CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP028216	Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	3	0
NZ_CP028215	Bacillus subtilis strain SRCM102750 chromosome, complete genome	2 crisprs	csa3,DinG,cas3,DEDDh	0	1	304	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 28919

Enterococcus_phage(30.43%)

tail,terminase,head,portal,capsid,protease,integrase

attL 2407:2422|attR 33848:33863

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009968675.1\|419_740_-	hypothetical protein	NA	NA	NA	NA
WP_009968676.1\|946_1126_+	hypothetical protein	NA	NA	NA	NA
WP_080028532.1\|1142_1514_+	HNH endonuclease	W5RV32	Staphylococcus_phage	1.5e-28	54.2
WP_160216301.1\|1525_2017_+\|terminase	phage terminase small subunit P27 family	A0A1G5SA54	Enterococcus_phage	3.3e-47	60.1
WP_074794807.1\|2249_2873_+	hypothetical protein	A0A1G5SA94	Enterococcus_phage	6.2e-67	65.2
2407:2422	attL	NA	NA	NA	NA
WP_074794810.1\|2983_3925_+	hypothetical protein	A0A060AKE0	Staphylococcus_phage	9.2e-46	64.8
WP_080475147.1\|4110_5241_+	hypothetical protein	A0A1G5SA94	Enterococcus_phage	1.8e-133	63.7
WP_009968694.1\|5263_6643_+\|portal	phage portal protein	A0A060AFC9	Staphylococcus_phage	2.1e-107	48.8
WP_020846131.1\|6684_7626_+\|head,protease	HK97 family phage prohead protease	A0A060AB24	Staphylococcus_phage	8.0e-42	45.2
WP_013603369.1\|7646_8795_+\|capsid	phage major capsid protein	A0A060AEU4	Staphylococcus_phage	1.1e-66	47.5
WP_009968725.1\|8896_9112_+	hypothetical protein	NA	NA	NA	NA
WP_009968726.1\|9101_9434_+\|head,tail	phage gp6-like head-tail connector protein	Q0SPK5	Clostridium_phage	5.6e-06	33.7
WP_013603366.1\|9433_9772_+\|head	phage head closure protein	NA	NA	NA	NA
WP_013603365.1\|9771_10152_+	HK97 gp10 family phage protein	A0A0M5M1E5	Enterococcus_phage	4.9e-06	30.3
WP_009968607.1\|10148_10553_+	hypothetical protein	NA	NA	NA	NA
WP_009968606.1\|10583_11234_+\|tail	phage major tail protein	A0A249XUT9	Enterococcus_phage	1.6e-20	36.4
WP_013603363.1\|11311_11638_+	hypothetical protein	A0A0M4R2F4	Enterococcus_phage	8.7e-12	41.1
WP_160216302.1\|11835_16920_+\|tail	phage tail tape measure protein	A8ATA7	Listeria_phage	2.9e-106	49.4
WP_160216303.1\|16916_18581_+\|tail	phage tail protein	A0A059T682	Listeria_phage	1.2e-85	35.4
WP_095374992.1\|18596_20927_+	hypothetical protein	A0A059T7Y6	Listeria_phage	8.7e-138	37.0
WP_020846128.1\|20929_21316_+	hypothetical protein	U5J9M3	Bacillus_phage	2.4e-24	49.1
WP_144499943.1\|21333_23001_+	hypothetical protein	U5PU90	Bacillus_phage	1.2e-77	57.9
WP_074794733.1\|23009_23489_+	hypothetical protein	R4JMW6	Bacillus_phage	2.4e-34	46.8
WP_074794736.1\|23526_23733_+	hypothetical protein	NA	NA	NA	NA
WP_009968664.1\|23775_24045_+	hypothetical protein	A0A1L2JY68	Aeribacillus_phage	1.4e-12	47.3
WP_074794739.1\|24049_24343_+	hypothetical protein	NA	NA	NA	NA
WP_160216304.1\|24356_25670_+	LysM peptidoglycan-binding domain-containing protein	A0A060AFE7	Listeria_phage	2.5e-09	57.8
WP_020846125.1\|25779_26757_+\|integrase	tyrosine-type recombinase/integrase	A0A1D3SNK9	Enterococcus_phage	6.4e-119	64.0
WP_160216305.1\|26871_28491_+	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	1.0e-76	61.3
WP_043940285.1\|28502_28919_+	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	1.6e-42	58.0
33848:33863	attR	NA	NA	NA	NA

DBSCAN-SWA_2

32815 : 40267

Lactococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216307.1\|32815_33712_-	DUF1738 domain-containing protein	A0A1B1IRD0	uncultured_Mediterranean_phage	5.3e-35	36.0
WP_009968555.1\|33837_35832_-	DNA gyrase/topoisomerase IV, subunit A	E0YIY2	Lactococcus_phage	1.2e-148	42.7
WP_160216308.1\|35952_37869_-	DNA topoisomerase	V9VEW1	Lactococcus_phage	2.9e-187	51.8
WP_074794761.1\|37982_38846_-	hypothetical protein	A0A286QTB6	Streptococcus_phage	1.6e-12	40.6
WP_129138233.1\|39204_39570_-	hypothetical protein	NA	NA	NA	NA
WP_043940325.1\|39679_40267_-	thymidine kinase	A0A291LB21	Escherichia_phage	1.1e-09	30.5

DBSCAN-SWA_3

43663 : 81305

Enterococcus_phage(34.78%)

integrase

attL 68567:68582|attR 81806:81821

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013603335.1\|43663_44221_-	RusA family crossover junction endodeoxyribonuclease	Q332C4	Clostridium_botulinum_C_phage	3.3e-19	34.1
WP_129110637.1\|44217_44766_-	guanylate kinase/L-type calcium channel region	A0A1D3SNH1	Enterococcus_phage	1.8e-25	35.6
WP_043940321.1\|44762_45059_-	thioredoxin family protein	NA	NA	NA	NA
WP_009968550.1\|45218_45428_-	hypothetical protein	NA	NA	NA	NA
WP_013603331.1\|45601_45976_-	deoxycytidine-triphosphatase	NA	NA	NA	NA
WP_160216309.1\|46262_50105_-	DNA polymerase III subunit alpha	W5RV95	Staphylococcus_phage	0.0e+00	49.7
WP_013603329.1\|50220_50673_-	hypothetical protein	NA	NA	NA	NA
WP_013603328.1\|50672_51647_-	FAD-dependent thymidylate synthase	NA	NA	NA	NA
WP_009968562.1\|51743_51980_-	hypothetical protein	NA	NA	NA	NA
WP_020846152.1\|51976_52444_-	ribonuclease HI	A0A0H3UZB5	Geobacillus_virus	6.3e-40	53.7
WP_020846151.1\|52443_52905_-	hypothetical protein	NA	NA	NA	NA
WP_109789047.1\|53097_53886_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_020846148.1\|54715_55276_-	HD domain-containing protein	NA	NA	NA	NA
WP_160216310.1\|55344_55611_-	thioredoxin family protein	A0A0K2FLN5	Brevibacillus_phage	8.1e-08	34.1
WP_013603320.1\|55715_56174_-	hypothetical protein	NA	NA	NA	NA
WP_013603319.1\|56333_56858_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	2.3e-06	28.2
WP_043940319.1\|56930_58685_-	hypothetical protein	A0A1G5SBU4	Enterococcus_phage	3.8e-85	37.3
WP_009968515.1\|58674_58878_-	hypothetical protein	NA	NA	NA	NA
WP_160216311.1\|58938_59979_-	hypothetical protein	A0A1G5SB33	Enterococcus_phage	4.2e-92	50.0
WP_043940316.1\|60058_61651_-	hypothetical protein	A0A1G5SC52	Enterococcus_phage	1.6e-154	52.8
WP_009968733.1\|61647_62136_-	hypothetical protein	A0A1G5SA84	Enterococcus_phage	1.7e-27	41.5
WP_160216312.1\|62227_63280_-	hypothetical protein	NA	NA	NA	NA
WP_160216313.1\|63525_63912_-	hypothetical protein	NA	NA	NA	NA
WP_043940313.1\|64010_64517_-	hypothetical protein	A0A0S2SY00	Bacillus_phage	1.5e-10	33.1
WP_043940312.1\|64768_65194_-	hypothetical protein	A0A249XZV0	Enterococcus_phage	3.8e-15	35.0
WP_095375003.1\|65195_66239_-	ribonucleotide-diphosphate reductase subunit beta	W5RVC6	Staphylococcus_phage	2.8e-104	52.7
WP_160216314.1\|66342_68712_-	ribonucleoside-diphosphate reductase subunit alpha	W5RV23	Staphylococcus_phage	6.3e-277	59.3
68567:68582	attL	NA	NA	NA	NA
WP_160216315.1\|68783_69818_-	AAA family ATPase	A0A1D3SNC4	Enterococcus_phage	2.8e-88	47.6
WP_064911619.1\|69886_70126_-	hypothetical protein	NA	NA	NA	NA
WP_013603306.1\|70214_70577_-	hypothetical protein	NA	NA	NA	NA
WP_020846142.1\|70573_71095_-	nucleoside 2-deoxyribosyltransferase	A0A218KC29	Bacillus_phage	1.5e-42	56.7
WP_020846141.1\|71169_72135_-	hypothetical protein	A0A1D3SNI1	Enterococcus_phage	3.4e-56	43.2
WP_020846140.1\|72194_72404_-	hypothetical protein	NA	NA	NA	NA
WP_020846139.1\|72682_72937_-	hypothetical protein	NA	NA	NA	NA
WP_013603301.1\|73169_73499_-	DUF2653 family protein	NA	NA	NA	NA
WP_013603300.1\|73501_74278_-	hypothetical protein	NA	NA	NA	NA
WP_009968486.1\|74317_74896_-	hypothetical protein	S5M867	Bacillus_phage	3.4e-19	42.1
WP_009968485.1\|74900_75425_-	hypothetical protein	A0A0H3UZF4	Geobacillus_virus	5.4e-48	60.6
WP_009968484.1\|75436_75667_-	hypothetical protein	NA	NA	NA	NA
WP_020846138.1\|75696_76395_-	hypothetical protein	NA	NA	NA	NA
WP_129138239.1\|76451_77486_-	hypothetical protein	A0A060AL21	Staphylococcus_phage	2.6e-54	38.5
WP_043940299.1\|77744_78317_+\|integrase	site-specific integrase	A3F636	Streptococcus_phage	2.2e-34	43.4
WP_009968570.1\|78354_78690_+	hypothetical protein	NA	NA	NA	NA
WP_100086170.1\|79354_79786_-	LysM peptidoglycan-binding domain-containing protein	S5MM68	Bacillus_phage	5.5e-14	48.9
WP_020846136.1\|80024_81305_-	ATP-dependent DNA ligase	A0A0K2FLM0	Brevibacillus_phage	1.6e-72	37.2
81806:81821	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028215

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028215_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028215_1

1187762-1187869

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028215_1

>merge|NZ_CP028215|1|1187762-1187869|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP028215|1|1|1187762-1187869|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028215.1\|WP_080481012.1\|1183075_1184107_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP028215.1\|WP_038828481.1\|1195440_1195962_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP028215.1\|WP_003228947.1\|1202277_1202820_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP028215.1\|WP_014477776.1\|1199381_1200590_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP028215.1\|WP_004399110.1\|1179241_1181638_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP028215.1\|WP_003229024.1\|1178743_1179211_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP028215.1\|WP_069704042.1\|1185269_1187153_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP028215.1\|WP_026113746.1\|1197529_1198054_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376684
NZ_CP028215.1\|WP_003242867.1\|1198221_1198710_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP028215.1\|WP_004399071.1\|1174764_1175196_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028215.1\|WP_003246015.1\|1181624_1183079_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP028215.1\|WP_003229031.1\|1175197_1176253_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP028215.1\|WP_003228966.1\|1194820_1195399_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP028215.1\|WP_015483611.1\|1200606_1202079_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP028215.1\|WP_003229028.1\|1176267_1177401_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP028215.1\|WP_003229018.1\|1184130_1185273_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP028215.1\|WP_003243556.1\|1203016_1203562_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP028215.1\|WP_003228960.1\|1195979_1197509_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP028215.1\|WP_010886600.1\|1177590_1178664_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP028215.1\|WP_017697649.1\|1198715_1199294_-\|molybdenum-cofactor-sulfurase	unknown	unknown	gnl\|CDD\|377051

Protein	Function_ID	Function_description	E-value
NZ_CP028215.1\|WP_080481012.1\|1183075_1184107_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP028215.1\|WP_038828481.1\|1195440_1195962_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	2.94613e-11
NZ_CP028215.1\|WP_003228947.1\|1202277_1202820_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	4.58408e-72
NZ_CP028215.1\|WP_014477776.1\|1199381_1200590_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	2.57195e-175
NZ_CP028215.1\|WP_004399110.1\|1179241_1181638_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP028215.1\|WP_003229024.1\|1178743_1179211_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NZ_CP028215.1\|WP_069704042.1\|1185269_1187153_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP028215.1\|WP_026113746.1\|1197529_1198054_-\|membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000174975
NZ_CP028215.1\|WP_003242867.1\|1198221_1198710_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
NZ_CP028215.1\|WP_003228960.1\|1195979_1197509_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.12922e-123
NZ_CP028215.1\|WP_003246015.1\|1181624_1183079_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP028215.1\|WP_003229031.1\|1175197_1176253_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
NZ_CP028215.1\|WP_003228966.1\|1194820_1195399_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
NZ_CP028215.1\|WP_015483611.1\|1200606_1202079_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP028215.1\|WP_003229028.1\|1176267_1177401_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.47076e-74
NZ_CP028215.1\|WP_003229018.1\|1184130_1185273_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP028215.1\|WP_003243556.1\|1203016_1203562_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NZ_CP028215.1\|WP_010886600.1\|1177590_1178664_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.3698e-134
NZ_CP028215.1\|WP_017697649.1\|1198715_1199294_-\|molybdenum-cofactor-sulfurase	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	9.40942e-06

>NZ_CP028215.1|WP_069704042.1|1185269_1187153_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDIYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNNWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NZ_CP028215.1|WP_003229018.1|1184130_1185273_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP028215.1|WP_080481012.1|1183075_1184107_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTHIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP028215.1|WP_003246015.1|1181624_1183079_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAENDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NZ_CP028215.1|WP_004399110.1|1179241_1181638_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP028215.1|WP_003229024.1|1178743_1179211_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NZ_CP028215.1|WP_010886600.1|1177590_1178664_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NZ_CP028215.1|WP_003229028.1|1176267_1177401_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>NZ_CP028215.1|WP_003229031.1|1175197_1176253_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP028215.1|WP_004399071.1|1174764_1175196_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP028215.1|WP_003228966.1|1194820_1195399_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP028215.1|WP_038828481.1|1195440_1195962_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHETIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NZ_CP028215.1|WP_003228960.1|1195979_1197509_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>NZ_CP028215.1|WP_026113746.1|1197529_1198054_-|membrane-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP028215.1|WP_003242867.1|1198221_1198710_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP028215.1|WP_017697649.1|1198715_1199294_-|molybdenum-cofactor-sulfurase
MWKRMTAKAEGLYIADTDSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPNLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLAPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP028215.1|WP_014477776.1|1199381_1200590_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFHKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP028215.1|WP_015483611.1|1200606_1202079_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP028215.1|WP_003228947.1|1202277_1202820_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLSKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
>NZ_CP028215.1|WP_003243556.1|1203016_1203562_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028215_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028215_2

3175519-3175624

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028215_2

>merge|NZ_CP028215|2|3175519-3175624|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NZ_CP028215|2|2|3175519-3175624|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028215.1\|WP_003233542.1\|3174346_3174571_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028215.1\|WP_003233481.1\|3190944_3191721_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NZ_CP028215.1\|WP_046380870.1\|3181464_3181938_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP028215.1\|WP_009966836.1\|3176921_3178664_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP028215.1\|WP_032679045.1\|3166980_3167298_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP028215.1\|WP_046380871.1\|3182532_3182886_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP028215.1\|WP_003243789.1\|3165963_3166233_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP028215.1\|WP_003233537.1\|3178740_3179802_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP028215.1\|WP_003244113.1\|3168391_3169381_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP028215.1\|WP_080265326.1\|3175816_3176161_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP028215.1\|WP_003223262.1\|3174652_3175405_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP028215.1\|WP_046380869.1\|3180022_3181312_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493
NZ_CP028215.1\|WP_003223272.1\|3176304_3176835_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP028215.1\|WP_029726837.1\|3173229_3174339_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP028215.1\|WP_046380872.1\|3183093_3183978_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP028215.1\|WP_029726838.1\|3169452_3172038_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP028215.1\|WP_003223285.1\|3182060_3182498_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP028215.1\|WP_029726839.1\|3167299_3168160_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP028215.1\|WP_003244136.1\|3172030_3173014_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP028215.1\|WP_029726841.1\|3166377_3166896_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600

Protein	Function_ID	Function_description	E-value
NZ_CP028215.1\|WP_003233481.1\|3190944_3191721_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	1.87454e-155
NZ_CP028215.1\|WP_046380870.1\|3181464_3181938_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	4.29963e-86
NZ_CP028215.1\|WP_009966836.1\|3176921_3178664_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP028215.1\|WP_032679045.1\|3166980_3167298_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	4.72456e-23
NZ_CP028215.1\|WP_046380871.1\|3182532_3182886_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	6.96449e-70
NZ_CP028215.1\|WP_003243789.1\|3165963_3166233_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP028215.1\|WP_003233537.1\|3178740_3179802_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.49461e-90
NZ_CP028215.1\|WP_003244113.1\|3168391_3169381_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NZ_CP028215.1\|WP_080265326.1\|3175816_3176161_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	5.78318e-29
NZ_CP028215.1\|WP_003223262.1\|3174652_3175405_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP028215.1\|WP_046380869.1\|3180022_3181312_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0
NZ_CP028215.1\|WP_003223272.1\|3176304_3176835_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NZ_CP028215.1\|WP_029726837.1\|3173229_3174339_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	1.5766e-156
NZ_CP028215.1\|WP_046380872.1\|3183093_3183978_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	3.95401e-59
NZ_CP028215.1\|WP_029726838.1\|3169452_3172038_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP028215.1\|WP_003223285.1\|3182060_3182498_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP028215.1\|WP_029726839.1\|3167299_3168160_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.79974e-38
NZ_CP028215.1\|WP_003244136.1\|3172030_3173014_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	2.00254e-44
NZ_CP028215.1\|WP_029726841.1\|3166377_3166896_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	6.63792e-13

