649_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.1e-20	56.2
WP_004638166.1\|2517650_2518142_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	5.3e-29	44.9
WP_005091398.1\|2518458_2519706_+\|integrase	tyrosine-type recombinase/integrase	A0A0P0IRB7	Acinetobacter_phage	2.9e-124	56.9
WP_005091401.1\|2520183_2520549_-	copper-binding protein	NA	NA	NA	NA
WP_005091403.1\|2520582_2523729_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_005091405.1\|2523742_2525242_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_005091408.1\|2525241_2526546_-	TolC family protein	NA	NA	NA	NA
WP_004678526.1\|2526842_2527544_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_087486619.1\|2529240_2530460_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
2530248:2530264	attR	NA	NA	NA	NA
WP_004699719.1\|2531093_2531351_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_005091417.1\|2531361_2532657_-	cation transporter	NA	NA	NA	NA
WP_004880426.1\|2532741_2533146_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_005091419.1\|2533195_2534077_-	copper resistance protein B	NA	NA	NA	NA
WP_005091421.1\|2534063_2536043_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_005091424.1\|2536120_2536423_-	hypothetical protein	NA	NA	NA	NA
WP_002058525.1\|2536571_2537255_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-31	34.2
WP_005091426.1\|2537244_2538621_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_004880442.1\|2538694_2541040_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.8e-87	37.1
WP_005091429.1\|2541317_2541698_+	copper resistance protein CopC	NA	NA	NA	NA
WP_005091431.1\|2541765_2542647_+	CopD family protein	NA	NA	NA	NA
WP_005091433.1\|2542662_2542935_+	hypothetical protein	NA	NA	NA	NA
WP_005091434.1\|2543038_2543935_-	hypothetical protein	NA	NA	NA	NA
WP_005091435.1\|2544078_2545218_-	YqaJ viral recombinase family protein	A0A139ZPJ9	Marinitoga_camini_virus	6.7e-43	43.0
WP_005091436.1\|2545447_2546521_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	1.0e-56	38.5
WP_005091437.1\|2546577_2546877_-	hypothetical protein	NA	NA	NA	NA
WP_087486619.1\|2547093_2548313_-\|transposase	IS3-like element ISAba19 family transposase	A0A0N7C1X7	Escherichia_phage	1.8e-78	51.5
WP_005091439.1\|2548797_2549673_-	hypothetical protein	NA	NA	NA	NA
WP_005091440.1\|2549705_2550071_-	hypothetical protein	NA	NA	NA	NA
WP_005091441.1\|2550071_2551196_-	hypothetical protein	NA	NA	NA	NA
WP_005091442.1\|2551658_2552579_-	hypothetical protein	NA	NA	NA	NA
WP_005091443.1\|2552682_2553681_-	hypothetical protein	NA	NA	NA	NA
WP_118901380.1\|2554086_2555245_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.5e-50	39.1
WP_125316813.1\|2555213_2557688_-	hypothetical protein	NA	NA	NA	NA
WP_004678526.1\|2558363_2559065_+\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0

DBSCAN-SWA_17

2614820 : 2685985

uncultured_virus(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100833738.1\|2614820_2615950_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_008941832.1\|2616003_2617311_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	3.0e-18	24.3
WP_008941834.1\|2617646_2618390_-	hydrolase	NA	NA	NA	NA
WP_008941835.1\|2618400_2618745_-	hypothetical protein	NA	NA	NA	NA
WP_005081431.1\|2618872_2619454_+	peroxiredoxin	NA	NA	NA	NA
WP_004638102.1\|2619496_2619961_-	bacterioferritin	NA	NA	NA	NA
WP_017396565.1\|2620314_2621370_+	aldehyde reductase	NA	NA	NA	NA
WP_008941837.1\|2621425_2623453_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.6e-124	38.6
WP_008941838.1\|2623525_2624563_-	hypothetical protein	NA	NA	NA	NA
WP_008941839.1\|2624870_2628329_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_005081419.1\|2628339_2629035_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_005081417.1\|2629403_2630204_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_008941840.1\|2630229_2630985_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_008941841.1\|2631000_2631744_+	pantothenate kinase	NA	NA	NA	NA
WP_017396564.1\|2631713_2632286_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_004638090.1\|2633743_2635153_-	signal recognition particle protein	NA	NA	NA	NA
WP_017396462.1\|2635300_2636110_+	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_161412422.1\|2636211_2637120_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
WP_017396463.1\|2637257_2638250_-	hypothetical protein	NA	NA	NA	NA
WP_035374992.1\|2640584_2641517_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	9.3e-59	40.9
WP_003653416.1\|2641662_2642232_-	dCTP deaminase	S5VM63	Pseudomonas_phage	4.3e-75	75.0
WP_008941849.1\|2642332_2642926_-	LysE family transporter	NA	NA	NA	NA
WP_008941850.1\|2643229_2643772_+	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_017394969.1\|2643923_2644928_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_004678526.1\|2645135_2645837_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_004638077.1\|2646131_2647364_-	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_008941853.1\|2647591_2648041_-	hypothetical protein	NA	NA	NA	NA
WP_026056257.1\|2648228_2648771_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004638073.1\|2648872_2649370_+	hypothetical protein	NA	NA	NA	NA
WP_017396445.1\|2649462_2651532_+\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_008941856.1\|2651782_2651983_+	hypothetical protein	NA	NA	NA	NA
WP_160140396.1\|2655731_2656616_+	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_026070424.1\|2656652_2657855_+	aminoacetone oxidase family FAD-binding enzyme	NA	NA	NA	NA
WP_004638069.1\|2657919_2658093_-	hypothetical protein	NA	NA	NA	NA
WP_035375201.1\|2658378_2659941_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_005081354.1\|2660166_2660367_-	hypothetical protein	NA	NA	NA	NA
WP_005091558.1\|2660572_2660995_+	hypothetical protein	NA	NA	NA	NA
WP_113997656.1\|2661029_2661791_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_005091563.1\|2661899_2662784_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_004678526.1\|2663377_2664079_-\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	9.9e-37	55.0
WP_004638062.1\|2664371_2664665_-	cold shock domain-containing protein	NA	NA	NA	NA
WP_118903169.1\|2664784_2665420_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_160140397.1\|2665526_2667023_-	NADH-quinone oxidoreductase subunit NuoN	NA	NA	NA	NA
WP_004638059.1\|2667026_2668625_-	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_004638058.1\|2668626_2670522_-	NADH-quinone oxidoreductase subunit L	NA	NA	NA	NA
WP_004638057.1\|2670518_2670827_-	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_171055772.1\|2670826_2671345_-	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_004638055.1\|2671344_2671887_-	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_004638054.1\|2671905_2672922_-	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_005091568.1\|2672925_2675610_-	NADH-quinone oxidoreductase subunit NuoG	NA	NA	NA	NA
WP_005091570.1\|2675621_2676950_-	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_004638051.1\|2676946_2677456_-	NADH-quinone oxidoreductase subunit NuoE	NA	NA	NA	NA
WP_004638050.1\|2677468_2679256_-	NADH-quinone oxidoreductase subunit C/D	NA	NA	NA	NA
WP_004638049.1\|2679344_2680022_-	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_171055685.1\|2680028_2680508_-	NADH-quinone oxidoreductase subunit A	NA	NA	NA	NA
WP_160140320.1\|2681006_2682096_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_118903171.1\|2682168_2683587_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.6e-20	36.3
WP_080591894.1\|2684956_2685985_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2815538 : 2876857