>NZ_CP028215.1|WP_003223262.1|3174652_3175405_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP028215.1|WP_003233542.1|3174346_3174571_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP028215.1|WP_029726837.1|3173229_3174339_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPIKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAGEAAAISAAP
>NZ_CP028215.1|WP_003244136.1|3172030_3173014_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP028215.1|WP_029726838.1|3169452_3172038_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGEADTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVFGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFALKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFAYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAVISLVSLLFAVFYIRRKKPGSI
>NZ_CP028215.1|WP_003244113.1|3168391_3169381_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP028215.1|WP_029726839.1|3167299_3168160_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGPEDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP028215.1|WP_032679045.1|3166980_3167298_+|SdpC-immunity-protein-SpdL
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLIILQLILLIAACVITFMLTEKRLKIITHSQGGD
>NZ_CP028215.1|WP_029726841.1|3166377_3166896_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKTGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIYFKGKKAYISTHFLMKTASQAKTTKQTAFYAPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP028215.1|WP_003243789.1|3165963_3166233_+|hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP028215.1|WP_080265326.1|3175816_3176161_+|hypothetical-protein
MSQRVCFTENEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP028215.1|WP_003223272.1|3176304_3176835_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP028215.1|WP_009966836.1|3176921_3178664_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP028215.1|WP_003233537.1|3178740_3179802_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP028215.1|WP_046380869.1|3180022_3181312_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKARGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALDKWGSEIAAVLVEPIVGNFGIVEPKEGFLEKVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFATFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
>NZ_CP028215.1|WP_046380870.1|3181464_3181938_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMAEK
>NZ_CP028215.1|WP_003223285.1|3182060_3182498_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP028215.1|WP_046380871.1|3182532_3182886_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGRVDMCMHCREPLTLDKRLEGKEFDESYNKKKMSK
>NZ_CP028215.1|WP_046380872.1|3183093_3183978_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVAELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTDKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP028215.1|WP_003233481.1|3190944_3191721_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP028215_1	1.1\|1187786\|60\|NZ_CP028215\|CRISPRCasFinder	1187786-1187845	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 1.1|1187786|60|NZ_CP028215|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 108527

119

Bacillus_phage(74.0%)

holin,protease,tRNA,portal,terminase,plate,head,coat,capsid,tail,integrase

attL 5267:5286|attR 84733:84752

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014476869.1\|448_682_+	hypothetical protein	NA	NA	NA	NA
WP_003245758.1\|961_1669_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
WP_003231775.1\|1738_2191_+	OsmC family protein	NA	NA	NA	NA
WP_046381046.1\|2204_2558_-	multidrug efflux SMR transporter subunit EbrB	NA	NA	NA	NA
WP_015483253.1\|2571_2889_-	multidrug efflux SMR transporter subunit EbrA	NA	NA	NA	NA
WP_029317825.1\|3024_3300_-	hypothetical protein	NA	NA	NA	NA
WP_003231769.1\|3388_3802_+	hypothetical protein	NA	NA	NA	NA
WP_038429003.1\|3901_4846_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_003221097.1\|4885_5107_+	RNA chaperone Hfq	NA	NA	NA	NA
5267:5286	attL	NA	NA	NA	NA
WP_014479841.1\|5302_5575_+	hypothetical protein	NA	NA	NA	NA
WP_003245262.1\|5656_5887_+	hypothetical protein	NA	NA	NA	NA
WP_003231758.1\|6129_6522_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_014479842.1\|6481_8584_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
WP_003231754.1\|8601_9591_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|9640_10261_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_046381048.1\|10324_11092_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.6e-51	49.5
WP_003231746.1\|11715_12684_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
WP_015483254.1\|12816_14079_+	GTPase HflX	NA	NA	NA	NA
WP_046160429.1\|14096_15362_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_003238341.1\|15471_15879_+	transcriptional repressor GlnR	NA	NA	NA	NA
WP_003231737.1\|15937_17272_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_160216207.1\|17384_18539_-\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	4.8e-65	39.2
WP_103671446.1\|18589_19645_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_103671447.1\|19637_19970_-	helix-turn-helix transcriptional regulator	R9VW28	Paenibacillus_phage	1.1e-09	46.3
WP_160216208.1\|20074_20287_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_160216209.1\|20400_21165_+	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.2e-51	49.3
WP_160216210.1\|21179_21491_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_105778750.1\|21551_21743_+	hypothetical protein	Q9ZXD0	Bacillus_phage	7.1e-06	53.1
WP_160216211.1\|21739_22015_+	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	46.0
WP_160216212.1\|22208_22763_+	hypothetical protein	Q9ZXC8	Bacillus_phage	3.4e-93	95.7
WP_160216213.1\|22766_23705_+	AAA family ATPase	Q9ZXC7	Bacillus_phage	2.4e-163	92.3
WP_019260095.1\|23694_23892_+	hypothetical protein	Q9ZXC6	Bacillus_phage	1.1e-17	87.5
WP_160216214.1\|23914_24355_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.0e-76	95.2
WP_160216215.1\|24415_26833_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	87.5
WP_160216216.1\|27096_27534_+	hypothetical protein	Q9ZXC3	Bacillus_phage	2.9e-71	86.2
WP_160216217.1\|27530_28070_+	nuclease	Q9ZXC2	Bacillus_phage	1.1e-93	96.1
WP_019260090.1\|28103_28619_+	hypothetical protein	D6R425	Bacillus_phage	1.2e-95	97.7
WP_060399192.1\|28872_29286_+	ArpU family transcriptional regulator	D6R428	Bacillus_phage	5.6e-64	97.7
WP_160216218.1\|29351_30071_+	hypothetical protein	NA	NA	NA	NA
WP_160216219.1\|30531_31047_+	hypothetical protein	NA	NA	NA	NA
WP_160216220.1\|31226_31802_+	hypothetical protein	NA	NA	NA	NA
WP_160216221.1\|31856_33017_+	hypothetical protein	NA	NA	NA	NA
WP_160216222.1\|33070_33436_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	1.2e-30	51.2
WP_019846969.1\|33664_34180_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	2.2e-33	43.4
WP_160216223.1\|34176_35886_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	8.4e-207	62.8
WP_160216224.1\|36074_37355_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	6.2e-154	63.8
WP_160216225.1\|37317_37944_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.5e-81	76.3
WP_160216226.1\|37982_39278_+\|capsid	phage major capsid protein	A0A0A7RTL2	Clostridium_phage	1.1e-92	48.0
WP_019260073.1\|39301_39763_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-10	58.9
WP_160216227.1\|39780_40083_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	1.6e-12	47.6
WP_160216228.1\|40072_40387_+\|head	phage head closure protein	A0A2H4JCB1	uncultured_Caudovirales_phage	3.8e-12	36.3
WP_032725460.1\|40386_40785_+	hypothetical protein	NA	NA	NA	NA
WP_160216229.1\|40781_41174_+	hypothetical protein	NA	NA	NA	NA
WP_160216230.1\|41188_41800_+\|tail	phage tail protein	J7KKC8	Streptococcus_phage	1.6e-11	35.9
WP_160216231.1\|41865_42243_+	hypothetical protein	NA	NA	NA	NA
WP_160216232.1\|42440_46928_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.5e-66	41.8
WP_160216233.1\|46921_47761_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	1.1e-98	60.1
WP_160216234.1\|47775_49479_+	alkaline phosphatase	D6R400	Bacillus_phage	1.6e-178	56.3
WP_160216235.1\|49530_52098_+	peptidase G2	D6R401	Bacillus_phage	0.0e+00	66.1
WP_160216295.1\|52113_53616_+\|plate	BppU family phage baseplate upper protein	D6R402	Bacillus_phage	1.0e-67	64.9
WP_032725469.1\|53599_53953_+	hypothetical protein	O64053	Bacillus_phage	1.2e-11	40.9
WP_144481587.1\|53953_54097_+	XkdX family protein	NA	NA	NA	NA
WP_160216236.1\|54115_54955_+	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	2.5e-31	33.5
WP_160216237.1\|54995_55418_+\|holin	holin family protein	D6R405	Bacillus_phage	6.7e-57	85.0
WP_160216238.1\|55461_56436_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.5e-62	67.8
WP_160216239.1\|56489_56954_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_160216240.1\|56967_58734_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	5.0e-130	51.2
WP_160216241.1\|59082_60198_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	1.6e-145	71.6
WP_046160430.1\|61610_61904_+	hypothetical protein	NA	NA	NA	NA
WP_042975843.1\|62150_62495_+	hypothetical protein	O64021	Bacillus_phage	2.7e-32	81.6
WP_080262658.1\|63061_63496_+	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_046160431.1\|64878_65415_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_046381049.1\|65498_66395_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160216242.1\|66472_66853_+	UPF0715 family protein	NA	NA	NA	NA
WP_014479898.1\|67394_67625_+	helix-turn-helix transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
WP_046381050.1\|67621_68263_+	DUF3885 domain-containing protein	NA	NA	NA	NA
WP_014479901.1\|69126_69291_+	hypothetical protein	NA	NA	NA	NA
WP_014479902.1\|69430_69901_+	hypothetical protein	NA	NA	NA	NA
WP_046381051.1\|70697_72089_+	MFS transporter	NA	NA	NA	NA
WP_014479906.1\|72119_73721_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_046381052.1\|73858_75013_-	ROK family protein	NA	NA	NA	NA
WP_014479908.1\|75250_76588_+	xylose isomerase	NA	NA	NA	NA
WP_014479909.1\|76738_78238_+	xylulokinase	NA	NA	NA	NA
WP_014479910.1\|78722_79358_-	endonuclease YncB	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
WP_033881939.1\|79770_81186_+	sugar porter family MFS transporter	NA	NA	NA	NA
WP_031600564.1\|81287_82472_-	alanine racemase	NA	NA	NA	NA
WP_014479913.1\|82882_83308_-	hypothetical protein	NA	NA	NA	NA
WP_014479915.1\|84226_84661_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
WP_033881937.1\|85261_85525_-\|coat	spore coat protein CotU	NA	NA	NA	NA
84733:84752	attR	NA	NA	NA	NA
WP_003231643.1\|85931_86096_+	hypothetical protein	NA	NA	NA	NA
WP_014479918.1\|86370_87210_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
WP_121509411.1\|87332_87620_-	hypothetical protein	NA	NA	NA	NA
WP_014479919.1\|87662_88382_-	hypothetical protein	NA	NA	NA	NA
WP_014479920.1\|88541_88898_-	hypothetical protein	NA	NA	NA	NA
WP_014479921.1\|89143_89344_-\|coat	spore coat protein CotC	NA	NA	NA	NA
WP_003231634.1\|89518_89707_-	twin-arginine translocase TatAC	NA	NA	NA	NA
WP_009967329.1\|89960_90359_+	hypothetical protein	NA	NA	NA	NA
WP_003231627.1\|90424_90859_-	SRPBCC domain-containing protein	NA	NA	NA	NA
WP_003231626.1\|91165_91354_+	hypothetical protein	NA	NA	NA	NA
WP_003231618.1\|94014_94821_+	hypothetical protein	NA	NA	NA	NA
WP_003244960.1\|94825_95443_+	DUF4166 domain-containing protein	NA	NA	NA	NA
WP_003231612.1\|95439_97080_+	YndJ family transporter	NA	NA	NA	NA
WP_003231610.1\|97116_97482_+	hypothetical protein	NA	NA	NA	NA
WP_003245793.1\|97707_98466_+	gamma-polyglutamate hydrolase PghL	O64134	Bacillus_phage	6.6e-55	50.2
WP_003231606.1\|98492_99032_-	YndM family protein	NA	NA	NA	NA
WP_046381053.1\|99149_99569_+	metallothiol transferase FosB	Q2LI91	Bacillus_phage	2.6e-40	66.1
WP_003238209.1\|100118_100736_-	repressor LexA	A0A1B2APZ1	Phage_Wrath	2.5e-15	62.3
WP_003231598.1\|100885_101203_+	cell division suppressor protein YneA	NA	NA	NA	NA
WP_014479938.1\|101221_101875_+	recombinase family protein	NA	NA	NA	NA
WP_003231595.1\|101938_102172_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_014476936.1\|102340_104344_+	transketolase	NA	NA	NA	NA
WP_003231591.1\|104496_104943_+	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
WP_003221221.1\|105028_105247_+	YneF family protein	NA	NA	NA	NA
WP_010886518.1\|105320_105494_-	aspartyl-phosphate phosphatase YnzD	NA	NA	NA	NA
WP_003231585.1\|105713_106421_+	cytochrome c-type biogenesis protein CcdA	NA	NA	NA	NA
WP_003245707.1\|106509_106872_+	response regulator	NA	NA	NA	NA
WP_010886519.1\|106950_107442_+	CcdC family protein	NA	NA	NA	NA
WP_003231580.1\|107472_107901_-	DUF2621 domain-containing protein	NA	NA	NA	NA
WP_072592538.1\|108134_108527_-\|coat	outer spore coat protein CotM	NA	NA	NA	NA

DBSCAN-SWA_2

115957 : 120349

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479944.1\|115957_117925_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	6.7e-123	42.2
WP_046381054.1\|117928_120349_+	DNA topoisomerase IV subunit A	A0A172JHV7	Bacillus_phage	2.2e-99	32.5

DBSCAN-SWA_3

129206 : 130100

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479952.1\|129206_130100_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.3e-83	54.9

DBSCAN-SWA_4

137029 : 138679

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381065.1\|137029_138679_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	9.5e-30	28.6

DBSCAN-SWA_5

142654 : 180403

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082098079.1\|142654_146494_-	non-ribosomal plipastatin synthetase PpsE	A0A2K9KZV5	Tupanvirus	1.8e-84	26.2
WP_052728186.1\|146501_157301_-	non-ribosomal plipastatin synthetase PpsD	A0A2K9KZV5	Tupanvirus	7.0e-166	27.5
WP_160216243.1\|157326_164994_-	non-ribosomal plipastatin synthetase PpsC	A0A2K9L3I8	Tupanvirus	1.2e-159	26.4
WP_046381071.1\|165010_172693_-	non-ribosomal plipastatin synthetase PpsB	A0A2K9KZV5	Tupanvirus	2.8e-153	27.1
WP_046381072.1\|172717_180403_-	non-ribosomal plipastatin synthetase PpsA	A0A2K9KZV5	Tupanvirus	5.1e-86	25.6

DBSCAN-SWA_6

185845 : 189927

Bacillus_phage(50.0%)

integrase

attL 166163:166176|attR 186719:186732

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
166163:166176	attL	NA	NA	NA	NA
WP_003231473.1\|185845_186391_-\|integrase	site-specific integrase	A0A1B0T6D2	Bacillus_phage	3.6e-42	51.4
WP_003231472.1\|186709_186940_-	excisionase family DNA-binding protein	NA	NA	NA	NA
186719:186732	attR	NA	NA	NA	NA
WP_160216244.1\|187124_188888_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_046381077.1\|189069_189927_-	LysR family transcriptional regulator YofA	Q6JIH3	Burkholderia_virus	1.2e-07	35.8

DBSCAN-SWA_7

198261 : 201798

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042975927.1\|198261_199377_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.3e-69	41.7
WP_010886524.1\|199373_200267_-	Pyrroline-5-carboxylate reductase 1	A0A1X9I6T5	Streptococcus_phage	1.0e-30	32.7
WP_046381082.1\|200411_200783_-	replication termination protein	A0A0K2CP62	Brevibacillus_phage	4.1e-18	41.5
WP_046381083.1\|201081_201798_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	9.7e-48	78.0

DBSCAN-SWA_8

205556 : 206495

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381088.1\|205556_206495_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-27	32.9

DBSCAN-SWA_9

218284 : 222232

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080121380.1\|218284_219304_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.3e-28	31.4
WP_003241887.1\|219971_220094_+	hypothetical protein	NA	NA	NA	NA
WP_003231427.1\|220137_220431_+	YozQ family protein	NA	NA	NA	NA
WP_003231425.1\|220546_222232_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-13	46.0

DBSCAN-SWA_10

227156 : 227840

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399422.1\|227156_227840_+	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	9.9e-66	83.8

DBSCAN-SWA_11

238402 : 251560

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381096.1\|238402_239323_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	3.0e-57	43.2
WP_046381099.1\|240898_241162_+	hypothetical protein	NA	NA	NA	NA
WP_046381100.1\|241520_244112_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.1e-43	34.2
WP_015251938.1\|244786_245428_-	endo-1,4-beta-xylanase XynA	NA	NA	NA	NA
WP_046381101.1\|246728_247064_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	3.5e-48	89.2
WP_046381102.1\|247106_247463_-	hypothetical protein	O64028	Bacillus_phage	1.2e-59	98.3
WP_046381103.1\|247736_248891_-	universal stress protein	NA	NA	NA	NA
WP_046381104.1\|248942_249539_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_046381105.1\|249535_251560_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.5e-32	27.4

DBSCAN-SWA_12

255679 : 262551

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381108.1\|255679_257482_-	type II toxin-antitoxin system toxin ribonuclease YobL	A0A1P8CWI7	Bacillus_phage	9.5e-217	86.2
WP_046381500.1\|257582_258140_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	5.9e-101	94.1
WP_128484050.1\|258267_259704_+	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	1.4e-08	22.1
WP_046381110.1\|260130_262551_+	peptidase G2	D6R401	Bacillus_phage	1.9e-220	49.9

DBSCAN-SWA_13

266991 : 269902

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381113.1\|266991_267930_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.7e-07	27.1
WP_046381114.1\|268135_268681_+	kinase	NA	NA	NA	NA
WP_003231284.1\|268707_269031_-	Zn(II)-responsive metalloregulatory transcriptional repressor CzrA	NA	NA	NA	NA
WP_003231283.1\|269224_269902_+	lysozyme family protein	A0A1S5SEZ8	Streptococcus_phage	7.6e-18	35.0

DBSCAN-SWA_14

276833 : 279720

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231267.1\|276833_277697_-	LysM peptidoglycan-binding domain-containing protein	A0A217ER34	Bacillus_phage	1.4e-32	71.7
WP_004399229.1\|277944_279720_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.1e-81	37.3

DBSCAN-SWA_15

287991 : 288837

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019712210.1\|287991_288837_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.9e-35	39.1

DBSCAN-SWA_16

297699 : 302191

Halovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010886530.1\|297699_298614_-	MoxR family ATPase	R4TG24	Halovirus	5.1e-09	27.6
WP_019712213.1\|298677_299268_-	superoxide dismutase family protein	NA	NA	NA	NA
WP_003231224.1\|299360_300605_-	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	1.0e-15	41.2
WP_003231222.1\|300973_302191_-	glycosyl transferase family 1	G4WEM5	Phthorimaea_operculella_granulovirus	8.6e-12	30.7

DBSCAN-SWA_17

335549 : 336575

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381121.1\|335549_336575_+	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	5.9e-38	35.0

DBSCAN-SWA_18

346127 : 348042

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015251863.1\|346127_346634_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	4.2e-37	49.1
WP_044052509.1\|346630_347425_-	thymidylate synthase	A6M9A2	Geobacillus_virus	8.7e-106	66.7
WP_003230797.1\|347508_348042_-	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.2e-50	58.5

DBSCAN-SWA_19

353445 : 354063

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381127.1\|353445_354063_-	Mn(2+)-dependent (deoxy)ribonucleoside pyrophosphohydrolase	S4W232	Pandoravirus	5.3e-10	27.2