Staphylococcus_phage(14.29%)

tRNA,integrase,transposase

attL 2818319:2818335|attR 2859594:2859610

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010326927.1\|2815538_2816564_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_160140455.1\|2816576_2817599_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_160140400.1\|2817681_2820438_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	2.7e-90	39.5
2818319:2818335	attL	NA	NA	NA	NA
WP_160140401.1\|2820667_2821663_+	hypothetical protein	NA	NA	NA	NA
WP_085945696.1\|2821710_2822929_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.4e-78	52.9
WP_151959128.1\|2823205_2823562_-	hypothetical protein	NA	NA	NA	NA
WP_160140402.1\|2823681_2824293_-	hypothetical protein	NA	NA	NA	NA
WP_151959082.1\|2824317_2824956_-	DUF805 domain-containing protein	NA	NA	NA	NA
WP_160140403.1\|2826012_2828088_+	polyphosphate kinase 1	NA	NA	NA	NA
WP_004914896.1\|2828168_2828402_-	hypothetical protein	NA	NA	NA	NA
WP_151831402.1\|2829061_2829295_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_125316793.1\|2829990_2831210_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	1.5e-77	52.6
WP_112987394.1\|2831787_2832834_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	8.0e-59	37.1
WP_160140404.1\|2832851_2833118_-	hypothetical protein	NA	NA	NA	NA
WP_112987392.1\|2833239_2834133_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_112987391.1\|2834603_2835521_+	hypothetical protein	NA	NA	NA	NA
WP_160140405.1\|2835522_2836722_-	hypothetical protein	NA	NA	NA	NA
WP_112987389.1\|2836879_2837149_+	pyocin activator PrtN family protein	NA	NA	NA	NA
WP_112987388.1\|2837141_2838278_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	1.9e-90	45.6
WP_160140406.1\|2838412_2839432_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_004637913.1\|2839689_2840145_+	CHAP domain-containing protein	D5GVH7	Campylobacter_virus	1.3e-13	43.2
WP_005092264.1\|2840167_2840959_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	S4VW33	Pandoravirus	3.5e-14	28.5
WP_005092262.1\|2841021_2842215_-	MFS transporter	NA	NA	NA	NA
WP_005092261.1\|2842320_2845077_-	aconitate hydratase AcnA	NA	NA	NA	NA
WP_005092259.1\|2845202_2846018_-	TatD family hydrolase	NA	NA	NA	NA
WP_005092258.1\|2846079_2846976_-	DUF3298 domain-containing protein	NA	NA	NA	NA
WP_005092256.1\|2847082_2847901_-	hypothetical protein	NA	NA	NA	NA
WP_017396220.1\|2847974_2849564_-	peptide chain release factor 3	A0A2K9L2P9	Tupanvirus	1.1e-11	32.9
WP_017396219.1\|2849746_2850751_-	Fic family protein	D7RWK9	Brochothrix_phage	1.5e-06	26.7
WP_160126664.1\|2850774_2853909_-	HsdR family type I site-specific deoxyribonuclease	NA	NA	NA	NA
WP_160126666.1\|2854003_2855227_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_160126667.1\|2855228_2857985_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.2e-88	40.0
WP_017396215.1\|2858149_2858851_-	hypothetical protein	NA	NA	NA	NA
WP_017396214.1\|2858837_2859281_-	hypothetical protein	NA	NA	NA	NA
WP_017396213.1\|2859277_2860378_-	hypothetical protein	NA	NA	NA	NA
2859594:2859610	attR	NA	NA	NA	NA
WP_017396212.1\|2860528_2860759_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_017396211.1\|2860856_2861786_-	hypothetical protein	NA	NA	NA	NA
WP_017396210.1\|2861966_2863007_-	YqaJ viral recombinase family protein	S6C475	Thermus_phage	4.7e-43	36.6
WP_017396209.1\|2863175_2864219_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.5e-60	39.2
WP_026070451.1\|2864277_2864577_-	hypothetical protein	NA	NA	NA	NA
WP_005002354.1\|2864779_2865196_-	hypothetical protein	NA	NA	NA	NA
WP_031995672.1\|2865324_2867391_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_031995669.1\|2868021_2868276_+	hypothetical protein	NA	NA	NA	NA
WP_017394886.1\|2868407_2868635_+	hypothetical protein	NA	NA	NA	NA
WP_017394885.1\|2868647_2869304_+	hypothetical protein	NA	NA	NA	NA
WP_017394884.1\|2870122_2870842_+	hypothetical protein	NA	NA	NA	NA
WP_005146791.1\|2870851_2871775_+	hypothetical protein	NA	NA	NA	NA
WP_160140320.1\|2871995_2873085_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_031995668.1\|2873117_2874062_-	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_005083376.1\|2874432_2874816_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_005080771.1\|2874812_2875157_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_160140359.1\|2875231_2876857_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.7e-143	54.0

DBSCAN-SWA_19

3339687 : 3406974

Faecalibacterium_phage(16.67%)