DBSCAN-SWA_20

357430 : 361411

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230776.1\|357430_357631_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	4.2e-17	61.9
WP_003230774.1\|357682_357865_-	transcriptional regulator DegR	NA	NA	NA	NA
WP_015251856.1\|358020_358290_+	DUF2564 family protein	NA	NA	NA	NA
WP_004399003.1\|358317_358500_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_021481511.1\|358492_359173_-	reverse transcriptase-like protein	NA	NA	NA	NA
WP_038429197.1\|359255_359945_+	queuosine precursor transporter	NA	NA	NA	NA
WP_003230765.1\|359944_360343_+	reverse transcriptase-like protein	NA	NA	NA	NA
WP_003218255.1\|360384_360513_+	small, acid-soluble spore protein L	NA	NA	NA	NA
WP_003230763.1\|360520_361411_-	5'-3' exonuclease	F8WQ40	Bacillus_phage	3.2e-24	28.7

DBSCAN-SWA_21

377013 : 378939

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381135.1\|377013_378939_-	ATP-dependent DNA helicase	A0A2P1N0K5	Streptomyces_phage	1.4e-11	22.2

DBSCAN-SWA_22

384108 : 386358

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381138.1\|384108_386358_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	6.7e-10	28.6

DBSCAN-SWA_23

390329 : 390950

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399067.1\|390329_390950_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	5.5e-23	36.6

DBSCAN-SWA_24

394948 : 406589

Bacillus_phage(40.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726781.1\|394948_395647_-	DNA replication protein DnaD	A0A0N7AE27	Bacillus_phage	3.3e-24	42.7
WP_004398777.1\|395739_397032_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.7e-58	30.1
WP_004398489.1\|397175_398357_-	aspartate transaminase AspB	NA	NA	NA	NA
WP_046381142.1\|398379_398865_-	hypothetical protein	NA	NA	NA	NA
WP_015251828.1\|398873_399044_-	YpmA family protein	NA	NA	NA	NA
WP_046381143.1\|399186_401982_-	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	3.8e-55	26.6
WP_003225586.1\|402107_402491_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_046381144.1\|402492_403353_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_003230652.1\|403354_404188_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.2e-50	39.1
WP_003230650.1\|404433_405411_-	bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor	NA	NA	NA	NA
WP_046381145.1\|405395_406589_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	2.6e-37	44.8

DBSCAN-SWA_25

410145 : 411018

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381147.1\|410145_411018_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-73	45.8

DBSCAN-SWA_26

415251 : 415791

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015251820.1\|415251_415791_-	YpiB family protein	G3MAV7	Bacillus_virus	2.7e-42	48.6

DBSCAN-SWA_27

419929 : 425415

Acinetobacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399129.1\|419929_421012_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	6.0e-25	28.5
WP_003230608.1\|421022_421826_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_014480121.1\|421818_423021_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_015251816.1\|423001_423649_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_015251815.1\|423653_424406_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	5.2e-44	43.6
WP_015251814.1\|424398_425415_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	6.4e-61	42.7

DBSCAN-SWA_28

428617 : 435339

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398727.1\|428617_429790_-	chorismate synthase	A0A291AU41	Pandoravirus	4.2e-40	34.9
WP_003230589.1\|429864_430635_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_010886554.1\|430871_431321_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.4e-28	44.3
WP_010886555.1\|431436_432483_-	Heptaprenyl diphosphate synthase component 2	NA	NA	NA	NA
WP_003230580.1\|432424_433126_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_004398550.1\|433132_433888_-	Heptaprenyl diphosphate synthase component 1	NA	NA	NA	NA
WP_003230576.1\|434051_434279_-	trp RNA-binding attenuation protein MtrB	NA	NA	NA	NA
WP_003225516.1\|434300_434873_-	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	4.9e-50	55.7
WP_003153447.1\|435060_435339_-	non-specific DNA-binding protein Hbs	A7KV42	Bacillus_phage	1.1e-28	75.3

DBSCAN-SWA_29

448669 : 449587

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398523.1\|448669_449587_-	spore cortex-lytic enzyme	A0A0E3XAL9	Bacillus_phage	1.6e-18	40.3

DBSCAN-SWA_30

456430 : 467414

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230528.1\|456430_457921_-	ATP-dependent DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	9.4e-61	39.0
WP_004398594.1\|457913_458972_-	hypothetical protein	NA	NA	NA	NA
WP_003225461.1\|459237_459486_+	ferredoxin	A0A127AYY7	Bacillus_phage	1.6e-18	56.8
WP_004399159.1\|459525_460098_-	riboflavin transporter FmnP	NA	NA	NA	NA
WP_004398713.1\|460594_462172_+	D-3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.3e-36	35.1
WP_046381154.1\|462216_462984_-	type I 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_046381155.1\|463095_464202_-	anti-sigma-X factor RsiX	NA	NA	NA	NA
WP_003230521.1\|464137_464722_-	RNA polymerase sigma factor SigX	NA	NA	NA	NA
WP_046381156.1\|464925_466695_-	sensor histidine kinase ResE	W8CYF6	Bacillus_phage	1.6e-38	38.9
WP_003246107.1\|466691_467414_-	DNA-binding response regulator ResD	W8CYM9	Bacillus_phage	2.7e-45	42.2

DBSCAN-SWA_31

472893 : 480854

Staphylococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480157.1\|472893_474042_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.0e-23	29.5
WP_014477219.1\|474164_474704_-	YpuI family protein	NA	NA	NA	NA
WP_003223904.1\|474758_475352_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_046381501.1\|475341_476097_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	7.2e-09	29.2
WP_046381158.1\|476377_476902_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_003223910.1\|476915_477290_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|477402_477867_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_003230496.1\|477899_479096_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.3e-115	54.9
WP_004398505.1\|479110_479758_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	5.0e-43	45.9
WP_046381159.1\|479768_480854_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.7e-56	36.1

DBSCAN-SWA_32

488324 : 488756

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223931.1\|488324_488756_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	1.2e-16	42.9

DBSCAN-SWA_33

496395 : 502448

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230458.1\|496395_497163_-	RNA polymerase sporulation sigma factor SigF	A0A0Y0AU18	Bacillus_phage	1.0e-71	60.7
WP_003230452.1\|497174_497615_-	anti-sigma F factor	NA	NA	NA	NA
WP_004398633.1\|497611_497965_-	anti-sigma F factor antagonist	NA	NA	NA	NA
WP_004398637.1\|498060_499230_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.1e-35	30.0
WP_003230447.1\|499384_500200_-	purine nucleoside phosphorylase I, inosine and guanosine-specific	Q5YBA4	Grouper_iridovirus	1.3e-69	48.2
WP_015251776.1\|500212_501397_-	phosphopentomutase	NA	NA	NA	NA
WP_004398985.1\|501557_502448_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.7e-41	34.0

DBSCAN-SWA_34

515159 : 526950

Erysipelothrix_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398771.1\|515159_516191_-	GNAT family N-acetyltransferase	A0A2K5B2B6	Erysipelothrix_phage	6.3e-32	41.2
WP_003245961.1\|516183_516528_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_004398668.1\|516537_517008_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_004398477.1\|517193_517532_-	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	2.8e-05	27.9
WP_010886562.1\|517528_518767_-	DNA polymerase IV 2	O64031	Bacillus_phage	2.3e-76	42.8
WP_004398642.1\|518932_519139_+	hypothetical protein	NA	NA	NA	NA
WP_029726749.1\|519682_520936_+	MFS transporter	NA	NA	NA	NA
WP_015251763.1\|521120_521507_-	hypothetical protein	V5UQY3	Oenococcus_phage	3.3e-34	55.6
WP_003245966.1\|521511_522471_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	5.5e-30	34.3
WP_160216245.1\|522542_523889_-	D-serine ammonia-lyase	NA	NA	NA	NA
WP_015483409.1\|523964_524744_-	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	7.4e-09	27.1
WP_029726748.1\|524749_525709_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_029317946.1\|526113_526950_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	5.3e-29	33.8

DBSCAN-SWA_35

532117 : 535119

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014114310.1\|532117_533587_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	3.6e-81	37.2
WP_003230365.1\|533709_535119_-	NADP-dependent phosphogluconate dehydrogenase	V5UT40	Synechococcus_phage	1.5e-36	33.7

DBSCAN-SWA_36

543535 : 544258

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230342.1\|543535_544258_-	arginine ABC transporter ATP-binding protein ArtR	G9BWD6	Planktothrix_phage	1.5e-32	40.9

DBSCAN-SWA_37

567127 : 571785

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230288.1\|567127_567859_-	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	4.1e-17	28.8
WP_010886565.1\|567937_568558_-	N-acetylmuramoyl-L-alanine amidase	A0A0N9SGH1	Paenibacillus_phage	2.9e-24	42.5
WP_003230284.1\|568572_568866_-	lipoprotein	NA	NA	NA	NA
WP_003230276.1\|569173_569326_+	hypothetical protein	NA	NA	NA	NA
WP_004398691.1\|569398_570517_+	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_003226427.1\|570981_571785_-	sporulation transcription factor Spo0A	W8CYM9	Bacillus_phage	7.1e-07	35.0

DBSCAN-SWA_38

579881 : 582217

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726730.1\|579881_581228_-	exodeoxyribonuclease VII large subunit	A0A1B3AYB4	Gordonia_phage	1.5e-28	32.9
WP_003230259.1\|581365_582217_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	5.9e-44	43.0

DBSCAN-SWA_39

595401 : 604410

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726728.1\|595401_596277_-	patatin-like phospholipase family protein	A0A1V0SFX9	Hokovirus	2.9e-17	28.7
WP_003236923.1\|596402_596831_-	transcriptional regulator MntR	NA	NA	NA	NA
WP_014664579.1\|596930_597767_-	octanoyltransferase LipM	NA	NA	NA	NA
WP_004398485.1\|597957_598338_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_029726727.1\|598372_599839_-	glycine dehydrogenase subunit 2	E3ST28	Prochlorococcus_phage	1.4e-85	42.2
WP_029317920.1\|599831_601178_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	E3SN07	Prochlorococcus_phage	3.4e-62	38.4
WP_015714248.1\|601207_602296_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_029726726.1\|602736_604410_+	DEAD/DEAH box helicase family protein	A0A2H4J643	uncultured_Caudovirales_phage	5.8e-59	31.2

DBSCAN-SWA_40

621534 : 623451

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381182.1\|621534_623451_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.6e-100	37.7

DBSCAN-SWA_41

630172 : 631775

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480273.1\|630172_630955_-	phosphate ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.2e-16	30.5
WP_009967747.1\|630965_631775_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-14	30.5

DBSCAN-SWA_42

638397 : 639006

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398583.1\|638397_639006_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	3.2e-68	61.1

DBSCAN-SWA_43

645212 : 655263

Bodo_saltans_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381187.1\|645212_646106_-	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	1.7e-25	33.0
WP_046381188.1\|646115_647432_-	DEAD-box ATP-dependent RNA helicase CshB	A0A1V0SIR5	Klosneuvirus	5.0e-50	34.5
WP_046381189.1\|647600_648335_+	hypothetical protein	NA	NA	NA	NA
WP_014477361.1\|648457_649402_+	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_046381190.1\|649424_650546_-	Nif3-like dinuclear metal center hexameric protein	A0A1S5V250	Saudi_moumouvirus	7.1e-21	48.0
WP_080481046.1\|650538_651228_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_003230068.1\|651445_651808_-	cytochrome c-550	NA	NA	NA	NA
WP_003226225.1\|652137_653253_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	5.8e-39	35.1
WP_046381192.1\|653451_655263_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.1e-52	38.0

DBSCAN-SWA_44

666419 : 667379

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014477373.1\|666419_667379_-	PhoH family protein	L7TP00	Rhizobium_phage	1.8e-52	54.0

DBSCAN-SWA_45

671833 : 672280

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230022.1\|671833_672280_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.1e-12	36.1

DBSCAN-SWA_46

676707 : 684671

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003230010.1\|676707_677835_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	4.5e-23	28.8
WP_004398786.1\|678034_679870_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.2e-139	49.5
WP_003230005.1\|679893_680457_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003246126.1\|680528_681560_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
WP_015714284.1\|681640_682780_-	radical SAM family heme chaperone HemW	NA	NA	NA	NA
WP_003229999.1\|682832_684671_-	elongation factor 4	A0A1B0RXH7	Streptococcus_phage	2.6e-20	24.6

DBSCAN-SWA_47

689466 : 692370

Clostridium_botulinum_C_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069704087.1\|689466_691797_-	DNA internalization-related competence protein ComEC/Rec2	Q332B9	Clostridium_botulinum_C_phage	1.2e-35	34.7
WP_003229978.1\|691800_692370_-	ComE operon protein 2	A0A127AWN5	Bacillus_phage	2.8e-34	52.5

DBSCAN-SWA_48

695688 : 696258

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398676.1\|695688_696258_-	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	1.1e-22	31.5

DBSCAN-SWA_49

700826 : 705645

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381197.1\|700826_701579_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	7.5e-67	63.7
WP_046381198.1\|701765_702392_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_015714298.1\|702410_703304_-	decarboxylating 6-phosphogluconate dehydrogenase	M4SJX8	Cyanophage	1.1e-56	35.4
WP_046381199.1\|703555_704278_+	hypothetical protein	NA	NA	NA	NA
WP_009967785.1\|704310_704721_-	sporulation-specific Dnase NucB	F8WPS9	Bacillus_phage	7.8e-42	60.6
WP_003226102.1\|704919_705645_+	RNA polymerase sporulation sigma factor SigK	A0A0A0RV91	Bacillus_phage	1.8e-12	27.5

DBSCAN-SWA_50

715736 : 716297

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381206.1\|715736_716297_-	cupin domain-containing protein	Q2Q459	Bacillus_phage	1.3e-55	55.8

DBSCAN-SWA_51

723590 : 724628

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019712545.1\|723590_724628_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.9e-15	25.9

DBSCAN-SWA_52

735044 : 735899

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381214.1\|735044_735899_-	aminoglycoside 6-adenylyltransferase AadK	E4ZFP8	Streptococcus_phage	9.7e-95	58.6

DBSCAN-SWA_53

747374 : 748208

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229851.1\|747374_748208_-	chitosanase	A0A223LHY0	Streptomyces_phage	3.8e-19	33.2

DBSCAN-SWA_54

752842 : 759467

Synechococcus_phage(33.33%)

protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229843.1\|752842_753979_+	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	2.2e-14	25.1
WP_003229842.1\|753997_754195_+	hypothetical protein	NA	NA	NA	NA
WP_003246006.1\|754210_754510_+\|coat	spore coat protein	NA	NA	NA	NA
WP_004398725.1\|754772_755195_-	aldehyde stress transcriptional regulator AdhR	NA	NA	NA	NA
WP_003229839.1\|755377_755572_+	carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_019712532.1\|755702_756752_+	formaldehyde dehydrogenase AdhA	A0A2K9L339	Tupanvirus	9.5e-68	41.5
WP_003229836.1\|756882_757392_+\|protease	cysteine protease YraA	NA	NA	NA	NA
WP_004398804.1\|757433_759467_-	levanase	S6ATV4	Bacillus_phage	1.7e-84	38.0

DBSCAN-SWA_55

770708 : 772613

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038429383.1\|770708_772613_+	peptidoglycan O-acetyltransferase OatA	B5WZU0	Pseudomonas_phage	3.0e-43	34.6

DBSCAN-SWA_56

779158 : 792252

Tupanvirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381224.1\|779158_780766_-	phenylalanine aminomutase (D-beta-phenylalanine forming)	A0A1V0S940	Catovirus	2.2e-68	31.7
WP_015714411.1\|780794_781682_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_015714412.1\|781695_783459_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	4.7e-59	28.4
WP_015714413.1\|783478_784291_-	ABC transporter permease	NA	NA	NA	NA
WP_015714414.1\|784290_785100_-	ABC transporter permease	NA	NA	NA	NA
WP_015714415.1\|785077_786082_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.9e-15	24.7
WP_015714416.1\|786211_787192_-	SDR family oxidoreductase	A0A2K9L0I7	Tupanvirus	6.5e-87	51.9
WP_015714417.1\|787193_788594_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
WP_003246174.1\|789087_792252_-	cytochrome P450	V5UQK0	Mycobacterium_phage	7.3e-79	37.6

DBSCAN-SWA_57

800197 : 802262

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015251583.1\|800197_801337_-	bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase	A0A0B5JD48	Pandoravirus	1.7e-22	31.0
WP_046381226.1\|801338_802262_-	O-acetylserine dependent cystathionine beta-synthase	A0A1W6JHY1	Lactococcus_phage	2.9e-60	42.8

DBSCAN-SWA_58

807414 : 818283

Catovirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003225916.1\|807414_808050_-	uridine kinase	A0A1V0SAA3	Catovirus	3.2e-34	38.7
WP_003229802.1\|808056_809325_-	U32 family peptidase	Q6DW11	Phage_TP	9.5e-38	31.8
WP_033882966.1\|809343_810273_-	U32 family peptidase	NA	NA	NA	NA
WP_015714429.1\|810278_810932_-	O-methyltransferase	W8CYT3	Bacillus_phage	3.2e-05	31.7
WP_029318172.1\|811083_812166_-	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_003246199.1\|812296_812578_-	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_160216247.1\|812595_813012_-	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003225903.1\|813019_813286_-	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_046381229.1\|813370_816007_-\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	1.1e-67	34.5
WP_009967889.1\|816337_817399_-	AI-2E family transporter	NA	NA	NA	NA
WP_003246180.1\|817554_818283_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-35	40.9

DBSCAN-SWA_59

821482 : 823879

Virus_Rctr197k(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381232.1\|821482_823879_-	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	1.9e-55	28.9

DBSCAN-SWA_60

827532 : 844317

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381234.1\|827532_828822_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.4e-113	52.9
WP_003229763.1\|828844_829609_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	A0A291ATS8	Pandoravirus	7.0e-20	31.8
WP_015251570.1\|829944_831723_-\|tRNA	aspartate--tRNA ligase	K7Y9W2	Megavirus	5.4e-07	33.6
WP_014480430.1\|831736_833011_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_004399157.1\|833392_833563_-	YrzK family protein	NA	NA	NA	NA
WP_046381235.1\|833696_835253_+	SH3 domain-containing protein	E5DV68	Deep-sea_thermophilic_phage	9.3e-11	28.7
WP_004398689.1\|835279_835720_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003229747.1\|835732_837937_-	GTP diphosphokinase	A0A1B1IUF0	uncultured_Mediterranean_phage	1.9e-09	34.4
WP_003229745.1\|838104_838617_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.5e-29	47.9
WP_046381236.1\|838622_840983_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.1e-91	33.8
WP_069704050.1\|841049_841373_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_003229739.1\|841448_841946_-	cation:proton antiporter regulatory subunit	NA	NA	NA	NA
WP_046381237.1\|842103_844317_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.1e-30	33.7

DBSCAN-SWA_61

847627 : 901396

uncultured_Mediterranean_phage(22.22%)

protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398708.1\|847627_847894_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.5e-06	40.3
WP_003229725.1\|847930_849076_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|849102_850131_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003222669.1\|850160_850361_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_046381239.1\|850353_851358_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_046381240.1\|851368_851974_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003229715.1\|852112_852625_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_046381241.1\|852672_853980_-	MFS transporter	NA	NA	NA	NA
WP_046381242.1\|854050_855076_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_003246159.1\|855313_855961_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
WP_003229707.1\|856006_856129_-	hypothetical protein	NA	NA	NA	NA
WP_157829193.1\|856287_856656_+	hypothetical protein	NA	NA	NA	NA
WP_017696343.1\|856662_856803_+	hypothetical protein	NA	NA	NA	NA
WP_017696342.1\|856966_858421_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_046381503.1\|858461_859184_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_015714450.1\|859286_859883_-	spore germination protein SgpA	NA	NA	NA	NA
WP_021480233.1\|860030_861194_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_046381243.1\|861310_862417_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_046381244.1\|862403_863273_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_046381245.1\|863226_864822_-	L-aspartate oxidase	NA	NA	NA	NA
WP_046381246.1\|864924_866112_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	1.7e-33	27.4
WP_004398582.1\|866071_866614_+	transcription repressor NadR	NA	NA	NA	NA
WP_014477545.1\|866637_867495_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|867511_867955_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_003246161.1\|868015_869302_-	GTPase ObgE	NA	NA	NA	NA
WP_004399131.1\|869335_869914_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|869991_870114_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|870234_870519_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|870531_870870_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|870872_871181_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_004398649.1\|871327_872194_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_046381248.1\|872186_872981_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_014664846.1\|873129_873936_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|873937_874618_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|874670_875189_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_009967915.1\|875185_876058_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|876088_877102_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_014480455.1\|877193_877889_-	JAB domain-containing protein	NA	NA	NA	NA
WP_024572904.1\|877925_878495_-	septum formation protein Maf	NA	NA	NA	NA
WP_046381249.1\|878647_879646_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_069704049.1\|879779_880526_-	prepilin peptidase	NA	NA	NA	NA
WP_046381250.1\|880665_881958_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_046381251.1\|882017_884660_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	1.4e-160	42.5
WP_003222590.1\|885107_885299_+	hypothetical protein	NA	NA	NA	NA
WP_046381252.1\|885317_886343_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_046381253.1\|886375_888103_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_003229633.1\|888233_889526_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_003229631.1\|889555_890530_-	porphobilinogen synthase	NA	NA	NA	NA
WP_029727111.1\|890526_891315_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_080481013.1\|891304_892249_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|892281_893112_-	protein HemX	NA	NA	NA	NA
WP_004399038.1\|893119_894487_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003229624.1\|894715_895213_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|895234_895822_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003229618.1\|895818_898143_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
WP_004398923.1\|898323_899982_-\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|900133_901396_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_62

907490 : 912325

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009967929.1\|907490_909047_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.0e-10	39.4
WP_003222549.1\|909033_910062_-	ketol-acid reductoisomerase	NA	NA	NA	NA
WP_004399096.1\|910085_910604_-	acetolactate synthase small subunit	NA	NA	NA	NA
WP_004398643.1\|910600_912325_-	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	8.3e-61	30.4

DBSCAN-SWA_63

915897 : 916494

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010886588.1\|915897_916494_-	XTP/dITP diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	5.5e-12	33.5

DBSCAN-SWA_64

920079 : 920304

Caldibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003184172.1\|920079_920304_-	spore germination protein GerE	A0A290GJH9	Caldibacillus_phage	1.2e-15	78.7

DBSCAN-SWA_65

928376 : 928691

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003222500.1\|928376_928691_-	thioredoxin	A0A1V0SD63	Indivirus	3.5e-10	43.0

DBSCAN-SWA_66

933996 : 940377

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399166.1\|933996_935679_-	long-chain-fatty-acid--CoA ligase LcfA	A0A2H4PQM9	Staphylococcus_phage	2.7e-32	26.8
WP_003237674.1\|935867_936272_-	DUF350 domain-containing protein	NA	NA	NA	NA
WP_003229541.1\|936286_938644_-	endonuclease MutS2	Q94M10	Lactobacillus_phage	2.2e-16	43.4
WP_003229538.1\|938664_940377_-	DNA polymerase/3'-5' exonuclease PolX	E3T5M9	Cafeteria_roenbergensis_virus	1.4e-12	24.8

DBSCAN-SWA_67

944944 : 945979

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381256.1\|944944_945979_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	4.5e-30	33.2

DBSCAN-SWA_68

968335 : 968857

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010886591.1\|968335_968857_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	7.1e-16	36.5

DBSCAN-SWA_69

971991 : 982299

Enterobacteria_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229477.1\|971991_973773_-	two-component system sensor histidine kinase LytS	Q9EYF3	Enterobacteria_phage	7.0e-71	31.0
WP_004398978.1\|973939_974722_+	HAD family hydrolase	NA	NA	NA	NA
WP_003229473.1\|974762_976694_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	8.3e-110	34.3
WP_003229471.1\|977091_977937_-	putative sporulation protein YtxC	NA	NA	NA	NA
WP_003229468.1\|978015_978657_-	TVP38/TMEM64 family membrane protein YtxB	NA	NA	NA	NA
WP_003229466.1\|978690_979626_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	3.7e-39	34.1
WP_003229464.1\|979653_981072_-	replication initiation membrane attachment protein DnaB	NA	NA	NA	NA
WP_003223586.1\|981186_981645_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_003223584.1\|981918_982299_-	S-adenosylmethionine decarboxylase proenzyme	Q5GQE8	Synechococcus_phage	1.6e-17	41.8

DBSCAN-SWA_70

985543 : 996493

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229455.1\|985543_986386_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.2e-82	54.8
WP_004398928.1\|986427_987021_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_003229449.1\|987036_987669_-	sporulation membrane protein YtaF	NA	NA	NA	NA
WP_003246122.1\|987834_988665_-	DNA-formamidopyrimidine glycosylase	A0A127AWE5	Bacillus_phage	5.1e-24	31.6
WP_004398870.1\|988687_991330_-	DNA polymerase I	A0A0C5K9B9	Enterococcus_phage	2.9e-41	26.7
WP_004398493.1\|991573_993313_-	sensory box histidine kinase PhoR	W8CYF6	Bacillus_phage	1.4e-44	40.6
WP_003229442.1\|993305_994028_-	two-component system response regulator PhoP	W8CYM9	Bacillus_phage	3.5e-45	43.6
WP_003229437.1\|994239_995178_-	malate dehydrogenase	NA	NA	NA	NA
WP_003229433.1\|995221_996493_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-12	63.0

DBSCAN-SWA_71

1000294 : 1002052

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398560.1\|1000294_1002052_-	pyruvate kinase	A0A2H4PQU5	Staphylococcus_phage	1.0e-13	50.6

DBSCAN-SWA_72

1006775 : 1010123

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229412.1\|1006775_1010123_-	DNA polymerase III subunit alpha	A0A291AWR1	Streptomyces_phage	2.5e-178	36.1

DBSCAN-SWA_73

1016491 : 1020632

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229393.1\|1016491_1017184_-	RNA-binding riboflavin kinase RibR	A0A1V0SD03	Indivirus	1.5e-05	30.9
WP_004398733.1\|1017230_1018559_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_004399148.1\|1018555_1018837_-	glutaredoxin family protein	NA	NA	NA	NA
WP_004398798.1\|1018851_1019856_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_004398701.1\|1019852_1020632_-	sulfur-containing amino-acid ABC transporter ATP-binding protein TcyN	G9BWD6	Planktothrix_phage	6.9e-31	38.6

DBSCAN-SWA_74

1035546 : 1041161

Burkholderia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381263.1\|1035546_1036554_-	signal peptide peptidase SppA	Q6UYI0	Burkholderia_phage	1.9e-17	32.1
WP_004399091.1\|1036739_1037543_+	NAD kinase	NA	NA	NA	NA
WP_003229333.1\|1037574_1039164_-	amidohydrolase	NA	NA	NA	NA
WP_160216249.1\|1039183_1040773_-	acyl--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.9e-72	36.0
WP_003223491.1\|1040951_1041161_-	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	4.7e-19	76.9

DBSCAN-SWA_75

1049202 : 1055438

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229309.1\|1049202_1050942_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.8e-21	33.8
WP_003229307.1\|1051024_1051207_-	hypothetical protein	NA	NA	NA	NA
WP_003229304.1\|1051236_1051839_+	30S ribosomal protein S4	NA	NA	NA	NA
WP_003229300.1\|1052109_1053378_-\|tRNA	Tyrosine--tRNA ligase 1	K4F5T3	Cronobacter_phage	7.7e-80	43.7
WP_004399030.1\|1053719_1055438_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.1e-209	73.2

DBSCAN-SWA_76

1060951 : 1062028

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069964250.1\|1060951_1062028_-	3-deoxy-7-phosphoheptulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.6e-14	28.5

DBSCAN-SWA_77

1065232 : 1069681

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381265.1\|1065232_1068091_-	DNA translocase SftA	S5VNE3	Mycobacterium_phage	9.1e-89	49.6
WP_003229269.1\|1068250_1068856_-	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_009967991.1\|1068871_1069681_-	DUF1444 domain-containing protein	A0A2H4PQY3	Staphylococcus_phage	9.6e-36	54.5

DBSCAN-SWA_78

1081957 : 1087617

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229237.1\|1081957_1082893_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.5e-83	52.9
WP_004399126.1\|1082926_1084318_-	dipeptidase PepV	NA	NA	NA	NA
WP_003229234.1\|1084414_1085713_+	hypoxanthine/guanine permease PbuO	A0A0R6PHV4	Moraxella_phage	4.6e-48	32.8
WP_046381267.1\|1085752_1086910_-	ABC transporter permease	NA	NA	NA	NA
WP_046381268.1\|1086906_1087617_-	ABC transporter ATP-binding protein	M1I1A6	Acanthocystis_turfacea_Chlorella_virus	7.5e-08	25.9

DBSCAN-SWA_79

1090874 : 1093864

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082098094.1\|1090874_1092137_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	8.8e-28	57.9
WP_003229220.1\|1092325_1093864_+	glycine betaine transporter OpuD	A0A2I7QNT1	Vibrio_phage	1.2e-21	26.7

DBSCAN-SWA_80

1107690 : 1110196

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029318274.1\|1107690_1108860_-	8-amino-7-oxononanoate synthase	D2TEZ5	Emiliania_huxleyi_virus	2.1e-39	29.8
WP_029318275.1\|1108849_1110196_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	1.5e-12	29.7

DBSCAN-SWA_81

1118135 : 1127595

Staphylococcus_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381282.1\|1118135_1120550_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	73.7
WP_003246114.1\|1120976_1121312_-	DUF4257 domain-containing protein	NA	NA	NA	NA
WP_033884846.1\|1121716_1122502_+	blue-light photoreceptor	NA	NA	NA	NA
WP_046381283.1\|1122738_1123932_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	4.5e-106	52.0
WP_046381284.1\|1124120_1124867_+	membrane protein	NA	NA	NA	NA
WP_069704044.1\|1124903_1126844_-	bacitracin ABC transporter permease BceB	NA	NA	NA	NA
WP_003229137.1\|1126833_1127595_-	bacitracin ABC transporter ATP-binding protein BceA	G9BWD6	Planktothrix_phage	6.1e-32	35.8

DBSCAN-SWA_82

1130785 : 1153831

Staphylococcus_phage(58.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229129.1\|1130785_1131481_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-38	40.8
WP_004398887.1\|1131495_1132473_-	ABC transporter permease	NA	NA	NA	NA
WP_046381287.1\|1132502_1133489_-	ABC transporter permease YtrC	NA	NA	NA	NA
WP_003229123.1\|1133482_1134361_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-19	28.7
WP_003229121.1\|1134353_1134746_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003229119.1\|1134779_1134917_-	hypothetical protein	NA	NA	NA	NA
WP_003229117.1\|1135071_1135344_-	YtzC family protein	NA	NA	NA	NA
WP_009968016.1\|1135505_1136474_+	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	4.2e-54	75.2
WP_004398483.1\|1136470_1137055_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase	A0A2H4PQV0	Staphylococcus_phage	1.3e-45	52.1
WP_033882168.1\|1137044_1138148_-	tetraprenyl-beta-curcumene synthase	NA	NA	NA	NA
WP_046381288.1\|1138168_1138948_-	phospholipase YtpA	A0A220T682	Eptesipox_virus	3.6e-11	25.7
WP_046381289.1\|1138996_1139512_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_046381290.1\|1139757_1141149_-	amino acid permease	NA	NA	NA	NA
WP_004398625.1\|1141284_1143183_-	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	4.3e-34	29.4
WP_003229102.1\|1143332_1144535_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.3e-165	74.6
WP_003229100.1\|1145037_1146621_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	6.2e-196	64.2
WP_004398611.1\|1146659_1146902_-	DUF2584 domain-containing protein	NA	NA	NA	NA
WP_003246204.1\|1146953_1147727_-	S9 family peptidase	A0A2H4PQM6	Staphylococcus_phage	5.8e-38	41.9
WP_003245977.1\|1147877_1148882_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003229092.1\|1148894_1149677_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.4e-33	37.4
WP_003229090.1\|1149651_1150464_+	ABC transporter permease	NA	NA	NA	NA
WP_003229087.1\|1150490_1150967_-	nucleoside triphosphatase YtkD	NA	NA	NA	NA
WP_003229085.1\|1151175_1151580_-\|holin	holin family protein	NA	NA	NA	NA
WP_003229083.1\|1151745_1152183_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.3e-47	61.4
WP_010886599.1\|1152275_1152452_+	YtzI protein	NA	NA	NA	NA
WP_014480629.1\|1152445_1152883_-	FixH family protein	NA	NA	NA	NA
WP_003219361.1\|1153002_1153476_-	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_003229076.1\|1153603_1153831_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	2.8e-25	70.3

DBSCAN-SWA_83

1159773 : 1164317

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004398644.1\|1159773_1160526_-	manganese ABC transporter ATP-binding protein MntB	A0A1V0SE00	Indivirus	6.0e-16	27.1
WP_003229060.1\|1160544_1161465_-	manganese ABC transporter substrate-binding protein/adhesin MntA	NA	NA	NA	NA
WP_003229057.1\|1161744_1162860_-	o-succinylbenzoate synthase	NA	NA	NA	NA
WP_003229056.1\|1162856_1164317_-	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.0e-75	32.9

DBSCAN-SWA_84

1170241 : 1173465

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229044.1\|1170241_1171060_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	8.2e-51	42.2
WP_004398478.1\|1171231_1172518_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.0e-71	34.8
WP_029318306.1\|1172514_1173465_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	8.4e-31	32.9

DBSCAN-SWA_85

1179241 : 1181638

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399110.1\|1179241_1181638_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.5e-12	40.2

DBSCAN-SWA_86

1195979 : 1197509

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228960.1\|1195979_1197509_-	flotillin lipid rafts scaffold protein FloT	A0A2I2L4B2	Orpheovirus	2.7e-07	27.9

DBSCAN-SWA_87

1206347 : 1207196

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228938.1\|1206347_1207196_-	exo-glucosaminidase LytG	A0A0K2CP65	Brevibacillus_phage	1.0e-24	41.1

DBSCAN-SWA_88

1219611 : 1227977

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228913.1\|1219611_1221600_-	methyl-accepting chemotaxis protein TlpB	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-15	52.0
WP_015714603.1\|1221713_1223699_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.4e-26	32.2
WP_003228909.1\|1223824_1225813_-	methyl-accepting chemotaxis protein TlpA	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-16	60.7
WP_032677065.1\|1225988_1227977_-	methyl-accepting chemotaxis protein McpB	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-13	53.4

DBSCAN-SWA_89

1234399 : 1235386

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228881.1\|1234399_1235386_+	potassium channel protein KbfO	A0A1B0Y2S3	Lactobacillus_phage	4.8e-05	34.8

DBSCAN-SWA_90

1243125 : 1243947

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014480683.1\|1243125_1243947_+	alpha/beta hydrolase	A0A0B5A484	Mycobacterium_phage	3.3e-07	27.5

DBSCAN-SWA_91

1256628 : 1261661

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381296.1\|1256628_1258161_+	guanosine ABC transporter ATP-binding protein NupO	A0A2R8FG22	Brazilian_cedratvirus	1.8e-06	25.4
WP_029318495.1\|1258153_1259200_+	guanosine ABC transporter permease NupP	NA	NA	NA	NA
WP_046381297.1\|1259200_1260160_+	guanosine ABC transporter permease NupQ	NA	NA	NA	NA
WP_160216250.1\|1260314_1261661_+	sodium/malate symporter MaeN	A0A140XAH4	Dickeya_phage	8.8e-18	48.4

DBSCAN-SWA_92

1274986 : 1276459

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228788.1\|1274986_1276459_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	6.5e-107	45.8

DBSCAN-SWA_93

1285488 : 1289976

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381303.1\|1285488_1289976_-	type VII secretion protein EssC	V5UPA0	Mycobacterium_phage	1.0e-33	22.6

DBSCAN-SWA_94

1296091 : 1303228

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381304.1\|1296091_1303228_-	nonribosomal peptide synthetase DhbF	A0A2K9KZV5	Tupanvirus	1.4e-98	26.9

DBSCAN-SWA_95

1311988 : 1326296

Mycoplasma_phage(14.29%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015251314.1\|1311988_1313491_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	9.8e-58	35.3
WP_003244337.1\|1313648_1314125_+	divergent PAP2 family protein	NA	NA	NA	NA
WP_009969090.1\|1314154_1314811_-	stationary phase survival protein SpsC	A0A217ER34	Bacillus_phage	7.4e-10	31.8
WP_003243877.1\|1314914_1315235_-	membrane protein	NA	NA	NA	NA
WP_003243733.1\|1315288_1315432_-	YuiA family protein	NA	NA	NA	NA
WP_010886605.1\|1315604_1316825_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003220618.1\|1317156_1318155_+	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	4.7e-32	52.4
WP_061891019.1\|1318194_1318335_-	hypothetical protein	NA	NA	NA	NA
WP_029725886.1\|1318613_1319594_+	GMP reductase	G3MBI2	Bacillus_virus	1.5e-163	85.8
WP_032726806.1\|1319667_1320291_-\|protease	protease synthase/sporulation negative transcriptional regulator PaiB	NA	NA	NA	NA
WP_046381306.1\|1320314_1320833_-	spermidine/spermine N(1)-acetyltransferase	NA	NA	NA	NA
WP_003244166.1\|1321173_1321536_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	1.4e-18	45.3
WP_003243745.1\|1321614_1322469_-	diaminopimelate epimerase	NA	NA	NA	NA
WP_003228710.1\|1322591_1323806_-	NupC/NupG family nucleoside CNT transporter	B2YG43	Musca_hytrovirus	1.6e-13	22.3
WP_003222913.1\|1323942_1324179_-	YuzB family protein	NA	NA	NA	NA
WP_003242518.1\|1324441_1325509_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003242597.1\|1325534_1325861_-	YuzD family protein	NA	NA	NA	NA
WP_003151955.1\|1326059_1326296_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.9e-09	44.3