transposase,integrase,tRNA

attL 3358877:3358922|attR 3421808:3421853

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_115736213.1\|3339687_3341487_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_075316386.1\|3341790_3342402_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_005085700.1\|3342460_3343114_-	glutathione S-transferase	NA	NA	NA	NA
WP_115736214.1\|3343210_3343609_-	OsmC family protein	NA	NA	NA	NA
WP_115736215.1\|3343605_3344553_-	pirin family protein	NA	NA	NA	NA
WP_080592133.1\|3344706_3344889_-	DUF2798 domain-containing protein	NA	NA	NA	NA
WP_005085705.1\|3345121_3345613_-	flavin reductase	NA	NA	NA	NA
WP_004637464.1\|3345798_3346827_-	methionine synthase	NA	NA	NA	NA
WP_115736216.1\|3346854_3347856_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_160140407.1\|3348223_3350662_+	AAA family ATPase	NA	NA	NA	NA
WP_004637461.1\|3350710_3352279_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.7e-25	33.3
WP_171055760.1\|3352726_3353953_+	DUF445 family protein	NA	NA	NA	NA
WP_005085711.1\|3354010_3354379_-	NirD/YgiW/YdeI family stress tolerance protein	NA	NA	NA	NA
WP_004637457.1\|3354511_3354934_-	DoxX family protein	NA	NA	NA	NA
WP_115736218.1\|3355158_3355800_+	DedA family protein	NA	NA	NA	NA
WP_005085714.1\|3355823_3356414_-	LysE family transporter	NA	NA	NA	NA
WP_004637453.1\|3356626_3357013_-	hypothetical protein	NA	NA	NA	NA
WP_115736219.1\|3357022_3357865_-	ParA family protein	V5UP47	Mycobacterium_phage	4.2e-10	24.3
WP_115736220.1\|3357945_3358338_-	SirB2 family protein	NA	NA	NA	NA
WP_115736221.1\|3358347_3358656_-	BolA family transcriptional regulator	NA	NA	NA	NA
3358877:3358922	attL	NA	NA	NA	NA
WP_087540503.1\|3359520_3359745_-	helix-turn-helix transcriptional regulator	S5MTW4	Brevibacillus_phage	1.5e-07	48.4
WP_004858367.1\|3359857_3360067_+	hypothetical protein	NA	NA	NA	NA
WP_039047371.1\|3360086_3361268_+\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	7.2e-40	30.6
WP_004858371.1\|3361260_3361509_+	hypothetical protein	NA	NA	NA	NA
WP_160140408.1\|3361577_3362114_+	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_039047369.1\|3362124_3362871_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.0e-44	37.5
WP_079270859.1\|3363806_3364202_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_039047368.1\|3364361_3366440_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_004907087.1\|3366552_3367821_-	MgtC/SapB family protein	NA	NA	NA	NA
WP_004985732.1\|3367870_3369463_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_004985737.1\|3369603_3370728_-	ABC transporter permease	NA	NA	NA	NA
WP_004985739.1\|3370729_3373486_-	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	3.4e-24	30.2
WP_004907097.1\|3373482_3374541_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004985741.1\|3374559_3375957_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010326927.1\|3376440_3377466_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
WP_125316847.1\|3378282_3379701_+	phosphate--AMP phosphotransferase	NA	NA	NA	NA
WP_100834159.1\|3380254_3380926_+	hypothetical protein	NA	NA	NA	NA
WP_000004527.1\|3380925_3383253_+	hypothetical protein	NA	NA	NA	NA
WP_000557620.1\|3386541_3386904_+	hypothetical protein	NA	NA	NA	NA
WP_001060549.1\|3387027_3389388_+	DEAD/DEAH box helicase family protein	W8W2E1	Invertebrate_iridovirus	1.3e-32	29.2
WP_001005874.1\|3389674_3389983_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016164863.1\|3389979_3391269_+	HipA domain-containing protein	NA	NA	NA	NA
WP_160140409.1\|3391286_3394634_-	SWIM zinc finger family protein	Q2NP48	Hyphantria_cunea_nuclear_polyhedrosis_virus	4.0e-51	31.4
WP_005092561.1\|3395964_3396885_-	hypothetical protein	NA	NA	NA	NA
WP_118902211.1\|3396907_3397840_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.5e-59	41.2
WP_000734101.1\|3397952_3398273_-	hypothetical protein	NA	NA	NA	NA
WP_000733361.1\|3398396_3398780_-	hypothetical protein	NA	NA	NA	NA
WP_160124306.1\|3398804_3398942_-	hypothetical protein	NA	NA	NA	NA
WP_001040037.1\|3398982_3399915_-\|transposase	IS5-like element ISAha2 family transposase	Q1MVF0	Enterobacteria_phage	1.9e-59	41.6
WP_017396282.1\|3400498_3401761_-	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_004985675.1\|3401925_3402567_-	glutathione S-transferase	NA	NA	NA	NA
WP_004985679.1\|3402667_3403066_-	OsmC family protein	NA	NA	NA	NA
WP_004985681.1\|3403062_3404010_-	pirin family protein	NA	NA	NA	NA
WP_004985683.1\|3404315_3404618_-	DUF3861 domain-containing protein	NA	NA	NA	NA
WP_004985684.1\|3404644_3405034_-	transcriptional repressor	NA	NA	NA	NA
WP_004985686.1\|3405048_3405573_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_160140410.1\|3405742_3405958_+	AAA family ATPase	NA	NA	NA	NA
WP_010326927.1\|3405948_3406974_-\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	8.8e-26	30.7
3421808:3421853	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP031994

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031994_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031994_1

2275-2370

Orphan

Consensus_repeat	Method
GTCATAGTTAGTAGTCAATCCGTCATAGTTAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031994_1

>merge|NZ_CP031994|1|2275-2370|CRISPRCasFinder
GTCATAGTTAGTAGTCAATCCGTCATAGTTAAGTAGTCAATCCGTCATAGTTAGTAGTCAATCCGTCATAGTTAGTAGTCAATCCGTCATATTTAA

>NZ_CP031994|1|1|2275-2370|CRISPRCasFinder
GTCATAGTTAGTAGTCAATCCGTCATAGTTAA	GTAGTCAATCCGTCATAGTTAGTAGTCAATCC
GTCATAGTTAGTAGTCAATCCGTCATATTTAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031994.1\|WP_151800611.1\|6705_7020_-\|BrnA-antitoxin-family-protein	unknown	unknown	gnl\|CDD\|373040
NZ_CP031994.1\|WP_002134206.1\|2778_3948_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|274289
NZ_CP031994.1\|WP_000425105.1\|4249_5011_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031994.1\|WP_004282220.1\|5302_5548_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031994.1\|WP_000439570.1\|7804_8638_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP031994.1\|WP_004728121.1\|6161_6479_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031994.1\|WP_001133626.1\|139_415_-\|metal/formaldehyde-sensitive-transcriptional-repressor	unknown	unknown	gnl\|CDD\|197388
NZ_CP031994.1\|WP_008942535.1\|728_1286_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031994.1\|WP_151800610.1\|7006_7294_-\|BrnT-family-toxin	unknown	unknown	gnl\|CDD\|367913
NZ_CP031994.1\|WP_004676219.1\|5697_5922_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP031994.1\|WP_000235176.1\|9111_9510_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319923

Protein	Function_ID	Function_description	E-value
NZ_CP031994.1\|WP_002134206.1\|2778_3948_-\|MobA/MobL-family-protein	gnl\|CDD\|274289	TIGR02768, conjugal_transfer_protein_TraA, Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.	1.88404e-14
NZ_CP031994.1\|WP_000235176.1\|9111_9510_-\|VOC-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.06133e-42
NZ_CP031994.1\|WP_151800611.1\|6705_7020_-\|BrnA-antitoxin-family-protein	gnl\|CDD\|373040	pfam14384, BrnA_antitoxin, BrnA antitoxin of type II toxin-antitoxin system. BrnA is family of antitoxins that neutralizes the toxin BrnT, pfam04365. It consists of 3 alpha-helices and a C-terminal ribbon-helix-helix DNA binding domain. As in other toxin-antitoxin systems, BrnA negatively autoregulates the brnTA operon and has higher affinity for the DNA operator when complexed with BrnT. It dimerizes with two molecules of its toxin BrnT.	2.41318e-20
NZ_CP031994.1\|WP_151800610.1\|7006_7294_-\|BrnT-family-toxin	gnl\|CDD\|367913	pfam04365, BrnT_toxin, Ribonuclease toxin, BrnT, of type II toxin-antitoxin system. BrnT is a ribonuclease toxin of a type II toxin-antitoxin system that exhibits a RelE-like fold. The antitoxin that neutralizes this toxin is pfam14384. BrnT is found in bacteria, archaea, bacteriophage, and plasmids. BrnT-BrnA forms a 2:2 tetrameric complex and autoregulates its own expression, which is induced by a number of different environmental stresses. Expression of BrnT alone results in cessation of bacterial growth which can be rescued after subsequent expression of BrnA.	1.63682e-28
NZ_CP031994.1\|WP_001133626.1\|139_415_-\|metal/formaldehyde-sensitive-transcriptional-repressor	gnl\|CDD\|197388	cd10153, RcnR-FrmR-like_DUF156, Transcriptional regulators RcnR and FrmR, and related domains; this domain family was previously known as part of DUF156. This domain family includes various transcriptional regulators that respond to different stressors. It includes Escherichia coli RncR (formally known as YohL, nickel and cobalt-sensitive), and E. coli FrmR (formally known as YaiN, formaldehyde sensitive). Escherichia coli RncR represses expression of the gene encoding the nickel and cobalt-efflux protein RcnA; RcnA may act through modulating NikR, to repress the NIkABCDE nickel transporter. In vitro, purified RncR binds to the rncA promoter DNA fragment in the absence of Ni2+ or Co2+, and the affinity of RncR for this promoter is reduced in the presence of excess nickel. Escherichia coli FrmR regulates the formaldehyde degradation frmRAB operon. This family belongs to a larger superfamily that includes CsoRs (copper-sensitive operon repressors). CsoRs form homotetramers (dimer of dimers). In Mycobacterium tuberculosis CsoR, within each dimer, two Cys residues on opposite subunits, along with a His residue, bind the Cu(I) ion (forming a triagonal S2N coordination complex, C-H-C). These residues are conserved in the majority of members of this superfamily. In this family, however, not all these residues are conserved; in E.coli RcnR and FrmR there is a His or a Thr instead of the second Cys (C-H-H or C-H-T) respectively. For E. coli FrmR, an N-terminal His residue, not conserved in all members of this family, is also involved in metal binding (H-C-H-H). A conserved Tyr and a Glu residue that facilitate allosteric regulation of DNA binding for CsoRs are poorly conserved in this family.	2.86477e-38
NZ_CP031994.1\|WP_000439570.1\|7804_8638_-\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	1.35202e-132
NZ_CP031994.1\|WP_004676219.1\|5697_5922_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00754589

>NZ_CP031994.1|WP_008942535.1|728_1286_-|hypothetical-protein
MKTSTKYSVSDAATLYKKSRATLYKDIKNGVLSRDHDGSIDFSELLRVYGEPFSGKHSKHTDTSPTQTINTPEYTDNTVIELKNQIDFLKKQLEKAEDREAKANSRIDTLLTLIEMKPTQVHPTPTSDQSSVQSSPSQVEPTLNVDNDKHDGLTTPENKRIPVPEHVEPEPKKRGFWSRFFLPYG
>NZ_CP031994.1|WP_001133626.1|139_415_-|metal/formaldehyde-sensitive-transcriptional-repressor
MPNQVEDKKKILTRVRRIKGQAEAIEKALEDNVECGAILQQICSVRGAINGLMNEMLEVHLKDTLVSGETTEQQRKEELAEIAKILKSYLK
>NZ_CP031994.1|WP_002134206.1|2778_3948_-|MobA/MobL-family-protein
MASYHFSVKSKNKGYATGHYLYISRLMQYEGIRKTSNETIEHIEPGRCMPAFVKDPIDFWQAADTYERANAKAYMEYEIALPNEFTSEQRKTLIETFLDKHIVPQQYPHSYAIHNVKSRISGEDQPHCHLMFSLKADDGIERSAEQYFKRYNPQDPAKGGAKKIQLQDGHEDYSTFLIYIRKQWENHLNDALAQHCPTVTYTLDGQDITIKNQVSADSYEKYNEIHSTLYLPEPKLGVGQQNATAEYLAQIQKIREHNQQERELEERQKQLDQQHEYFYSAENNPFSSLEVMYYLNYLIKNATNKDKLKNDLNEIIKNQGPILKQEAWSIYEMNEKLEDSRRNSTPCFEFEVHSLPEYVLPIQNTPPKRTQSEPVQPKADDYDYGGPGF
>NZ_CP031994.1|WP_000425105.1|4249_5011_+|hypothetical-protein
MEMEKAKKRGRPAQLLQIAELHAFVEFLEQQEQLSDLQSQVLKALNSVDCNFEGLTQTDQVLVKEALKPYREHLKLKLLFEELNNLPLKTEYEQKFLDLYELFQKNALDQMELNILKTLATRYLNFKAQKLEYSDLELYLSQLQKKDAGKKRKAENQRKFELGGAVLVAFKKLNIDISNDTPQQITNRIVNTTKFHNEVRKSLIFKDVKTYENEYFKANKLFIQVLEGLHTWQKGGELLSVIEIKKALEKGEE
>NZ_CP031994.1|WP_004282220.1|5302_5548_-|hypothetical-protein
MYSYPDSNTEKKIALMIINDFFIQKAHELWIFLQLDQCFNDYEATLIWTRRYLEKHPECEYSDIQKAFVSCFPEHFFSFDC
>NZ_CP031994.1|WP_004676219.1|5697_5922_+|helix-turn-helix-transcriptional-regulator
MPYEEFQRLMGKAGLSIKEFATLLDMNPNSITNYKKIGKVPTHIAVLVYLLSSMKDEGVDFYPIFEKIKSYSKD
>NZ_CP031994.1|WP_004728121.1|6161_6479_-|hypothetical-protein
MLGQHHHFLKKLSISDAAIAYRKPRSTILKYIKSGDFELDYNNLIEYSQLVKKLGEITSPIRDERDQQIEKLKDEVMHLKKQLNFFKYTSISNKHRLLISHKDSI
>NZ_CP031994.1|WP_151800611.1|6705_7020_-|BrnA-antitoxin-family-protein
MSMVRYSRKELNEKFSDKQDAEIQRLLAKGTVADDQLDLSDIPEITDWSNAVRHNQFYRPVKQQTSIRLDADVLAWFKSQGKGYQTRMNEILRDAMLKELKNHQ
>NZ_CP031994.1|WP_151800610.1|7006_7294_-|BrnT-family-toxin
MEQYFEWDEAKNRKNQKKHDVSFETASLVFDDPLRISMQDRHTDGEERWQTIGKVKGVLMLLVAHTIFDEDDCEIIRIISARQVTKAERDRYEHG
>NZ_CP031994.1|WP_000439570.1|7804_8638_-|S-formylglutathione-hydrolase
MERIEHHASFEGWQDVFQHESTVLGCMMRFGIYLPPQAEHEKLPVLYWLSGLTCTEQNFITKAAVQRYAAEHGIIVVAPDTSPRGESVADDAAYDLGQGAGFYVDATELPWSDHYQMYSYVVDELPALIEANFPASSRRSISGHSMGGHGALVIALRNPGRYASVSAFSPIVAPTQVPWGQKALAAYLGEKNLEAWKQYDTVELIRVAQERLPLLVDQGLSDEFLEHQLRPQLLRTACEQVDHPLTLNLRPGHDHSYYFISTYLSEHMAHHAAALNR
>NZ_CP031994.1|WP_000235176.1|9111_9510_-|VOC-family-protein
MATPVISGNDIFSHVFLGAVDLKKSVVFYDAALGALGIKNLGPFGNDWVLYGRDKPAFMITRPSNGAEPTSNGVTVGFAAATPAEVNAFHAAGLAAGGTDEGQPGPRGHLPGAYAAYLRDPAGNKVCAYTFV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6018-6049	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044476	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence	6039-6070	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14314-14345	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LR026972	Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence	14335-14366	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2706-2737	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023027	Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence	2727-2758	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1572-1603	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020587	Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence	1593-1624	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15134-15165	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021348	Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence	15155-15186	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4058-4089	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023021	Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence	4079-4110	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6031-6062	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KY499579	Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence	6052-6083	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13480-13511	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP027248	Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence	13501-13532	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3684-3715	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP028570	Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence	3705-3736	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2307-2338	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031994	Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence	2328-2359	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3598-3629	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044462	Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence	3619-3650	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	228-259	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_010481	Acinetobacter baumannii plasmid pABIR, complete sequence	249-280	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	59-90	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP033542	Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence	80-111	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1817-1848	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP038648	Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence	1838-1869	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6654-6685	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP033571	Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence	6675-6706	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8645-8676	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033132	Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence	8666-8697	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9523-9554	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033752	Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence	9544-9575	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8103-8134	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP027252	Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence	8124-8155	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9414-9445	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LT984691	Acinetobacter baumannii isolate K50 plasmid II, complete sequence	9435-9466	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6928-6959	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP029572	Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence	6949-6980	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3638-3669	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN461228	Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence	3659-3690	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2718-2749	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN481286	Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence	2739-2770	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8318-8349	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN495625	Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence	8339-8370	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8318-8349	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN495626	Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence	8339-8370	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2122-2153	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051871	Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence	2143-2174	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8537-8568	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_013506	Acinetobacter baumannii plasmid pMMCU2, complete sequence	8558-8589	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2818-2849	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MK978160	Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence	2839-2870	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7752-7783	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_013056	Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence	7773-7804	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8144-8175	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP042207	Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence	8165-8196	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10198-10229	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP042367	Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence	10219-10250	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4129-4160	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP018141	Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence	4150-4181	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10478-10509	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP038260	Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence	10499-10530	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7568-7599	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP049810	Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence	7589-7620	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	247-278	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP015146	Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence	268-299	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1389-1420	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051877	Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence	1410-1441	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	759-790	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031981	Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence	780-811	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6952-6983	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026427	Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence	6973-7004	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	17984-18015	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP014479	Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence	18005-18036	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2195-2226	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP016899	Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence	2216-2247	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7686-7717	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP051868	Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence	7707-7738	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7703-7734	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019280	Acinetobacter baumannii plasmid pMMD, complete sequence	7724-7755	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2972-3003	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023035	Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence	2993-3024	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4250-4281	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KT022421	Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence	4271-4302	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18027-18058	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032127	Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence	18048-18079	0	1.0
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7417-7448	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP015112	Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence	7438-7469	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4788-4819	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4809-4840	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8559-8590	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP010354	Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence	8580-8611	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9450-9481	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9471-9502	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3221-3252	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3242-3273	1	0.969
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_014312	Klebsiella pneumoniae plasmid pKP048, complete sequence	33923-33954	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	33736-33767	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP023051	Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence	137476-137507	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MF399199	Acinetobacter baumannii strain D46 plasmid pD46-4, complete sequence	81897-81928	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP016764	Citrobacter freundii strain B38 plasmid pOZ181, complete sequence	208670-208701	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_021728	Acinetobacter baumannii BJAB07104 plasmid p2BJAB07104, complete sequence	14498-14529	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KX443408	Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence	59126-59157	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KU302802	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence	72945-72976	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KX009507	Escherichia coli strain 06K2206 plasmid LM6771, complete sequence	30580-30611	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KU302801	Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence	72945-72976	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KM083064	Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence	11040-11071	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KT225462	Klebsiella pneumoniae strain YDC676 plasmid pYDC676, complete sequence	15891-15922	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	82195-82226	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	33092-33123	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026156	Klebsiella pneumoniae strain B12(AN) plasmid pB12AN_1, complete sequence	5686-5717	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP040051	Acinetobacter baumannii strain VB16141 plasmid unnamed1, complete sequence	157830-157861	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_004464	Citrobacter freundii plasmid pCTX-M3, complete sequence	78331-78362	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_007682	Escherichia coli plasmid pMUR050, complete sequence	23523-23554	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	269347-269378	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052160	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-2, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_021180	Klebsiella pneumoniae plasmid pNDM-1saitama01 DNA, complete sequence, strain: NDM-1saitama01	47233-47264	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052311	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence	123333-123364	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP027679	Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence	71941-71972	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	66516-66547	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021328	Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence	379170-379201	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP029729	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence	192795-192826	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	4269-4300	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	172346-172377	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KJ187752	Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence	51083-51114	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052145	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-2, complete sequence	21151-21182	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP014650	Acinetobacter baumannii strain IOMTU433 plasmid pIOMTU433, complete sequence	1251-1282	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044454	Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-4, complete sequence	6554-6585	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033628	Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence	70170-70201	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP038646	Acinetobacter baumannii strain ACN21 plasmid unnamed2, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	136022-136053	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_018107	Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence	353358-353389	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP012007	Acinetobacter baumannii strain Ab04-mff plasmid pAB04-1, complete sequence	