DBSCAN-SWA_96

1333076 : 1333577

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243814.1\|1333076_1333577_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.2e-41	56.0

DBSCAN-SWA_97

1337029 : 1338010

Microcystis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243462.1\|1337029_1338010_+	L-Ala--D-Glu endopeptidase	A0A075BS18	Microcystis_phage	3.0e-07	37.3

DBSCAN-SWA_98

1346076 : 1348724

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243942.1\|1346076_1347426_+	uric acid permease PucJ	Q9KX94	Enterobacteria_phage	1.8e-26	28.3
WP_046381309.1\|1347431_1348724_+	uric acid permease PucK	Q9KX94	Enterobacteria_phage	1.4e-25	29.0

DBSCAN-SWA_99

1360586 : 1361690

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228630.1\|1360586_1361690_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	3.8e-19	28.6

DBSCAN-SWA_100

1366683 : 1367670

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243688.1\|1366683_1367670_-	SIS domain-containing protein	A0A2L2DN46	Acanthamoeba_polyphaga_mimivirus	1.9e-09	23.6

DBSCAN-SWA_101

1372584 : 1382503

Mycobacterium_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003222809.1\|1372584_1373028_-	iron-sulfur cluster assembly scaffold protein SufU	A0A2P1CJL8	Mycobacterium_phage	1.9e-14	38.7
WP_003228604.1\|1373017_1374238_-	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	3.4e-117	47.8
WP_003228602.1\|1374237_1375551_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003151872.1\|1375568_1376354_-	Fe-S cluster assembly ATPase SufC	W5SAS9	Pithovirus	3.5e-06	22.7
WP_003228600.1\|1376547_1376685_-	hypothetical protein	NA	NA	NA	NA
WP_003228596.1\|1376878_1377256_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_003228595.1\|1377340_1378165_-	methionine ABC transporter substrate-binding lipoprotein MetQ	NA	NA	NA	NA
WP_003228593.1\|1378178_1378847_-	methionine ABC transporter permease MetP	NA	NA	NA	NA
WP_003242531.1\|1378839_1379865_-	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-31	36.5
WP_003228587.1\|1380191_1380536_-	hypothetical protein	NA	NA	NA	NA
WP_003228585.1\|1380642_1380963_-	thioredoxin family protein	NA	NA	NA	NA
WP_009968134.1\|1380964_1381405_-	toprim domain-containing protein	NA	NA	NA	NA
WP_003228581.1\|1381404_1381641_-	YusG family protein	NA	NA	NA	NA
WP_003222781.1\|1381696_1382080_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_003222779.1\|1382146_1382503_-	arsenate reductase family protein	M1PLC0	Streptococcus_phage	1.8e-23	54.6

DBSCAN-SWA_102

1388313 : 1389222

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015714674.1\|1388313_1389222_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	2.3e-62	42.2

DBSCAN-SWA_103

1392592 : 1395513

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033884687.1\|1392592_1393333_-	SDR family NAD(P)-dependent oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.3e-12	28.3
WP_015714676.1\|1393466_1394354_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003228549.1\|1394373_1394661_-	YusU family protein	NA	NA	NA	NA
WP_010886609.1\|1394685_1395513_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.4e-10	25.7

DBSCAN-SWA_104

1399140 : 1401977

Clostridium_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228537.1\|1399140_1399602_+	metalloregulation DNA-binding stress protein MgrA	A0A0A7RTZ1	Clostridium_phage	9.1e-31	49.6
WP_003228534.1\|1399645_1401022_-\|protease	serine protease Do-like protein HtrB	A0A1B1IT49	uncultured_Mediterranean_phage	2.3e-21	30.4
WP_003228529.1\|1401299_1401977_+	secretion stress-responsive two-component system response regulator CssR	W8CYM9	Bacillus_phage	2.4e-27	34.1

DBSCAN-SWA_105

1416720 : 1419110

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080481007.1\|1416720_1418049_-	ATP-binding cassette domain-containing protein	A0A2H4UU96	Bodo_saltans_virus	4.8e-08	25.8
WP_046381317.1\|1418048_1419110_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	5.0e-16	25.9

DBSCAN-SWA_106

1422193 : 1424646

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381321.1\|1422193_1423936_-	two-component system sensor histidine kinase YvrG	W8CYF6	Bacillus_phage	1.3e-16	24.2
WP_003243545.1\|1423932_1424646_-	two-component system response regulator YvrH	W8CYM9	Bacillus_phage	7.9e-34	36.5

DBSCAN-SWA_107

1428929 : 1431777

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041333113.1\|1428929_1429619_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-40	42.3
WP_046381323.1\|1429602_1430796_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003243882.1\|1430967_1431777_-	ABC transporter ATP-binding protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	1.1e-10	26.9

DBSCAN-SWA_108

1437351 : 1443159

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228444.1\|1437351_1437834_+	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	1.3e-08	31.4
WP_046381328.1\|1437933_1439787_+	LTA synthase family protein	W6LM83	Streptococcus_phage	8.6e-88	35.1
WP_046381508.1\|1439815_1440742_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_160216251.1\|1440852_1441635_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_121509434.1\|1441606_1442299_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_048655206.1\|1442328_1443159_-	glyoxal/methylglyoxal reductase	A0A2H4PQR8	Staphylococcus_phage	7.0e-82	57.1

DBSCAN-SWA_109

1455362 : 1460042

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139127062.1\|1455362_1457471_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.5e-112	35.4
WP_046381336.1\|1457630_1460042_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-120	37.8

DBSCAN-SWA_110

1467763 : 1484060

Thermus_phage(28.57%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003220025.1\|1467763_1468234_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
WP_003228386.1\|1468378_1470718_-	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-87	42.9
WP_003242610.1\|1470736_1471477_-	carboxylesterase	NA	NA	NA	NA
WP_003220028.1\|1471608_1471839_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_003228381.1\|1471987_1472758_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_009968172.1\|1472797_1473031_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003220034.1\|1473182_1473590_+	transcriptional repressor RghR	S6C481	Thermus_phage	1.9e-16	64.8
WP_003228377.1\|1473619_1474039_+	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
WP_003242888.1\|1474130_1474457_+	catDE operon transcriptional regulator CatR	NA	NA	NA	NA
WP_046381339.1\|1474584_1476285_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.4e-25	30.1
WP_003228374.1\|1476325_1477006_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_069704014.1\|1477022_1477943_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_046381341.1\|1477954_1478608_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_046381342.1\|1478624_1479770_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.3
WP_014478002.1\|1480053_1480587_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_015714713.1\|1480618_1481293_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_015384655.1\|1481310_1482222_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228349.1\|1482241_1482895_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|1482917_1484060_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_111

1489622 : 1490915

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228333.1\|1489622_1490915_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.4e-175	71.5

DBSCAN-SWA_112

1504723 : 1505758

Microbacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069704016.1\|1504723_1505758_-	glycosylase	A0A2P1CFB9	Microbacterium_phage	9.8e-09	24.9

DBSCAN-SWA_113

1511420 : 1512326

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080481003.1\|1511420_1512326_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-23	32.7

DBSCAN-SWA_114

1521734 : 1522727

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244199.1\|1521734_1522727_-	galactan degradation operon transcriptional regulator GanR	C6ZCU4	Enterobacteria_phage	8.0e-08	22.3

DBSCAN-SWA_115

1528140 : 1529307

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029725953.1\|1528140_1529307_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	7.4e-29	32.4

DBSCAN-SWA_116

1537495 : 1552137

Catovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228255.1\|1537495_1538332_-	glycosyltransferase EpsE	A0A1V0SAH6	Catovirus	1.7e-14	39.6
WP_061891011.1\|1538328_1539474_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_015251176.1\|1539485_1541282_-	polysaccharide biosynthesis protein	K7Y9E1	Megavirus	2.6e-25	30.6
WP_003228249.1\|1541540_1542224_-	protein tyrosine kinase EpsB	NA	NA	NA	NA
WP_003228247.1\|1542229_1542934_-	hypothetical protein	NA	NA	NA	NA
WP_048654996.1\|1543179_1543638_+	transcriptional regulator SlrR	NA	NA	NA	NA
WP_048654997.1\|1543712_1545182_+	para-nitrobenzyl esterase	A0A0M4JT58	Mollivirus	1.1e-37	33.8
WP_048654998.1\|1545184_1545376_+	hypothetical protein	NA	NA	NA	NA
WP_015384708.1\|1545403_1545889_-	phenolic acid decarboxylase	NA	NA	NA	NA
WP_046160878.1\|1545911_1546367_-	DUF3237 domain-containing protein	NA	NA	NA	NA
WP_015251173.1\|1546498_1547182_-	broad specificity amino-acid racemase RacX	NA	NA	NA	NA
WP_015251172.1\|1547197_1548553_-	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.3e-13	23.7
WP_001022105.1\|1549091_1550513_+	levansucrase	NA	NA	NA	NA
WP_048654999.1\|1550586_1552137_+	2,6-beta-fructan 6-levanbiohydrolase	F8WPR5	Bacillus_phage	3.4e-98	42.9

DBSCAN-SWA_117

1559307 : 1560638

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228214.1\|1559307_1559901_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.6e-54	55.8
WP_048655002.1\|1559963_1560638_-	beta-phosphoglucomutase	A7ITQ4	Paramecium_bursaria_Chlorella_virus	9.2e-08	26.2

DBSCAN-SWA_118

1572024 : 1574656

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228180.1\|1572024_1572600_-	LOG family protein YvdD	A0A1V0S9E9	Catovirus	3.8e-10	27.1
WP_019712402.1\|1572716_1573037_+	hypothetical protein	G3MBI9	Bacillus_virus	3.9e-17	42.3
WP_003244488.1\|1573063_1574656_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.5e-45	28.2

DBSCAN-SWA_119

1578580 : 1579360

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228167.1\|1578580_1579360_-	lantibiotic ABC transporter ATP-binding protein PsdA	G9BWD6	Planktothrix_phage	3.2e-28	34.4

DBSCAN-SWA_120

1582657 : 1592586

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243775.1\|1582657_1583608_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	5.6e-51	38.4
WP_003244450.1\|1583630_1584584_-	gluconeogenesis morphogenetic factor	A1IMD5	Streptococcus_phage	4.0e-65	41.1
WP_003243903.1\|1584585_1585473_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	8.7e-06	28.0
WP_010886622.1\|1585497_1585974_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_003228139.1\|1586292_1587243_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.0e-88	54.2
WP_014481004.1\|1587447_1588857_-	peptidoglycan DL-endopeptidase CwlO	A0A0A0RVE6	Bacillus_phage	1.6e-25	52.6
WP_015251148.1\|1589236_1590691_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_061891008.1\|1590816_1592586_-	multidrug resistance ABC transporter ATP-binding protein/permease BmrA	W8CYL7	Bacillus_phage	1.1e-164	59.3

DBSCAN-SWA_121

1617933 : 1618680

Powai_lake_megavirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242712.1\|1617933_1618680_-\|tRNA	tRNA-dependent cyclodipeptide synthase	A0A167R1P4	Powai_lake_megavirus	1.3e-05	20.8

DBSCAN-SWA_122

1624176 : 1627050

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228057.1\|1624176_1627050_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.5

DBSCAN-SWA_123

1636467 : 1639619

Moraxella_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228041.1\|1636467_1637910_-\|protease	carboxy-terminal processing protease CtpB	A0A0R6PIZ1	Moraxella_phage	6.3e-22	27.8
WP_009968247.1\|1638049_1638940_-	ABC transporter permease	NA	NA	NA	NA
WP_003228039.1\|1638932_1639619_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.7e-25	34.0

DBSCAN-SWA_124

1650157 : 1650382

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003219727.1\|1650157_1650382_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	2.6e-07	50.0

DBSCAN-SWA_125

1656278 : 1661518

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243962.1\|1656278_1657670_-	ATP-dependent helicase ComFA	A0A1X9I5S6	Streptococcus_phage	1.1e-66	37.6
WP_003244125.1\|1657775_1658621_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	7.5e-15	34.6
WP_003219701.1\|1658718_1659408_-	two-component system response regulator DegU	NA	NA	NA	NA
WP_003227983.1\|1659490_1660648_-	two-component sensor histidine kinase DegS	NA	NA	NA	NA
WP_003227979.1\|1660864_1661518_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	5.8e-39	43.1

DBSCAN-SWA_126

1665208 : 1669636

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242619.1\|1665208_1665967_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	9.4e-17	35.4
WP_003243110.1\|1665990_1666671_-	teichuronic acid biosynthesis protein TuaF	NA	NA	NA	NA
WP_010886625.1\|1666699_1668166_-	hypothetical protein	NA	NA	NA	NA
WP_080481010.1\|1668250_1669636_-	UDP-glucose 6-dehydrogenase TuaD	A0A127AXI2	Bacillus_phage	5.8e-89	42.1

DBSCAN-SWA_127

1673256 : 1690137

Paenibacillus_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242758.1\|1673256_1674747_-	N-acetylmuramoyl-L-alanine amidase LytC	A0A0N9SGH1	Paenibacillus_phage	3.3e-21	39.4
WP_003243620.1\|1674785_1676903_-	SpoIID/LytB domain-containing protein	Q2XU88	Pseudomonas_phage	6.7e-12	27.6
WP_003242772.1\|1676926_1677235_-	membrane-bound protein LytA	NA	NA	NA	NA
WP_003227949.1\|1677418_1678339_+	transcription antiterminator LytR	NA	NA	NA	NA
WP_003243178.1\|1678378_1679521_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.6e-26	33.0
WP_003227944.1\|1679766_1680645_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.3e-82	54.7
WP_046381366.1\|1681135_1681912_-	hypothetical protein	D7RWE8	Brochothrix_phage	4.1e-36	35.5
WP_052728189.1\|1681908_1684593_-	bifunctional glycosyltransferase family 2 protein/CDP-glycerol:glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
WP_033884186.1\|1684636_1685983_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	3.4e-09	38.6
WP_128484071.1\|1687223_1687355_-	adenylyltransferase/cytidyltransferase family protein	NA	NA	NA	NA
WP_046381367.1\|1688553_1690137_-	teichoic acids export ABC transporter ATP-binding subunit TagH	A0A2H4PQG7	Staphylococcus_phage	4.7e-18	29.0

DBSCAN-SWA_128

1695583 : 1702471

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227921.1\|1695583_1695973_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	1.7e-17	42.6
WP_003227919.1\|1696372_1697143_+	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D- mannosaminyltransferase	NA	NA	NA	NA
WP_009968271.1\|1697175_1698321_+	teichoic acid glycerol-phosphate primase	NA	NA	NA	NA
WP_033884187.1\|1698440_1699769_+	teichoic acid biosynthesis protein	A0A1J0MII7	Staphylococcus_phage	6.2e-24	29.3
WP_046381370.1\|1699828_1702471_-	beta-N-acetylglucosaminidase LytD	Q4ZC50	Staphylococcus_virus	2.3e-38	44.9

DBSCAN-SWA_129

1707536 : 1712502

Aichi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243731.1\|1707536_1708910_-	sugar porter family MFS transporter	O13311	Aichi_virus	3.9e-37	30.7
WP_003243404.1\|1709242_1710211_+	polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase TagT	NA	NA	NA	NA
WP_003244395.1\|1710366_1711227_+	HAD family phosphatase	NA	NA	NA	NA
WP_003242751.1\|1711260_1712502_-	gamma-DL-glutamyl hydrolase	S5MM68	Bacillus_phage	1.4e-17	42.0

DBSCAN-SWA_130

1718685 : 1720167

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244379.1\|1718685_1720167_+	ribose ABC transporter ATP-binding protein RbsA	W6JKT0	Anomala_cuprea_entomopoxvirus	6.5e-14	27.0

DBSCAN-SWA_131

1726502 : 1728950

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227859.1\|1726502_1727411_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.9e-14	25.6
WP_029318749.1\|1727621_1728950_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	8.4e-45	29.5

DBSCAN-SWA_132

1739506 : 1757536

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381377.1\|1739506_1740220_-	endonuclease V	A0A1V0SJW5	Klosneuvirus	3.8e-20	29.4
WP_014481129.1\|1740340_1740694_-	hypothetical protein	NA	NA	NA	NA
WP_021480772.1\|1741827_1742037_-	hypothetical protein	NA	NA	NA	NA
WP_041334792.1\|1742050_1742569_-	hypothetical protein	NA	NA	NA	NA
WP_046381378.1\|1742576_1744388_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	2.7e-38	35.5
WP_046381379.1\|1744406_1744667_-	YwqI/YxiC family protein	NA	NA	NA	NA
WP_010332155.1\|1744676_1745099_-	DUF5082 domain-containing protein	NA	NA	NA	NA
WP_128484073.1\|1745288_1745441_-	hypothetical protein	NA	NA	NA	NA
WP_033885053.1\|1745490_1746276_-	DUF1963 domain-containing protein	NA	NA	NA	NA
WP_015251054.1\|1746476_1747799_-	UDP-glucose 6-dehydrogenase UglF	A0A127AXI2	Bacillus_phage	1.8e-87	39.3
WP_033885052.1\|1747993_1748758_-	tyrosine-protein phosphatase	NA	NA	NA	NA
WP_046381380.1\|1748810_1749524_-	tyrosine-protein kinase PtkA	A0A1X9I5D6	Streptococcus_phage	1.1e-27	38.7
WP_003227811.1\|1749513_1750260_-	protein-tyrosine kinase activator TkmA	NA	NA	NA	NA
WP_003242876.1\|1750492_1750636_-	hypothetical protein	NA	NA	NA	NA
WP_033885050.1\|1750839_1752450_+	SWIM zinc finger family protein	NA	NA	NA	NA
WP_046381381.1\|1752436_1755205_+	DEAD/DEAH box helicase	V9XTV7	Choristoneura_murinana_nucleopolyhedrovirus	2.9e-39	27.5
WP_046381382.1\|1755330_1756188_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003244075.1\|1756193_1756970_-	transcriptional regulator GlcR	NA	NA	NA	NA
WP_014478203.1\|1757194_1757536_-	single-stranded DNA-binding protein	A8ASP5	Listeria_phage	2.0e-35	66.0

DBSCAN-SWA_133

1765403 : 1765685

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003221804.1\|1765403_1765685_-	sporulation transcriptional regulator SpoIIID	M9Q261	Clostridium_phage	9.4e-15	50.7

DBSCAN-SWA_134

1776677 : 1777550

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381387.1\|1776677_1777550_-	stage II sporulation protein spoIIQ	I3PV24	Clostridium_phage	1.1e-05	36.1

DBSCAN-SWA_135

1787998 : 1789132

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227715.1\|1787998_1789132_-	response regulator aspartate phosphatase RapB	A0A1P8CWN8	Bacillus_phage	1.7e-86	45.5

DBSCAN-SWA_136

1793721 : 1794753

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029318715.1\|1793721_1794753_-	stage II sporulation protein D	Q2XU88	Pseudomonas_phage	1.0e-42	40.6

DBSCAN-SWA_137

1806187 : 1811007

Aeromonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227669.1\|1806187_1807435_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.5e-99	51.7
WP_029318713.1\|1807641_1808184_-	TIGR01440 family protein	NA	NA	NA	NA
WP_029318712.1\|1808196_1808646_-	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_015384897.1\|1808802_1809255_-	low molecular weight protein arginine phosphatase	NA	NA	NA	NA
WP_003227661.1\|1809330_1809888_-	manganese efflux pump	NA	NA	NA	NA
WP_015251011.1\|1809966_1811007_-	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	2.2e-61	42.6

DBSCAN-SWA_138

1814082 : 1815153

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227645.1\|1814082_1815153_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	40.0

DBSCAN-SWA_139

1819402 : 1819990

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017696004.1\|1819402_1819990_-	thymidine kinase	G3MBK1	Bacillus_virus	3.1e-36	45.9

DBSCAN-SWA_140

1824751 : 1829298

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227626.1\|1824751_1825390_-	fructose-6-phosphate aldolase	A0A0E3FQP8	Synechococcus_phage	7.3e-47	45.0
WP_003243339.1\|1825509_1826367_-	fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_003227621.1\|1826547_1826922_-	sporulation initiation phosphotransferase Spo0F	W8CYM9	Bacillus_phage	2.9e-11	36.5
WP_029318708.1\|1827087_1827609_+	DUF2529 domain-containing protein	NA	NA	NA	NA
WP_003227612.1\|1827690_1829298_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-153	52.1

DBSCAN-SWA_141

1834860 : 1838479

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381394.1\|1834860_1835823_+	UV DNA damage repair endonuclease UvsE	A0A0G2Y997	Acanthamoeba_polyphaga_mimivirus	6.5e-31	32.7
WP_003227597.1\|1835903_1836176_+	hypothetical protein	NA	NA	NA	NA
WP_003227595.1\|1836217_1836742_-	dihydrofolate reductase	NA	NA	NA	NA
WP_044052434.1\|1836751_1838479_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-60	31.2

DBSCAN-SWA_142

1841809 : 1843273

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481212.1\|1841809_1843273_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	4.2e-21	43.6

DBSCAN-SWA_143

1850648 : 1925967

Bacillus_phage(26.67%)

bacteriocin,protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227570.1\|1850648_1852319_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003243604.1\|1852315_1852744_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|1853056_1853188_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|1853144_1853297_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_015714887.1\|1853321_1854668_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|1854680_1854842_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_003227564.1\|1854838_1855558_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
WP_046381398.1\|1855550_1856861_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_080481011.1\|1856850_1858011_+	insulinase family protein	NA	NA	NA	NA
WP_046381400.1\|1858015_1859296_+	insulinase family protein	NA	NA	NA	NA
WP_029726080.1\|1859292_1859994_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_046381401.1\|1859999_1861376_-	YncE family protein	NA	NA	NA	NA
WP_069704038.1\|1861415_1862771_-	YncE family protein	NA	NA	NA	NA
WP_015250985.1\|1863000_1864146_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	5.0e-78	43.0
WP_009968329.1\|1864129_1864249_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_003227545.1\|1864840_1865713_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|1865773_1866604_-	spermidine synthase	NA	NA	NA	NA
WP_029726084.1\|1866806_1868882_+	penicillin-binding protein	NA	NA	NA	NA
WP_014478299.1\|1868909_1869344_-	hypothetical protein	NA	NA	NA	NA
WP_003244446.1\|1869482_1870001_-	hypothetical protein	NA	NA	NA	NA
WP_003243167.1\|1870014_1870674_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|1870782_1870971_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_003227535.1\|1871013_1871433_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_046381404.1\|1871552_1873469_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	6.2e-142	43.2
WP_046381405.1\|1874302_1875712_-	MFS transporter	NA	NA	NA	NA
WP_017696247.1\|1875711_1876182_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|1876293_1876794_-	YwgA family protein	NA	NA	NA	NA
WP_024571616.1\|1876829_1878131_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|1878292_1878517_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003243464.1\|1878731_1879508_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_042975435.1\|1879651_1880542_-	DMT family transporter	NA	NA	NA	NA
WP_024571618.1\|1880709_1881555_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_014481233.1\|1881603_1882503_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_003235941.1\|1882648_1883620_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003242896.1\|1883889_1884654_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_042975433.1\|1884786_1885566_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_014481235.1\|1885580_1886780_-	transaminase BacF	NA	NA	NA	NA
WP_014481236.1\|1886780_1887965_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_003242921.1\|1887961_1889380_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_046381517.1\|1889398_1890160_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-22	31.3
WP_003244300.1\|1890162_1890870_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_009968341.1\|1890859_1891474_-	prephenate decarboxylase	NA	NA	NA	NA
WP_046381406.1\|1891625_1892864_-	MFS transporter	NA	NA	NA	NA
WP_046381407.1\|1893073_1894486_-	amino acid permease	NA	NA	NA	NA
WP_046160966.1\|1894485_1896186_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_014478322.1\|1896259_1897807_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_014665807.1\|1898033_1899308_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_003227472.1\|1899483_1899948_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_014481242.1\|1900271_1900727_-\|coat	spore coat polysaccharide biosynthesis protein SpsL	NA	NA	NA	NA
WP_046381408.1\|1900719_1901571_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	39.3
WP_003244201.1\|1901584_1902532_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_014478328.1\|1902531_1903272_-	NTP transferase domain-containing protein	I7I009	Enterobacteria_phage	4.5e-48	41.9
WP_046381409.1\|1903296_1904316_-\|coat	spore coat protein	NA	NA	NA	NA
WP_046381410.1\|1904318_1905041_-\|coat	spore coat protein	NA	NA	NA	NA
WP_046381411.1\|1905033_1906155_-\|coat	spore coat protein	NA	NA	NA	NA
WP_014481248.1\|1906154_1907024_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_046381412.1\|1907024_1908194_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	9.4e-16	28.1
WP_046381413.1\|1908214_1909639_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_021480921.1\|1909643_1910414_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	2.6e-06	28.6
WP_014481253.1\|1910733_1911279_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003227446.1\|1911322_1911694_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_015384975.1\|1911755_1913078_-	purine permease	NA	NA	NA	NA
WP_046161096.1\|1913097_1913415_-	YwdI family protein	NA	NA	NA	NA
WP_046381414.1\|1913582_1914953_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_014478341.1\|1914977_1915655_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	1.8e-48	45.7
WP_069703977.1\|1915668_1916475_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_014665830.1\|1916665_1917481_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003243437.1\|1917570_1917819_-	hypothetical protein	NA	NA	NA	NA
WP_069703976.1\|1917912_1919352_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	4.1e-21	26.7
WP_069703975.1\|1919348_1920734_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_069703974.1\|1921035_1921806_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003227423.1\|1921844_1922675_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|1922714_1923017_-	hypothetical protein	NA	NA	NA	NA
WP_046381416.1\|1923546_1925967_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	5.3e-21	38.2

DBSCAN-SWA_144

1951486 : 1952674

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381422.1\|1951486_1952674_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	7.7e-74	42.0

DBSCAN-SWA_145

1957418 : 1962971

Bacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381425.1\|1957418_1959356_+\|protease	minor protease Epr	A0A1B0T6A2	Bacillus_phage	1.1e-45	34.9
WP_046381426.1\|1959782_1961162_+	SacY negative regulator SacX	NA	NA	NA	NA
WP_046381427.1\|1961215_1962058_+	transcription antiterminator	NA	NA	NA	NA
WP_015714932.1\|1962110_1962971_-	glycosyltransferase family 8 protein	A0A2P0VP84	Tetraselmis_virus	2.9e-06	27.2

DBSCAN-SWA_146

1972465 : 1975161

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041054155.1\|1972465_1973977_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	1.7e-46	29.3
WP_046381433.1\|1973973_1975161_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	2.3e-22	27.9

DBSCAN-SWA_147

1985187 : 1989793

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381437.1\|1985187_1986831_+	catalase	A0A2K9L572	Tupanvirus	6.2e-98	45.2
WP_046381438.1\|1986933_1988136_+	MFS transporter	NA	NA	NA	NA
WP_046381439.1\|1988132_1988909_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_033882875.1\|1988905_1989793_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-27	33.2

DBSCAN-SWA_148

1993552 : 1996980

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381442.1\|1993552_1995280_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	1.4e-23	24.0
WP_046381443.1\|1995276_1996980_-	thiol reductant ABC exporter subunit CydD	A0A2H4UU96	Bodo_saltans_virus	1.6e-16	31.1

DBSCAN-SWA_149

2004350 : 2011180

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242648.1\|2004350_2005448_-	maltodextrin ABC transporter ATP-binding protein MsmX	G9BWD6	Planktothrix_phage	2.4e-21	31.2
WP_019712848.1\|2005568_2006462_-	PucR family transcriptional regulator	NA	NA	NA	NA
WP_069703971.1\|2006645_2008103_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_003242615.1\|2008144_2008981_-	YitT family protein	M1Q1P6	Streptococcus_phage	1.0e-40	33.6
WP_121549361.1\|2009549_2010089_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_003244356.1\|2010160_2011180_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	8.5e-98	51.4

DBSCAN-SWA_150

2016702 : 2019225

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244296.1\|2016702_2017836_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	1.2e-89	46.5
WP_003244221.1\|2018088_2019225_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	2.4e-88	46.1

DBSCAN-SWA_151

2026879 : 2028940

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046161020.1\|2026879_2028940_-	catalase	A0A2K9L0T1	Tupanvirus	7.6e-154	52.7

DBSCAN-SWA_152

2034722 : 2036162

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019712854.1\|2034722_2036162_-	ATP-dependent RNA helicase DbpA	A0A1B1IS59	uncultured_Mediterranean_phage	6.9e-61	36.1

DBSCAN-SWA_153

2060787 : 2062314

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243255.1\|2060787_2062314_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.3e-93	39.5

DBSCAN-SWA_154

2067743 : 2069045

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243952.1\|2067743_2069045_-	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.6e-133	61.5

DBSCAN-SWA_155

2076763 : 2077513

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243284.1\|2076763_2077513_-	amino acid ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	6.0e-16	28.7

DBSCAN-SWA_156

2081277 : 2082264

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243495.1\|2081277_2082264_-	penicillin V amidase	M1H9I8	Acanthocystis_turfacea_Chlorella_virus	1.6e-29	31.1

DBSCAN-SWA_157

2089126 : 2089900

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243557.1\|2089126_2089900_-	ABC transporter ATP-binding protein YxdL	G9BWD6	Planktothrix_phage	1.5e-30	37.3

DBSCAN-SWA_158

2108170 : 2110051

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243561.1\|2108170_2110051_-	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	6.2e-94	33.5

DBSCAN-SWA_159

2117667 : 2119911

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216256.1\|2117667_2119911_+	asparagine synthase (glutamine-hydrolyzing)	F2Y2L7	Organic_Lake_phycodnavirus	7.1e-28	29.4

DBSCAN-SWA_160

2130814 : 2131963

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381464.1\|2130814_2131963_-	glycerate kinase	W6LM47	Streptococcus_phage	1.8e-48	41.9

DBSCAN-SWA_161

2135821 : 2139800

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019712613.1\|2135821_2137228_+	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	6.0e-33	30.9
WP_003243686.1\|2137693_2138257_+	peroxiredoxin	NA	NA	NA	NA
WP_003226996.1\|2138270_2139800_+	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.0e-33	29.3

DBSCAN-SWA_162

2146787 : 2148278

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381468.1\|2146787_2148278_-	hypothetical protein	A0A1S5SA14	Streptococcus_phage	2.2e-33	31.5

DBSCAN-SWA_163

2151934 : 2153161

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481458.1\|2151934_2153161_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	29.3

DBSCAN-SWA_164

2156390 : 2161636

Klosneuvirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014481464.1\|2156390_2157488_+	response regulator aspartate phosphatase RapG	D6R410	Bacillus_phage	6.0e-73	39.3
WP_003226961.1\|2157488_2157605_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_003226959.1\|2157841_2158732_-	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
WP_014481465.1\|2158804_2160208_-	amino acid permease	NA	NA	NA	NA
WP_033882007.1\|2160430_2161636_-	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5

DBSCAN-SWA_165

2164942 : 2182151

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015715052.1\|2164942_2165227_-	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
WP_003244510.1\|2165453_2166839_+	arginine utilization regulatory protein RocR	NA	NA	NA	NA
WP_046381472.1\|2166820_2168287_-	HAMP domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	4.3e-34	37.2
WP_038428106.1\|2168283_2168967_-	response regulator transcription factor	A0A1J0GWE0	Alteromonas_phage	6.1e-07	31.0
WP_046381473.1\|2169178_2170078_+	peptidase	NA	NA	NA	NA
WP_046381474.1\|2170238_2170739_+	peptidase	NA	NA	NA	NA
WP_046381475.1\|2170882_2172085_-\|protease	serine protease HtrC	W5SAB9	Pithovirus	5.9e-13	40.4
WP_046381476.1\|2172166_2172961_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	9.8e-41	35.6
WP_003244037.1\|2172982_2173825_-	WalRK two-component regulatory system regulator WalI	NA	NA	NA	NA
WP_042976993.1\|2173811_2175179_-	WalRK two-component regulatory system regulator WalH	NA	NA	NA	NA
WP_024572714.1\|2175168_2177004_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.8e-36	33.5
WP_003244363.1\|2177011_2177719_-	cell wall metabolism DNA-binding response regulator WalR	W8CYM9	Bacillus_phage	3.4e-45	41.2
WP_003226929.1\|2178749_2180042_-	adenylosuccinate synthase	G5CQQ4	Megavirus	3.1e-68	35.9
WP_046381477.1\|2180247_2180667_-	VOC family protein	NA	NA	NA	NA
WP_003226923.1\|2180786_2182151_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.6e-128	54.8

DBSCAN-SWA_166

2203838 : 2204360

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029318530.1\|2203838_2204360_-	streptothricin N-acetyltransferase SatA	A0A1B0RXL7	Streptococcus_phage	8.1e-44	47.2

DBSCAN-SWA_167

2210144 : 2214240

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216258.1\|2210144_2211656_+	recombinase family protein	A0A0N9RZT8	Staphylococcus_phage	8.6e-38	29.0
WP_144486887.1\|2211688_2212057_-	hypothetical protein	NA	NA	NA	NA
WP_160216296.1\|2212286_2212667_-	DUF4467 domain-containing protein	NA	NA	NA	NA
WP_160216259.1\|2212729_2213236_-	hypothetical protein	NA	NA	NA	NA
WP_160216260.1\|2213250_2214240_-	transglycosylase SLT domain-containing protein	A0A1S5SEZ8	Streptococcus_phage	3.2e-65	43.2

DBSCAN-SWA_168

2223675 : 2233921

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216267.1\|2223675_2224734_-	replication initiation factor domain-containing protein	A0A1S5SEX3	Streptococcus_phage	7.8e-62	40.4
WP_160216268.1\|2224726_2226169_-	coupling conjugation protein ConQ	A0A1S5SFB5	Streptococcus_phage	4.7e-118	50.2
WP_009966619.1\|2226204_2226585_-	helicase processivity factor HelP	NA	NA	NA	NA
WP_119122843.1\|2226620_2226749_-	hypothetical protein	NA	NA	NA	NA
WP_160216269.1\|2226954_2227215_-	hypothetical protein	NA	NA	NA	NA
WP_160216270.1\|2227268_2227529_-	hypothetical protein	NA	NA	NA	NA
WP_019716390.1\|2227525_2227705_-	hypothetical protein	Q8SBM7	Clostridium_phage	5.4e-08	51.9
WP_129093547.1\|2228000_2228384_+	helix-turn-helix transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	2.1e-20	44.4
WP_019716392.1\|2228380_2228911_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_129093548.1\|2229023_2230220_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.0e-49	32.0
WP_129093549.1\|2230447_2231167_-	hypothetical protein	NA	NA	NA	NA
WP_160216271.1\|2231442_2231652_+	DUF255 domain-containing protein	NA	NA	NA	NA
WP_041351256.1\|2231827_2232553_+	MjaII restriction endonuclease	NA	NA	NA	NA
WP_052478213.1\|2232616_2233921_-	DNA (cytosine-5-)-methyltransferase	F2Y148	Organic_Lake_phycodnavirus	1.3e-77	39.8

DBSCAN-SWA_169

2240778 : 2242402

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726087.1\|2240778_2241537_-	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	4.8e-61	46.3
WP_003219224.1\|2241600_2241840_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003219228.1\|2241883_2242402_-	single-stranded DNA-binding protein	M5ABV5	Bacillus_phage	2.3e-51	69.8

DBSCAN-SWA_170

2247899 : 2251748

Bacillus_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243890.1\|2247899_2248517_+\|protease	spore protease YyaC	G3M9W0	Bacillus_virus	2.0e-17	32.7
WP_003226832.1\|2248555_2249404_-	stage 0 sporulation protein Spo0J	I3NLC2	Bifidobacterium_phage	2.0e-20	38.9
WP_003219244.1\|2249396_2250158_-	sporulation initiation inhibitor protein Soj	Q8JL10	Natrialba_phage	6.5e-26	31.1
WP_015250779.1\|2250405_2250846_+	PH domain-containing protein	NA	NA	NA	NA
WP_015250778.1\|2250896_2251748_-	nucleoid occlusion protein	S5VTK0	Leptospira_phage	9.5e-18	36.7

DBSCAN-SWA_171

2260544 : 2268065

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242509.1\|2260544_2261681_+	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	6.3e-17	33.6
WP_003226810.1\|2261811_2262027_+	ribosome maturation protein RlbA	NA	NA	NA	NA
WP_003243515.1\|2262042_2263155_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003219266.1\|2263172_2263418_+	extracellular matrix regulator RemB	NA	NA	NA	NA
WP_003226808.1\|2263472_2265389_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.9e-156	48.8
WP_014475555.1\|2265599_2268065_+	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	7.1e-114	36.9

DBSCAN-SWA_172

2274520 : 2282375

Klosneuvirus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003226803.1\|2274520_2275987_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.9e-98	41.9
WP_032676922.1\|2276139_2277471_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.3e-25	28.4
WP_003247145.1\|2277667_2278552_+	pyridoxal 5'-phosphate synthase lyase subunit PdxS	NA	NA	NA	NA
WP_029726364.1\|2278573_2279164_+	pyridoxal 5'-phosphate synthase glutaminase subunit PdxT	NA	NA	NA	NA
WP_003247131.1\|2279485_2280763_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-95	53.9
WP_003226792.1\|2281101_2281755_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.7e-22	33.5
WP_003247138.1\|2281751_2282375_-	deoxynucleoside kinase	A0A1G5SAJ8	Enterococcus_phage	9.1e-10	24.3

DBSCAN-SWA_173

2285419 : 2287111

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015253021.1\|2285419_2287111_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	6.7e-55	34.6

DBSCAN-SWA_174

2295006 : 2308472

Streptococcus_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380713.1\|2295006_2296167_+	toxic anion resistance protein	A0A291I9K4	Lactobacillus_phage	2.8e-36	31.0
WP_046380714.1\|2296248_2297691_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_046380715.1\|2297687_2298326_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.1e-58	55.4
WP_003242755.1\|2298399_2298729_+	cyclic di-AMP receptor DarA	NA	NA	NA	NA
WP_009966249.1\|2298741_2299182_+	YaaR family protein	NA	NA	NA	NA
WP_003226770.1\|2299193_2300183_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-33	33.1
WP_003226767.1\|2300185_2301013_+	competence/sporulation regulator complex protein RicT	NA	NA	NA	NA
WP_003218308.1\|2301027_2301387_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
WP_003244526.1\|2301445_2302189_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_046380716.1\|2302175_2302475_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_046380717.1\|2302449_2303328_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.8e-67	48.3
WP_003226760.1\|2303376_2303667_-	transition state genes transcriptional regulator AbrB	A0A2I7SC16	Paenibacillus_phage	8.0e-17	54.3
WP_015382561.1\|2304161_2306156_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	4.0e-99	39.2
WP_014475570.1\|2306235_2307003_+	TatD family hydrolase	NA	NA	NA	NA
WP_046380719.1\|2307158_2308472_+	DUF348 domain-containing protein	A0A217ER34	Bacillus_phage	1.1e-28	70.9

DBSCAN-SWA_175

2314882 : 2317229

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380722.1\|2314882_2316253_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	3.8e-32	34.8
WP_003218353.1\|2316275_2317229_+	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	5.1e-44	35.9

DBSCAN-SWA_176

2322629 : 2323166

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003218365.1\|2322629_2323166_+	stage V sporulation protein T	A0A2I7SC16	Paenibacillus_phage	4.2e-11	70.6

DBSCAN-SWA_177

2335514 : 2343405

Micromonas_pusilla_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003243881.1\|2335514_2337428_+\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	1.1e-114	42.0
WP_010886388.1\|2337622_2338399_+	type III pantothenate kinase	NA	NA	NA	NA
WP_003226695.1\|2338410_2339286_+	redox-regulated molecular chaperone HslO	NA	NA	NA	NA
WP_160216273.1\|2339332_2340226_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_003226691.1\|2340301_2341228_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	8.8e-110	64.9
WP_041334206.1\|2341394_2342807_+	anthranilate synthase component I family protein	S4VT78	Pandoravirus	4.9e-35	31.5
WP_014475585.1\|2342820_2343405_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.4e-65	59.1

DBSCAN-SWA_178

2347257 : 2348757

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003226674.1\|2347257_2348757_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	6.2e-97	39.4

DBSCAN-SWA_179

2362109 : 2364542

Enterobacteria_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380728.1\|2362109_2364542_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpC	H6X3M6	Enterobacteria_phage	6.7e-133	35.3

DBSCAN-SWA_180

2371988 : 2373389

Catovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399682.1\|2371988_2373389_+\|tRNA	cysteine--tRNA ligase	A0A1V0SAQ2	Catovirus	1.0e-61	31.4

DBSCAN-SWA_181

2376428 : 2376962

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003225764.1\|2376428_2376962_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	9.2e-11	30.8

DBSCAN-SWA_182

2380457 : 2391301

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009966326.1\|2380457_2384039_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.2e-48	23.7
WP_004399688.1\|2384100_2387700_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	2.8e-66	25.1
WP_003225778.1\|2387878_2388127_+	50S ribosomal protein L7ae-like protein	NA	NA	NA	NA
WP_003225781.1\|2388240_2388657_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_003225784.1\|2388698_2389169_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_003235056.1\|2389222_2391301_+	elongation factor G	E4ZFJ7	Streptococcus_phage	7.4e-64	28.2

DBSCAN-SWA_183

2408981 : 2410672

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380731.1\|2408981_2409827_+	energy-coupling factor ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-20	30.5
WP_003235106.1\|2409802_2410672_+	energy-coupling factor ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.0e-11	27.8

DBSCAN-SWA_184

2415146 : 2415860

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252979.1\|2415146_2415860_+	N-acetylmuramoyl-L-alanine amidase CwlD	A0A0N6W8I1	Bacillus_phage	8.3e-15	30.0

DBSCAN-SWA_185

2435422 : 2436859

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234986.1\|2435422_2436859_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.0e-141	57.5

DBSCAN-SWA_186

2458617 : 2463204

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380736.1\|2458617_2460420_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q84421	Paramecium_bursaria_Chlorella_virus	8.3e-104	39.9
WP_128484027.1\|2460466_2460607_+	hypothetical protein	NA	NA	NA	NA
WP_046380737.1\|2460855_2461767_-	DNA-3-methyladenine glycosidase II	NA	NA	NA	NA
WP_046380738.1\|2462039_2462678_+	bifunctional transcriptional activator/DNA repair enzyme AdaA	NA	NA	NA	NA
WP_046380739.1\|2462661_2463204_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	5.3e-22	46.7

DBSCAN-SWA_187

2475237 : 2475957

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234899.1\|2475237_2475957_+	sporulation killing factor ABC transporter ATP-binding protein SkfE	A0A285PWH2	Cedratvirus	7.5e-16	28.6

DBSCAN-SWA_188

2479584 : 2482312

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252948.1\|2479584_2480256_+	two-component system response regulator YbdK	W8CYM9	Bacillus_phage	1.1e-24	32.1
WP_072557087.1\|2480276_2481239_+	two-component system sensor histidine kinase YbdK	NA	NA	NA	NA
WP_026009835.1\|2481297_2481549_+	hypothetical protein	NA	NA	NA	NA
WP_017694962.1\|2481541_2482312_-	protein kinase	A0A2I2L4H4	Orpheovirus	1.9e-09	32.7

DBSCAN-SWA_189

2491334 : 2492216

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246382.1\|2491334_2492216_-	glycerophosphodiester phosphodiesterase	I6XE30	Staphylococcus_phage	2.2e-41	38.9

DBSCAN-SWA_190

2511018 : 2512914

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380749.1\|2511018_2512914_-	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	4.0e-08	42.3

DBSCAN-SWA_191

2534486 : 2539006

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080481000.1\|2534486_2535167_+	two-component system response regulator YcbL	W8CYM9	Bacillus_phage	2.1e-31	32.7
WP_046380758.1\|2535168_2536104_+	two-component system sensor histidine kinase YcbM	W8CYF6	Bacillus_phage	5.2e-25	25.9
WP_046160014.1\|2536195_2537119_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.1e-41	43.5
WP_080480999.1\|2537137_2537824_+	ABC transporter permease	NA	NA	NA	NA
WP_121591398.1\|2537784_2537919_-	hypothetical protein	NA	NA	NA	NA
WP_003246313.1\|2537878_2538265_-	YndM family protein	NA	NA	NA	NA
WP_046160016.1\|2538577_2539006_+	cell wall hydrolase	A0A172JHR8	Bacillus_phage	4.6e-05	34.6

DBSCAN-SWA_192

2542157 : 2546203

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234779.1\|2542157_2542886_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.3e-15	25.0
WP_046380759.1\|2542882_2543530_-	pyroglutamyl-peptidase I	NA	NA	NA	NA
WP_046380760.1\|2543608_2544721_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_032728901.1\|2544763_2546203_-	lincomycin efflux MFS transporter Lmr(B)	A0A0M3UL24	Mycobacterium_phage	1.1e-13	23.0

DBSCAN-SWA_193

2552537 : 2553278

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234757.1\|2552537_2553278_+	sodium ABC transporter ATP-binding protein NatA	A0A2H4PQG7	Staphylococcus_phage	5.4e-25	31.5

DBSCAN-SWA_194

2559916 : 2561664

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380766.1\|2559916_2560420_-	peptidoglycan L-alanyl-D-glutamate endopeptidase CwlK	A0A2H4J4U2	uncultured_Caudovirales_phage	3.8e-30	50.8
WP_046380767.1\|2560542_2561664_+	response regulator aspartate phosphatase RapJ	A0A1P8CWN8	Bacillus_phage	1.3e-51	32.5

DBSCAN-SWA_195

2565459 : 2570911

Caulobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234730.1\|2565459_2566155_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	1.6e-18	28.1
WP_003246340.1\|2566112_2566955_+	zinc ABC transporter permease ZnuB	NA	NA	NA	NA
WP_003246351.1\|2566992_2567988_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_003246350.1\|2568271_2568871_+	TerD family protein	K4JRX3	Caulobacter_phage	5.3e-23	31.0
WP_003234723.1\|2568892_2569474_+	TerD family protein	K4JRX3	Caulobacter_phage	6.7e-31	41.7
WP_003241242.1\|2569508_2570087_+	TerD family protein	K4JRX3	Caulobacter_phage	1.3e-29	38.8
WP_003246458.1\|2570137_2570911_+	TerC family protein	S5MAL1	Bacillus_phage	5.0e-82	64.3

DBSCAN-SWA_196

2577125 : 2578382

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246301.1\|2577125_2578382_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-33	41.1

DBSCAN-SWA_197

2594420 : 2595239

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246440.1\|2594420_2595239_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.6e-91	61.1

DBSCAN-SWA_198

2599713 : 2601597

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246492.1\|2599713_2600496_+	nucleotidyltransferase domain-containing protein	A0A2D1GQQ2	Pseudomonas_phage	9.9e-46	44.9
WP_003246421.1\|2600685_2601597_+	Proline dehydrogenase 2	A0A2H4PQT6	Staphylococcus_phage	1.6e-66	42.6

DBSCAN-SWA_199

2608985 : 2609996

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029727065.1\|2608985_2609996_+	ferredoxin--NADP(+) reductase	A0A2K9L4X0	Tupanvirus	1.3e-18	27.4

DBSCAN-SWA_200

2614429 : 2616562

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061891261.1\|2614429_2616562_-	assimilatory nitrate reductase catalytic subunit	A0A077SK27	Escherichia_phage	1.4e-17	22.9

DBSCAN-SWA_201

2626386 : 2658482

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048654749.1\|2626386_2627820_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	4.5e-52	30.6
WP_015715226.1\|2627856_2628255_-	DNA-entry nuclease inhibitor	NA	NA	NA	NA
WP_003234608.1\|2628281_2628731_-	DNA-entry nuclease	F8WPS9	Bacillus_phage	2.9e-42	67.8
WP_061891260.1\|2628898_2630620_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-15	44.4
WP_014478803.1\|2630730_2631288_-	6-phospho-3-hexuloisomerase	NA	NA	NA	NA
WP_003234604.1\|2631293_2631926_-	3-hexulose-6-phosphate synthase	NA	NA	NA	NA
WP_003246265.1\|2632154_2632517_+	transcriptional activator HxlR	NA	NA	NA	NA
WP_048654751.1\|2633090_2643854_+	surfactin non-ribosomal peptide synthetase SrfAA	A0A2K9KZV5	Tupanvirus	2.5e-155	26.6
WP_069703992.1\|2643866_2654618_+	surfactin non-ribosomal peptide synthetase SrfAB	A0A2K9KZV5	Tupanvirus	3.7e-167	27.4
WP_061891259.1\|2654654_2658482_+	surfactin non-ribosomal peptide synthetase SrfAC	A0A2K9KZV5	Tupanvirus	2.5e-89	26.6

DBSCAN-SWA_202

2662253 : 2666073

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252835.1\|2662253_2663588_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.3e-66	37.7
WP_003234549.1\|2663582_2664257_-	4'-phosphopantetheinyl transferase	NA	NA	NA	NA
WP_014475783.1\|2664361_2665009_-	YitT family protein	NA	NA	NA	NA
WP_003234543.1\|2665329_2666073_-	cystine ABC transporter ATP-binding protein TcyC	G9BWD6	Planktothrix_phage	5.4e-33	38.4

DBSCAN-SWA_203

2672357 : 2675870

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048654757.1\|2672357_2673836_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	7.3e-82	38.8
WP_048654758.1\|2674115_2675870_+	hypothetical protein	U5PSS0	Bacillus_phage	2.2e-125	41.2

DBSCAN-SWA_204

2682704 : 2691141

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246532.1\|2682704_2683388_+	two-component system response regulator YclJ	W8CYM9	Bacillus_phage	3.6e-44	40.4
WP_080348068.1\|2683374_2684796_+	two-component system sensor histidine kinase YclK	W8CYF6	Bacillus_phage	6.0e-41	35.0
WP_014475800.1\|2684958_2686107_+	response regulator aspartate phosphatase RapC	A0A1P8CWN8	Bacillus_phage	2.2e-78	44.6
WP_003224994.1\|2686090_2686213_+	phosphatase RapC inhibitor PhrC	NA	NA	NA	NA
WP_015482794.1\|2686312_2686402_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_032678937.1\|2686483_2686597_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_029726569.1\|2686749_2688114_-	aspartate kinase	NA	NA	NA	NA
WP_014475804.1\|2688498_2689449_+	petrobactin ABC transporter permease YclN	A0A2H4IY97	uncultured_Caudovirales_phage	2.4e-94	54.8
WP_015252820.1\|2689441_2690389_+	petrobactin ABC transporter permease YclO	NA	NA	NA	NA
WP_015252819.1\|2690382_2691141_+	petrobactin ABC transporter ATP-binding protein YclP	Q9EMR9	Amsacta_moorei_entomopoxvirus	3.4e-19	30.6

DBSCAN-SWA_205

2697696 : 2702255

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019712392.1\|2697696_2699007_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	4.4e-22	24.2
WP_015382777.1\|2699075_2700464_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_026009827.1\|2700586_2701450_+	glucose uptake protein GlcU	NA	NA	NA	NA
WP_003246720.1\|2701469_2702255_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-24	31.9

DBSCAN-SWA_206

2725550 : 2728693

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014478863.1\|2725550_2727062_+	acyl--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	9.9e-42	27.5
WP_072592622.1\|2727081_2727627_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003246648.1\|2727832_2728693_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.2e-57	45.3

DBSCAN-SWA_207

2732684 : 2734868

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029317313.1\|2732684_2734868_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	2.7e-40	31.0

DBSCAN-SWA_208

2744435 : 2746676

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380790.1\|2744435_2744885_+	8-oxo-dGTP diphosphatase MutT	I3WW32	Acinetobacter_phage	6.4e-05	38.3
WP_046380791.1\|2744951_2746676_+	pyruvate oxidase	G8DDL3	Micromonas_pusilla_virus	9.2e-36	25.8

DBSCAN-SWA_209

2759030 : 2759957

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246573.1\|2759030_2759957_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.9e-37	35.7

DBSCAN-SWA_210

2763878 : 2764199

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032722927.1\|2763878_2764199_-	thioredoxin family protein	A0A1X9I9P5	Staphylococcus_phage	2.2e-07	33.3

DBSCAN-SWA_211

2767282 : 2768767

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246685.1\|2767282_2768767_+	ATP-dependent RNA helicase CshA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.6e-63	37.3

DBSCAN-SWA_212

2775013 : 2775364

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003156187.1\|2775013_2775364_+	type II toxin-antitoxin system endoribonuclease NdoA	A0A2P0ZKX3	Lactobacillus_phage	5.8e-14	38.6

DBSCAN-SWA_213

2778932 : 2779721

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246715.1\|2778932_2779721_+	RNA polymerase sigma factor SigB	A0A0Y0AU18	Bacillus_phage	2.2e-24	35.2

DBSCAN-SWA_214

2784202 : 2793516

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003246525.1\|2784202_2784655_+	SprT family protein	U5J9G1	Bacillus_phage	4.9e-05	29.8
WP_015252759.1\|2785711_2786275_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014478933.1\|2786473_2786992_-	hypothetical protein	NA	NA	NA	NA
WP_046380793.1\|2787002_2788724_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	3.3e-134	56.8
WP_029316771.1\|2789204_2789438_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_009966645.1\|2790612_2790789_+	hypothetical protein	NA	NA	NA	NA
WP_004399401.1\|2790813_2791500_+	hypothetical protein	O64048	Bacillus_phage	2.7e-124	98.2
WP_009966647.1\|2791924_2792110_+	hypothetical protein	NA	NA	NA	NA
WP_003234249.1\|2792459_2793053_+	glutamine amidotransferase	NA	NA	NA	NA
WP_003234247.1\|2793315_2793516_+	cold shock protein CspC	Q9AZD3	Lactococcus_phage	9.6e-22	75.8

DBSCAN-SWA_215

2798451 : 2799324

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046160082.1\|2798451_2799324_-	AraC family transcriptional regulator	D0R0F8	Streptococcus_phage	9.7e-34	33.0

DBSCAN-SWA_216

2811178 : 2812051

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029317361.1\|2811178_2812051_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-33	33.0

DBSCAN-SWA_217

2816401 : 2817709

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252728.1\|2816401_2817709_+	arsenical efflux pump membrane protein ArsB	A0A2H4PQU3	Staphylococcus_phage	8.3e-154	66.8

DBSCAN-SWA_218

2825473 : 2826115

Feldmannia_irregularis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244318.1\|2825473_2826115_+	two-component system response regulator YdfI	Q6XM27	Feldmannia_irregularis_virus	5.7e-07	30.5

DBSCAN-SWA_219

2846276 : 2847905

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380802.1\|2846276_2847905_-	ABC-F type ribosomal protection protein VmlR	Q6DMX7	Streptococcus_phage	3.2e-54	31.7

DBSCAN-SWA_220

2853717 : 2854347

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380805.1\|2853717_2854347_-	nitroreductase family protein	A0A1V0E011	Clostridioides_phage	6.2e-06	53.1

DBSCAN-SWA_221

2859620 : 2860808

Lambdina_fiscellaria_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380808.1\|2859620_2860808_+	glycosyltransferase	A0A0E3URP0	Lambdina_fiscellaria_nucleopolyhedrovirus	3.0e-09	29.1

DBSCAN-SWA_222

2870158 : 2871556

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252688.1\|2870158_2871556_+	6-phospho-beta-glucosidase GmuD	A0A0B5JD41	Pandoravirus	4.2e-47	29.1

DBSCAN-SWA_223

2884792 : 2893598

uncultured_virus(40.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032722963.1\|2884792_2885833_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.0e-66	43.9
WP_069322419.1\|2886063_2887992_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.1e-56	29.5
WP_046380818.1\|2888117_2888630_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_003234073.1\|2888626_2889274_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003234072.1\|2889295_2889469_+	sec-independent protein translocase protein TatAY	NA	NA	NA	NA
WP_015252680.1\|2889475_2890240_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.5e-22	30.8
WP_003225680.1\|2890471_2890663_-	YdiK family protein	NA	NA	NA	NA
WP_003234069.1\|2890659_2891394_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003155970.1\|2891632_2891917_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.2e-19	51.6
WP_003243151.1\|2891963_2893598_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.8e-159	57.7

DBSCAN-SWA_224

2896952 : 2899427

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003234063.1\|2896952_2898236_+	DNA (cytosine-5-)-methyltransferase	A0A0R6PG08	Moraxella_phage	2.1e-24	28.8
WP_003242904.1\|2898257_2899427_+	DNA cytosine methyltransferase	A0A2I7QSC9	Vibrio_phage	4.6e-31	32.4

DBSCAN-SWA_225

2923274 : 2924090

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041333557.1\|2923274_2924090_-	alpha/beta hydrolase	A0A291AV30	Mycobacterium_phage	2.2e-11	30.8

DBSCAN-SWA_226

2934465 : 2953952

Synechococcus_phage(30.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233970.1\|2934465_2936007_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	7.5e-21	30.5
WP_019712792.1\|2936115_2936649_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_019712793.1\|2936630_2938097_+	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_003233968.1\|2938481_2939804_+	hypoxanthine/guanine permease PbuG	A0A0R6PHV4	Moraxella_phage	2.2e-37	30.0
WP_046160140.1\|2940014_2940818_+	hypothetical protein	NA	NA	NA	NA
WP_003244066.1\|2940976_2941144_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
WP_015482896.1\|2941357_2941912_+	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_003219403.1\|2941911_2942109_+	NETI motif-containing protein	NA	NA	NA	NA
WP_003244134.1\|2942431_2942920_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	8.7e-24	44.9
WP_014479059.1\|2942912_2944055_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003233955.1\|2944051_2945347_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_046380819.1\|2945420_2946146_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	4.1e-46	44.1
WP_003219409.1\|2946138_2946393_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_014663062.1\|2946389_2947073_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_046160142.1\|2947056_2949285_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.2e-159	40.1
WP_003233947.1\|2949260_2950691_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_003233945.1\|2950792_2951833_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
WP_015252651.1\|2951829_2952417_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
WP_046380820.1\|2952413_2953952_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.9e-78	52.6

DBSCAN-SWA_227

2963192 : 2970556

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015383008.1\|2963192_2965412_+	DNA helicase PcrA	A7KV33	Bacillus_phage	9.5e-134	41.7
WP_041333598.1\|2965435_2967442_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	3.5e-127	40.1
WP_003242795.1\|2967457_2968648_+	CamS family sex pheromone protein	NA	NA	NA	NA
WP_080480982.1\|2968809_2969820_+	phosphotransferase enzyme family protein	NA	NA	NA	NA
WP_080480983.1\|2969857_2970556_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.7e-18	37.9

DBSCAN-SWA_228

2976778 : 2986863

Leptospira_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380827.1\|2976778_2979937_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	8.6e-64	23.5
WP_003233894.1\|2980260_2981172_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.2e-21	29.7
WP_046380828.1\|2981428_2982811_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	8.0e-115	46.8
WP_046380829.1\|2983860_2986863_+	DEAD/DEAH box helicase family protein	U6E9C9	Streptococcus_phage	3.5e-14	26.5

DBSCAN-SWA_229

2990130 : 2995039

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052728183.1\|2990130_2991258_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	7.8e-76	41.2
WP_046380833.1\|2991832_2992225_-	hypothetical protein	NA	NA	NA	NA
WP_046380834.1\|2992557_2993028_-	antitoxin YezG family protein	NA	NA	NA	NA
WP_046380835.1\|2993032_2995039_-	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	1.3e-145	57.6

DBSCAN-SWA_230

2998733 : 2999864

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069703934.1\|2998733_2999864_+	response regulator aspartate phosphatase RapH	A0A1P8CWN8	Bacillus_phage	8.3e-86	45.6

DBSCAN-SWA_231

3006511 : 3008245

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380844.1\|3006511_3008245_+	two-component system sensor histidine kinase YesM	Q9EYF3	Enterobacteria_phage	1.5e-22	27.5

DBSCAN-SWA_232

3038088 : 3045615

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_128753544.1\|3038088_3041274_+	cytochrome P450	V5UQK0	Mycobacterium_phage	3.0e-80	37.5
WP_003243930.1\|3041720_3043640_+	Lipoteichoic acid synthase 1	W6LM83	Streptococcus_phage	1.0e-128	43.5
WP_003244408.1\|3043875_3044640_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_003244102.1\|3044646_3045615_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L0I7	Tupanvirus	1.1e-30	29.3

DBSCAN-SWA_233

3053973 : 3065116

uncultured_Caudovirales_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003242537.1\|3053973_3054828_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-09	41.0
WP_069703943.1\|3054962_3056852_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1V0SGN0	Hokovirus	6.1e-41	31.9
WP_069703944.1\|3056975_3057422_+	hypothetical protein	NA	NA	NA	NA
WP_069703945.1\|3057546_3057969_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003233759.1\|3058034_3059225_+	MFS transporter	NA	NA	NA	NA
WP_033883242.1\|3059765_3061322_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.5e-56	29.3
WP_015252580.1\|3061494_3062625_+	DEAD/DEAH box helicase	A0A1V0SIR5	Klosneuvirus	3.7e-41	30.9
WP_015252579.1\|3062692_3063139_+	N-acetyltransferase	NA	NA	NA	NA
WP_069703946.1\|3063191_3064211_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_003233737.1\|3064315_3065116_-	Fe(3+)-citrate ABC transporter ATP-binding protein YfmF	W6JKT0	Anomala_cuprea_entomopoxvirus	8.4e-16	30.2

DBSCAN-SWA_234

3080197 : 3080335

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233704.1\|3080197_3080335_-	YflJ family protein	G3MBD1	Bacillus_virus	8.6e-06	58.1

DBSCAN-SWA_235

3083462 : 3085412

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233694.1\|3083462_3085412_-	lipoteichoic acid synthase	W6LM83	Streptococcus_phage	2.2e-134	43.2

DBSCAN-SWA_236

3111553 : 3112954

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380861.1\|3111553_3112954_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.2e-88	39.6

DBSCAN-SWA_237

3123416 : 3123746

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010886445.1\|3123416_3123746_-	YnfA family protein	A0A218MNG8	uncultured_virus	1.6e-13	41.5

DBSCAN-SWA_238

3131476 : 3135006

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216280.1\|3131476_3133198_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-53	30.3
WP_042978122.1\|3133191_3135006_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.0e-56	30.8

DBSCAN-SWA_239

3143387 : 3144323

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048655258.1\|3143387_3144323_+	linearmycin resistance ATP-binding protein LnrL	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-30	36.2

DBSCAN-SWA_240

3151498 : 3152035

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021481174.1\|3151498_3152035_+	bacillithiol transferase BstA	D0R7I3	Paenibacillus_phage	5.8e-21	46.1

DBSCAN-SWA_241

3167299 : 3169381

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726839.1\|3167299_3168160_+	alpha/beta hydrolase	A0A0S2MV32	Mycobacterium_phage	5.0e-06	27.4
WP_003244113.1\|3168391_3169381_+	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	1.5e-59	42.4

DBSCAN-SWA_242

3176921 : 3178664

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009966836.1\|3176921_3178664_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-46	27.5

DBSCAN-SWA_243

3195266 : 3199723

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233470.1\|3195266_3196622_-	FAD-binding oxidoreductase	S4VRT3	Pandoravirus	2.7e-43	39.5
WP_003245192.1\|3196872_3197070_+	transcriptional regulator SenS	NA	NA	NA	NA
WP_003245322.1\|3197096_3198548_-	Vegetative catalase	A0A2K9L0T1	Tupanvirus	1.2e-108	41.3
WP_010886450.1\|3198955_3199723_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.2e-33	35.9

DBSCAN-SWA_244

3210717 : 3213971

Thermus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233433.1\|3210717_3212613_+	serine/threonine protein kinase PrkA	A0MN77	Thermus_phage	1.4e-101	36.5
WP_003233432.1\|3212792_3213971_+	sporulation protein YhbH	X2JIL8	Bacillus_phage	6.5e-25	45.3

DBSCAN-SWA_245

3219165 : 3224375

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233423.1\|3219165_3219864_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-21	30.4
WP_029317524.1\|3219880_3220798_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-39	38.0
WP_038427544.1\|3220790_3221732_+	ABC transporter permease	NA	NA	NA	NA
WP_003224086.1\|3221823_3222027_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.2e-16	61.5
WP_003245726.1\|3222462_3223293_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_046380874.1\|3223295_3224375_-	diguanylate cyclase DgcK	A0A127AWB9	Bacillus_phage	5.8e-20	37.0

DBSCAN-SWA_246

3234655 : 3237418

Bodo_saltans_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244785.1\|3234655_3235564_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.1e-06	25.3
WP_003233401.1\|3235674_3236070_+	YhcU family protein	NA	NA	NA	NA
WP_003245462.1\|3236206_3236629_+	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	4.6e-13	35.0
WP_003245030.1\|3236755_3237418_+	HAD family hydrolase	A0A1D8KNV9	Synechococcus_phage	5.9e-07	26.6

DBSCAN-SWA_247

3241532 : 3242357

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233386.1\|3241532_3242357_+	glycerol uptake facilitator protein GlpF	M1IAZ4	Acanthocystis_turfacea_Chlorella_virus	1.1e-31	34.6

DBSCAN-SWA_248

3245805 : 3247551

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244986.1\|3245805_3247551_+	phosphoglucomutase	A0A1X9I671	Streptococcus_phage	3.5e-160	49.3

DBSCAN-SWA_249

3250823 : 3252290

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252477.1\|3250823_3252290_-	peptidoglycan endopeptidase LytF	A0A1V0DZX6	Clostridioides_phage	3.8e-14	41.7

DBSCAN-SWA_250

3258030 : 3262142

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069704133.1\|3258030_3259044_+	peptidoglycan endopeptidase LytE	M1HNA7	Bacillus_virus	3.4e-14	43.8
WP_003233357.1\|3259114_3259990_-	transcriptional regulator CitR	NA	NA	NA	NA
WP_041335618.1\|3260098_3261199_+	citrate synthase/methylcitrate synthase	NA	NA	NA	NA
WP_029726337.1\|3261272_3262142_+	glucose 1-dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.6e-58	44.8

DBSCAN-SWA_251

3276348 : 3279880

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479308.1\|3276348_3276744_-	CrcB family protein	A0A2H4PQR0	Staphylococcus_phage	8.9e-11	36.5
WP_014479309.1\|3276730_3277462_-	hypothetical protein	A0A0S2MYI4	Enterococcus_phage	5.9e-16	29.5
WP_009966908.1\|3277695_3277803_+	YhdX family protein	NA	NA	NA	NA
WP_046380885.1\|3277951_3279067_+	small-conductance mechanosensitive channel protein MscY	NA	NA	NA	NA
WP_046380886.1\|3279136_3279880_+	sirtuin NAD-dependent deacetylase	A0A068EPD4	Bacillus_phage	3.1e-20	31.2

DBSCAN-SWA_252

3284360 : 3289277

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380892.1\|3284360_3286118_+	multidrug ABC transporter ATP-binding protein BmrC	W8CYL7	Bacillus_phage	3.1e-55	30.3
WP_046380893.1\|3286114_3288136_+	multidrug resistance ABC transporter ATP-binding protein/permease BmrD	A0A076FI99	Aureococcus_anophage	1.4e-30	25.8
WP_046380894.1\|3288185_3288806_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_003245136.1\|3288844_3288970_-	hypothetical protein	NA	NA	NA	NA
WP_003233287.1\|3289073_3289277_-	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	4.5e-19	76.6

DBSCAN-SWA_253

3293789 : 3294143

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003224239.1\|3293789_3294143_+	YlbF family regulator	A0A1X9I5Y8	Streptococcus_phage	4.5e-06	27.9

DBSCAN-SWA_254

3301634 : 3302531

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_041338159.1\|3301634_3302531_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-25	30.2

DBSCAN-SWA_255

3314331 : 3317226

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024571663.1\|3314331_3315411_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.4e-82	44.7
WP_003233231.1\|3315557_3315995_-	HIT family protein	NA	NA	NA	NA
WP_003233230.1\|3316482_3317226_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.2e-25	28.4

DBSCAN-SWA_256

3340010 : 3344599

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029726300.1\|3340010_3341552_+	long-chain-fatty-acid--CoA ligase LcfB	A0A2H4PQM9	Staphylococcus_phage	5.7e-45	28.2
WP_003245187.1\|3341590_3341986_-	hypothetical protein	NA	NA	NA	NA
WP_046380902.1\|3342134_3343415_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_029726299.1\|3343453_3344599_-	subtilisin AprE	A0A217EQY2	Bacillus_phage	3.7e-49	46.7

DBSCAN-SWA_257

3349518 : 3357673

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061891218.1\|3349518_3350958_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.0e-24	25.9
WP_080481037.1\|3350964_3351525_-	biotin transporter BioY	NA	NA	NA	NA
WP_003245216.1\|3351659_3352958_-	heme-based aerotactic transducer HemAT	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-06	66.7
WP_049140685.1\|3353096_3354626_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003245662.1\|3354737_3355595_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.5e-52	44.6
WP_003233142.1\|3355622_3355856_-	IDEAL domain-containing protein	NA	NA	NA	NA
WP_003245329.1\|3356148_3356727_+	competence transcription factor ComK	NA	NA	NA	NA
WP_003245421.1\|3356773_3357673_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.0e-70	51.6

DBSCAN-SWA_258

3367312 : 3368638

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380910.1\|3367312_3368638_-	3-dehydro-glucose-6-phosphate--glutamate transaminase	A0A2K9L0G1	Tupanvirus	9.6e-25	27.5

DBSCAN-SWA_259

3378833 : 3387168

Clostridium_botulinum_C_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216283.1\|3378833_3382532_+	helicase-exonuclease AddAB subunit AddA	Q331U3	Clostridium_botulinum_C_phage	2.7e-16	23.6
WP_069704117.1\|3382603_3383779_+	exonuclease SbcCD subunit D	NA	NA	NA	NA
WP_069704116.1\|3383775_3387168_+	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	1.5e-10	27.1

DBSCAN-SWA_260

3392815 : 3398102

Bacillus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069704115.1\|3392815_3395500_+\|protease	cell wall-associated protease WprA	A0A217EQY2	Bacillus_phage	8.2e-31	37.0
WP_080481060.1\|3395530_3396112_-	DUF2777 domain-containing protein	NA	NA	NA	NA
WP_029726288.1\|3396257_3398102_+	asparagine synthase (glutamine-hydrolyzing)	E3T4J5	Cafeteria_roenbergensis_virus	5.4e-34	24.6

DBSCAN-SWA_261

3408065 : 3410665

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245141.1\|3408065_3408872_+	alpha/beta hydrolase	A0A0A1ELD0	Mycobacterium_phage	2.5e-12	26.9
WP_003245829.1\|3408899_3409499_-	adenylyl-sulfate kinase	A0A1B0XTK9	Freshwater_phage	3.0e-10	40.2
WP_046380919.1\|3409495_3410665_-	sulfate adenylyltransferase	A0A2K9L0F0	Tupanvirus	6.4e-49	33.0

DBSCAN-SWA_262

3426724 : 3427576

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245785.1\|3426724_3427576_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	4.6e-12	32.1

DBSCAN-SWA_263

3431651 : 3433313

Bacteriophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232996.1\|3431651_3431822_+	YqaE/Pmp3 family membrane protein	A0A0C5AJ71	Bacteriophage	9.4e-10	60.0
WP_046380925.1\|3431882_3433313_+	FAD-binding oxidoreductase	A0A2K9KZR0	Tupanvirus	2.9e-51	29.8

DBSCAN-SWA_264

3437122 : 3439413

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380927.1\|3437122_3438280_+	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	3.1e-27	27.5
WP_046380928.1\|3438351_3439413_+	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	6.0e-62	40.1

DBSCAN-SWA_265

3442485 : 3443445

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479432.1\|3442485_3443445_+	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	1.2e-21	28.6

DBSCAN-SWA_266

3446842 : 3498636

Bacillus_phage(30.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232972.1\|3446842_3447082_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|3447246_3448185_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|3448207_3449449_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_160216284.1\|3449524_3450310_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|3450501_3451488_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_003232964.1\|3451484_3452474_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
WP_003245082.1\|3452561_3454193_+	oligopeptide-binding protein AppA	NA	NA	NA	NA
WP_003245828.1\|3454268_3455219_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_003232961.1\|3455235_3456147_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_046380932.1\|3456352_3457105_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|3457139_3458132_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_015252360.1\|3458875_3460513_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_003245554.1\|3460620_3461556_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|3461559_3462477_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_072173823.1\|3462481_3463558_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|3463559_3464477_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_080478438.1\|3464584_3465802_+	MFS transporter	NA	NA	NA	NA
WP_003224597.1\|3465966_3466545_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014476435.1\|3466725_3467121_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003232944.1\|3467163_3467820_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|3467989_3468130_+	hypothetical protein	NA	NA	NA	NA
WP_003245194.1\|3468096_3468753_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|3468747_3468870_-	hypothetical protein	NA	NA	NA	NA
WP_046380934.1\|3468913_3470065_+	competence protein CoiA	NA	NA	NA	NA
WP_014479450.1\|3470111_3472124_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|3472161_3472329_-	hypothetical protein	NA	NA	NA	NA
WP_024573348.1\|3472642_3473542_-	adaptor protein SpxH	NA	NA	NA	NA
WP_046380935.1\|3473538_3473937_-	thiol management oxidoreductase	NA	NA	NA	NA
WP_080481059.1\|3474191_3474737_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	2.4e-38	59.7
WP_014479452.1\|3474940_3475513_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_046380937.1\|3475637_3476006_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|3476034_3476670_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|3476688_3477489_+	NAD kinase	NA	NA	NA	NA
WP_080481058.1\|3477551_3478403_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003244765.1\|3478415_3479150_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	M4Q4T6	Vibrio_phage	3.2e-06	25.0
WP_029317615.1\|3479384_3481229_+	sodium:proton antiporter	NA	NA	NA	NA
WP_003232909.1\|3481477_3482188_+	thiaminase II	NA	NA	NA	NA
WP_046380938.1\|3482162_3482780_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_046380939.1\|3482763_3483873_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_015252345.1\|3483872_3484073_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_010886483.1\|3484069_3484840_+	thiazole synthase	NA	NA	NA	NA
WP_046380940.1\|3484836_3485847_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_046380941.1\|3485865_3486681_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_046380942.1\|3486816_3487593_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003232894.1\|3487693_3488377_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_014479464.1\|3488469_3488919_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_014479465.1\|3489046_3489535_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003232886.1\|3489686_3490196_-\|coat	spore coat protein	NA	NA	NA	NA
WP_003232884.1\|3490290_3490614_-	hypothetical protein	NA	NA	NA	NA
WP_032677403.1\|3490655_3491042_-\|coat	spore coat protein CotV	NA	NA	NA	NA
WP_003232879.1\|3491201_3491558_+	sporulation protein YjcA	NA	NA	NA	NA
WP_003232875.1\|3491837_3