115941-115972	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020854	Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence	80036-80067	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN175387	Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence	140438-140469	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031563	Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence	213043-213074	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019165	Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence	73574-73605	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP012754	Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence	1992-2023	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MH909331	Leclercia adecarboxylata plasmid p707804-NDM, complete sequence	140993-141024	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031736	Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence	57768-57799	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP041083	Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence	123289-123320	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP022441	Klebsiella sp. LY plasmid unnamed3, complete sequence	252486-252517	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP036336	Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_016974	Providencia stuartii plasmid pMR0211, complete sequence	129281-129312	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_017172	Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete sequence	7220-7251	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	64116-64147	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP035180	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence	210601-210632	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	KU318419	Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence	2279-2310	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021958	Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u	18918-18949	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LT985387	Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI	10636-10667	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP045003	Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence	96027-96058	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP036195	Klebsiella pneumoniae strain BA34918 plasmid pIncX3	46739-46770	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC508263	Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence	75060-75091	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	225163-225194	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050416	Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019063	Escherichia coli plasmid pNDM-HK, complete sequence	24804-24835	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050426	Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LT009689	Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence	71778-71809	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP040054	Acinetobacter baumannii strain VB35179 plasmid unnamed1, complete sequence	178122-178153	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP008933	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence	204413-204444	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MF344571	Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence	240182-240213	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050433	Acinetobacter baumannii strain PM194229 plasmid pPM194229_1, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050386	Acinetobacter baumannii strain VB82 plasmid pVB82_1, complete sequence	190142-190173	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	117937-117968	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP029118	Escherichia coli strain AR435 plasmid unnamed5, complete sequence	117666-117697	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MF344568	Pseudomonas aeruginosa plasmid p727-IMP, complete sequence	234138-234169	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MF344570	Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence	232207-232238	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP041052	Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence	24288-24319	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020068	Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence	260033-260064	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP028929	Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence	175110-175141	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP050162	Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence	82577-82608	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	186059-186090	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031235	Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence	50975-51006	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP016921	Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence	59097-59128	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP050156	Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence	238004-238035	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052423	Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence	168984-169015	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP022612	Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence	131618-131649	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019065	Escherichia coli plasmid pPG010208, complete sequence	20620-20651	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026154	Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence	211170-211201	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020902	Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence	85298-85329	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC536683	Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence	23823-23854	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC542971	Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence	96278-96309	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC542972	Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence	101394-101425	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP018748	Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence	116343-116374	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	KX957970	Vibrio parahaemolyticus plasmid pVPS43, complete sequence	110095-110126	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021709	Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence	82830-82861	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP021551	Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence	96680-96711	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP023488	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence	152490-152521	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	KX957969	Vibrio alginolyticus plasmid pVAS114, complete sequence	113977-114008	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP013115	Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence	97345-97376	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052205	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-2, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP006799	Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence	1992-2023	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP012902	Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence	47690-47721	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP020596	Acinetobacter baumannii strain HWBA8 plasmid pHWBA8_1, complete sequence	9354-9385	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP031372	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence	208719-208750	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032193	Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence	12765-12796	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP040260	Acinetobacter baumannii strain P7774 plasmid unnamed1, complete sequence	80809-80840	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_022589	Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence	77049-77080	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052352	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence	16262-16293	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044337	Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence	53382-53413	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP007579	Acinetobacter baumannii AC30 plasmid pAC30b, complete sequence	6758-6789	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019360	Citrobacter freundii plasmid pNDM-CIT, complete sequence	31352-31383	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP043933	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence	161706-161737	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP046598	Acinetobacter indicus strain FS42-2 plasmid pFS42-2-3, complete sequence	3413-3444	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP030345	Enterobacter hormaechei strain AR_038 plasmid unnamed1	10319-10350	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP030345	Enterobacter hormaechei strain AR_038 plasmid unnamed1	132235-132266	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	189638-189669	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052393	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence	16262-16293	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	52169-52200	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP026014	Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence	263190-263221	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP018143	Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence	126288-126319	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_AP018145	Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence	145049-145080	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	CP052316	Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-1, complete sequence	1306-1337	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LN831184	Vibrio cholerae isolate V. cholerae 116-14 plasmid pNDM-116-14, complete sequence	232232-232263	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LN831185	Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence	74417-74448	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN937241	Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence	107980-108011	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_LT985241	Escherichia coli strain 721 plasmid RCS40_p, complete sequence	33073-33104	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC505604	Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence	75060-75091	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	LC508722	Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence	75060-75091	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MN101852	Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence	18954-18985	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MK262712	Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence	174691-174722	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	214047-214078	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MN101853	Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence	140400-140431	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_019889	Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence	62261-62292	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN657249	Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence	111158-111189	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN657250	Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence	111194-111225	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN657252	Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence	134420-134451	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	65657-65688	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MH011352	Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence	180693-180724	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MK413720	Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence	121318-121349	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP016215	Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence	75770-75801	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN657241	Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence	132511-132542	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP012903	Providencia rettgeri strain N15-01091 plasmid pNDM15-1091, complete sequence	49446-49477	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MH001166	Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence	159056-159087	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	193045-193076	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344561	Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence	294301-294332	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	151708-151739	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344565	Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence	287996-288027	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	166624-166655	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344562	Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence	302552-302583	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	183933-183964	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344564	Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence	317390-317421	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344572	Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence	88579-88610	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MG450360	Escherichia coli strain AMA566 plasmid pAMA566, complete sequence	134913-134944	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MH892479	Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence	150519-150550	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP049048	Enterobacter hormaechei strain Y233 plasmid p233-142, complete sequence	72812-72843	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NC_021732	Acinetobacter baumannii BJAB0868 plasmid p3BJAB0868, complete sequence	15627-15658	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP044468	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-5, complete sequence	5814-5845	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_KY883660	Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence	257700-257731	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF072965	Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence	138794-138825	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MG288680	Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence	121625-121656	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MG845200	Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence	247967-247998	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MG288682	Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence	74577-74608	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MG845201	Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence	247998-248029	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_MF344582	Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence	143388-143419	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP040068	Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence	124572-124603	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP034406	Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence	244179-244210	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	MN661402	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence	279108-279139	7	0.781
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP032275	Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence	4767-4798	8	0.75
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP050406	Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence	9492-9523	8	0.75
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP035940	Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence	3200-3231	8	0.75
NZ_CP031994_1	1.1\|2307\|32\|NZ_CP031994\|CRISPRCasFinder	2307-2338	32	NZ_CP033846	Klebsiella oxytoca strain FDAARGOS_500 plasmid unnamed2, complete sequence	381-412	10	0.688

1. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

2. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044476 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

3. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

4. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LR026972 (Acinetobacter baumannii strain KCRI-28 isolate RDK36_28 plasmid pKCRI-28-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

5. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

6. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023027 (Acinetobacter baumannii strain 10042 plasmid pAba10042a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

7. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

8. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020587 (Acinetobacter nosocomialis strain SSA3 plasmid pSSA3_1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

9. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

10. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021348 (Acinetobacter baumannii strain B8300 plasmid pB8300, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

11. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

12. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023021 (Acinetobacter baumannii strain 9201 plasmid pAba9201a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

13. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

14. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KY499579 (Acinetobacter pittii strain CCBH10253 plasmid pAP10253-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

15. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

16. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP027248 (Acinetobacter pittii strain WCHAP100004 plasmid p2_100004, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

17. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

18. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP028570 (Acinetobacter pittii strain WCHAP005046 plasmid p2_005046, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

19. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

20. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031994 (Acinetobacter haemolyticus strain 2126ch plasmid pAhaem2126chd, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

21. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

22. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044462 (Acinetobacter indicus strain B18 plasmid pB18-7, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

23. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

24. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_010481 (Acinetobacter baumannii plasmid pABIR, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

25. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

26. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP033542 (Acinetobacter pittii strain 2014S06-099 plasmid p2014S06-099-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

27. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

28. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP038648 (Acinetobacter baumannii strain ACN21 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

29. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

30. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP033571 (Acinetobacter pittii strain 2014N21-145 plasmid p2014N21-145-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

31. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

32. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033132 (Acinetobacter wuhouensis strain WCHAW010062 plasmid pOXA653_010062, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

33. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

34. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033752 (Acinetobacter baumannii strain FDAARGOS_540 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

35. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

36. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP027252 (Acinetobacter pittii strain WCHAP100020 plasmid p2_100020, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

37. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

38. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LT984691 (Acinetobacter baumannii isolate K50 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

39. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

40. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP029572 (Acinetobacter baumannii strain DA33098 plasmid pDA33098-9-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

41. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

42. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN461228 (Acinetobacter pittii strain A2584 plasmid pA2584, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

43. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

44. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN481286 (Acinetobacter baylyi strain A2702 plasmid pA2702, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

45. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

46. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN495625 (Acinetobacter baumannii strain A2485 plasmid pA2485, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

47. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

48. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN495626 (Acinetobacter baumannii strain A2503 plasmid pA2503, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

49. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

50. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051871 (Acinetobacter baumannii strain Ab-D10a-a plasmid pAb-D10a-a_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

51. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

52. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_013506 (Acinetobacter baumannii plasmid pMMCU2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

53. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

54. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MK978160 (Acinetobacter lwoffii strain M2a plasmid pAVAci119, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

55. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

56. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_013056 (Acinetobacter calcoaceticus strain Acal H12O-07 plasmid pMMCU1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

57. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

58. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP042207 (Acinetobacter baumannii strain DS002 plasmid pTS9900, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

59. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

60. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP042367 (Acinetobacter pittii strain C54 plasmid pC54_003, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

61. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

62. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP018141 (Acinetobacter larvae strain BRTC-1 plasmid pRW1, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

63. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

64. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP038260 (Acinetobacter baumannii strain 39741 plasmid pEH_gr3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

65. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

66. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP049810 (Acinetobacter pittii strain A1254 plasmid pA1254_4, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

67. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

68. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP015146 (Acinetobacter pittii strain IEC338SC plasmid pIEC338SCOX, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

69. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

70. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051877 (Acinetobacter baumannii strain Ab-B004d-c plasmid pAb-B004d-c_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

71. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

72. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031981 (Acinetobacter haemolyticus strain AN4 plasmid pAhaemAN4c, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

73. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

74. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026427 (Acinetobacter sp. ACNIH1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

75. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

76. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP014479 (Acinetobacter pittii strain AP_882 plasmid pOXA58-AP_882, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

77. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

78. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP016899 (Acinetobacter soli strain GFJ2 plasmid pGFJ3, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

79. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

80. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP051868 (Acinetobacter baumannii strain Ab-C63 plasmid pAb-C63_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

81. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

82. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019280 (Acinetobacter baumannii plasmid pMMD, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

83. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

84. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023035 (Acinetobacter baumannii strain 5845 plasmid pAba5845a, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

85. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

86. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KT022421 (Acinetobacter baumannii strain ML plasmid pAB-ML, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

87. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

88. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032127 (Acinetobacter chinensis strain WCHAc010005 plasmid p1_010005, complete sequence) position: , mismatch: 0, identity: 1.0

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttagtagtcaatcc	Protospacer
********************************

89. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttggtagtcaatcc	Protospacer
********************.***********

90. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP015112 (Acinetobacter sp. TGL-Y2 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatagttggtagtcaatcc	Protospacer
********************.***********

91. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

92. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

93. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

94. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP010354 (Acinetobacter johnsonii XBB1 plasmid pXBB1-3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

95. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

96. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

97. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

98. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 1, identity: 0.969

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttagtagtcaatcc	Protospacer
*********** ********************

99. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_014312 (Klebsiella pneumoniae plasmid pKP048, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

100. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

101. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP023051 (Citrobacter portucalensis strain IOMTU157 plasmid pIOMTU157, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

102. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MF399199 (Acinetobacter baumannii strain D46 plasmid pD46-4, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

103. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP016764 (Citrobacter freundii strain B38 plasmid pOZ181, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

104. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_021728 (Acinetobacter baumannii BJAB07104 plasmid p2BJAB07104, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

105. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KX443408 (Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

106. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KU302802 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ2 clone ST231, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

107. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KX009507 (Escherichia coli strain 06K2206 plasmid LM6771, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

108. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KU302801 (Enterobacter cloacae strain SZECL1 plasmid pNDM1_SZ1 clone ST231, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

109. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KM083064 (Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

110. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KT225462 (Klebsiella pneumoniae strain YDC676 plasmid pYDC676, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

111. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

112. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

113. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026156 (Klebsiella pneumoniae strain B12(AN) plasmid pB12AN_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

114. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP040051 (Acinetobacter baumannii strain VB16141 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

115. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_004464 (Citrobacter freundii plasmid pCTX-M3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

116. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_007682 (Escherichia coli plasmid pMUR050, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

117. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

118. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052160 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

119. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_021180 (Klebsiella pneumoniae plasmid pNDM-1saitama01 DNA, complete sequence, strain: NDM-1saitama01) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

120. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052311 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

121. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP027679 (Salmonella enterica subsp. enterica serovar Corvallis strain 12-01738 plasmid pSE12-01738-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

122. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

123. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021328 (Raoultella ornithinolytica strain Ro24724 plasmid pRo24724, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

124. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP029729 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

125. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

126. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

127. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KJ187752 (Klebsiella pneumoniae strain 7433 plasmid pTR2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

128. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052145 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

129. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP014650 (Acinetobacter baumannii strain IOMTU433 plasmid pIOMTU433, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

130. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044454 (Acinetobacter indicus strain MMS9-2 plasmid pMMS9-2-4, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

131. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033628 (Klebsiella pneumoniae strain 4743 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

132. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP038646 (Acinetobacter baumannii strain ACN21 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

133. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

134. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_018107 (Klebsiella michiganensis E718 plasmid pKOX_R1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

135. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP012007 (Acinetobacter baumannii strain Ab04-mff plasmid pAB04-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

136. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020854 (Klebsiella pneumoniae strain KPN528 plasmid pKPN528-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

137. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN175387 (Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

138. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031563 (Klebsiella pneumoniae strain 2-1 plasmid pKP21HI1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

139. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019165 (Klebsiella pneumoniae plasmid pKPN101-IT, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

140. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP012754 (Klebsiella pneumoniae strain KP617 plasmid KP-p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

141. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MH909331 (Leclercia adecarboxylata plasmid p707804-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

142. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031736 (Klebsiella pneumoniae subsp. pneumoniae strain Klebsiella pneumoniae plasmid pKPM502, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

143. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP041083 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

144. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP022441 (Klebsiella sp. LY plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

145. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP036336 (Klebsiella pneumoniae strain BP327 plasmid pIncHIB, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

146. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_016974 (Providencia stuartii plasmid pMR0211, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

147. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_017172 (Acinetobacter baumannii MDR-ZJ06 plasmid pMDR-ZJ06, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

148. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

149. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP035180 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncFIB, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

150. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to KU318419 (Enterbacter aerogenes strain EA49 plasmid pEA49-KPC, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

151. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021958 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000002_u) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

152. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LT985387 (Escherichia coli strain 694 genome assembly, plasmid: RCS55_pI) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

153. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP045003 (Pseudomonas aeruginosa strain PAG5 plasmid pPAG5, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

154. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP036195 (Klebsiella pneumoniae strain BA34918 plasmid pIncX3) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

155. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC508263 (Klebsiella pneumoniae A1-3 plasmid pA1-3 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

156. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

157. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050416 (Acinetobacter baumannii strain PM193665 plasmid pPM193665_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

158. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019063 (Escherichia coli plasmid pNDM-HK, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

159. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050426 (Acinetobacter baumannii strain PM194188 plasmid pPM194122_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

160. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LT009689 (Klebsiella pneumoniae plasmid pIT-12C73, strain 12C73, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

161. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP040054 (Acinetobacter baumannii strain VB35179 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

162. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP008933 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-NDM, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

163. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MF344571 (Pseudomonas aeruginosa plasmid pR31014-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

164. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050433 (Acinetobacter baumannii strain PM194229 plasmid pPM194229_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

165. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050386 (Acinetobacter baumannii strain VB82 plasmid pVB82_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

166. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

167. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP029118 (Escherichia coli strain AR435 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

168. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MF344568 (Pseudomonas aeruginosa plasmid p727-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

169. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MF344570 (Pseudomonas aeruginosa plasmid pA681-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

170. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP041052 (Enterobacter hormaechei strain C126 plasmid pEnC126NDM, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

171. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020068 (Klebsiella pneumoniae strain AR_0068 plasmid unitig_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

172. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP028929 (Klebsiella pneumoniae strain AR_0153 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

173. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP050162 (Escherichia coli plasmid Carbapenemase(NDM-1)_IncA/C2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

174. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

175. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031235 (Escherichia coli strain Es_ST410_NW1_NDM_09_2017 plasmid pEsST410_NW_NDM, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

176. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP016921 (Klebsiella pneumoniae isolate 11 plasmid pIncHI1B_DHQP1300920, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

177. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP050156 (Klebsiella pneumoniae plasmid Carbapenemase(NDM-1)_IncH1B, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

178. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052423 (Klebsiella pneumoniae strain C16KP0164 plasmid pC16KP0164-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

179. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP022612 (Klebsiella pneumoniae strain CDC 0106 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

180. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019065 (Escherichia coli plasmid pPG010208, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

181. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026154 (Klebsiella pneumoniae strain F10(AN) plasmid pF10AN_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

182. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020902 (Klebsiella pneumoniae strain K66-45 plasmid pK66-45-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

183. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC536683 (Klebsiella pneumoniae MyNCGM084 plasmid pMyNCGM084, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

184. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC542971 (Escherichia coli IOMTU413 plasmid pIOMTU413 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

185. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC542972 (Escherichia coli IOMTU792 plasmid pIOMTU792 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

186. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP018748 (Klebsiella pneumoniae strain KP33 plasmid pKP3301, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

187. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to KX957970 (Vibrio parahaemolyticus plasmid pVPS43, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

188. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021709 (Klebsiella pneumoniae strain AR_0143 plasmid tig00000001_p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

189. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP021551 (Proteus mirabilis strain AR_0159 plasmid tig00000137, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

190. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP023488 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_01, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

191. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to KX957969 (Vibrio alginolyticus plasmid pVAS114, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

192. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP013115 (Shewanella xiamenensis strain T17 plasmid pSx1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

193. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052205 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

194. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP006799 (Klebsiella pneumoniae subsp. pneumoniae PittNDM01 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

195. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP012902 (Escherichia coli strain N15-01078 plasmid pNDM15-1078, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

196. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP020596 (Acinetobacter baumannii strain HWBA8 plasmid pHWBA8_1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

197. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP031372 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101_5, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

198. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032193 (Salmonella enterica subsp. enterica serovar Senftenberg strain AR_0127 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

199. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP040260 (Acinetobacter baumannii strain P7774 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

200. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_022589 (Providencia rettgeri strain 09ACRGNY2001 plasmid pPrY2001, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

201. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052352 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

202. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044337 (Enterobacter hormaechei strain AKB48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

203. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP007579 (Acinetobacter baumannii AC30 plasmid pAC30b, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

204. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019360 (Citrobacter freundii plasmid pNDM-CIT, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

205. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP043933 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

206. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP046598 (Acinetobacter indicus strain FS42-2 plasmid pFS42-2-3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

207. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP030345 (Enterobacter hormaechei strain AR_038 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

208. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP030345 (Enterobacter hormaechei strain AR_038 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

209. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

210. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052393 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

211. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

212. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP026014 (Klebsiella variicola strain 13450 plasmid p13450-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

213. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP018143 (Escherichia coli strain M214 isolate M214 plasmid pM214_AC2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

214. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_AP018145 (Escherichia coli strain M216 isolate M216 plasmid pM216_AC2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

215. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to CP052316 (Klebsiella pneumoniae strain E16KP0093 plasmid pE16KP0093-1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

216. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LN831184 (Vibrio cholerae isolate V. cholerae 116-14 plasmid pNDM-116-14, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

217. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LN831185 (Vibrio cholerae isolate V. cholerae 116-17a plasmid pNDM-116-17, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

218. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN937241 (Enterobacter cloacae strain BSI034 plasmid pBSI034-MCR9, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

219. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_LT985241 (Escherichia coli strain 721 plasmid RCS40_p, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

220. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC505604 (Klebsiella pneumoniae A1-1 plasmid pKp1-1 genomic DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

221. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to LC508722 (Klebsiella pneumoniae A2-1 plasmid pA2-4 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

222. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MN101852 (Escherichia coli strain 13ZX28-TC-98 plasmid p13ZX28-TC-98, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

223. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MK262712 (Klebsiella pneumoniae strain KP18-29 plasmid p18-29-MDR, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

224. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

225. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MN101853 (Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

226. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_019889 (Klebsiella pneumoniae strain 601 plasmid pNDM-OM, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

227. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN657249 (Enterobacteriaceae bacterium strain 1086-16 plasmid pKP39-T3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

228. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN657250 (Enterobacteriaceae bacterium strain 1083-16 plasmid pKP39-T4, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

229. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN657252 (Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

230. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

231. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MH011352 (Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

232. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MK413720 (Enterobacter cloacae strain 12949 plasmid p12949-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

233. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP016215 (Pseudomonas aeruginosa strain PA121617 plasmid pBM413, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

234. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN657241 (Enterobacteriaceae bacterium strain 20-16 plasmid pCF104a-T3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

235. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP012903 (Providencia rettgeri strain N15-01091 plasmid pNDM15-1091, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

236. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MH001166 (Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

237. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

238. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344561 (Klebsiella pneumoniae strain 11219 plasmid p11219-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

239. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

240. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344565 (Klebsiella pneumoniae strain 19051 plasmid p19051-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

241. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

242. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344562 (Klebsiella pneumoniae strain 12208 plasmid p12208-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

243. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

244. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344564 (Klebsiella pneumoniae strain 13450 plasmid p13450-IMP, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

245. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344572 (Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

246. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MG450360 (Escherichia coli strain AMA566 plasmid pAMA566, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

247. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MH892479 (Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

248. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP049048 (Enterobacter hormaechei strain Y233 plasmid p233-142, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

249. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NC_021732 (Acinetobacter baumannii BJAB0868 plasmid p3BJAB0868, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

250. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP044468 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-5, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

251. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_KY883660 (Pseudomonas putida strain SY153 plasmid pSY153-MDR, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

252. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF072965 (Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

253. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MG288680 (Klebsiella pneumoniae strain D610 plasmid pD610-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

254. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MG845200 (Klebsiella oxytoca strain TJ11 plasmid pNDM-TJ11, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

255. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MG288682 (Klebsiella aerogenes strain E20 plasmid pE20-HI3, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

256. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MG845201 (Klebsiella pneumoniae strain TJ03 plasmid pNDM-TJ03, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

257. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_MF344582 (Citrobacter freundii strain 525011 plasmid p525011-HI2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

258. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP040068 (Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

259. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP034406 (Klebsiella pneumoniae strain NH34 plasmid pNH34.1, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

260. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to MN661402 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-IMP,KPC, complete sequence) position: , mismatch: 7, identity: 0.781

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaattcgtcatagttcgttgctagttc	Protospacer
*********.********** ** *..*.*.*

261. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP032275 (Acinetobacter sp. WCHAc010034 plasmid p7_010034, complete sequence) position: , mismatch: 8, identity: 0.75

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttaggagctgaaag	Protospacer
*********** ********** **...*

262. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP050406 (Acinetobacter baumannii strain VB2486 plasmid pVB2486_3, complete sequence) position: , mismatch: 8, identity: 0.75

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttaggagctgaaag	Protospacer
*********** ********** **...*

263. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP035940 (Acinetobacter cumulans strain WCHAc060092 plasmid p5_060092, complete sequence) position: , mismatch: 8, identity: 0.75

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccctcatagttaggagctgaaag	Protospacer
*********** ********** **...*

264. spacer 1.1|2307|32|NZ_CP031994|CRISPRCasFinder matches to NZ_CP033846 (Klebsiella oxytoca strain FDAARGOS_500 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

gtagtcaatccgtcatagttagtagtcaatcc	CRISPR spacer
gtagtcaatccgtcatgtttagtttctgctgt	Protospacer
****************. *****  ... * .

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP031993

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7556

Mycobacterium_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005086339.1\|0_936_+	replication initiation protein	A0A218MNI2	uncultured_virus	2.0e-56	41.7
WP_017394741.1\|1004_1550_+	hypothetical protein	NA	NA	NA	NA
WP_151800612.1\|1767_2295_+	plasmid pRiA4b ORF-3 family protein	A0A2H4PDG5	Mycobacterium_phage	4.8e-12	28.8
WP_044425274.1\|2400_2649_+	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_035270373.1\|2645_2981_+	type II toxin-antitoxin system HicB family antitoxin	K7PJX6	Enterobacterial_phage	3.1e-20	45.7
WP_005331680.1\|3094_3943_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.1e-05	26.2
WP_005331677.1\|4043_5279_+	alpha/beta fold hydrolase	A0A0B5A484	Mycobacterium_phage	2.5e-11	25.6
WP_005091751.1\|5492_5804_+	BrnT family toxin	NA	NA	NA	NA
WP_005091750.1\|5766_6081_+	BrnA antitoxin family protein	NA	NA	NA	NA
WP_125316763.1\|6390_7556_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-137	84.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031991

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP031994

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP031993

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection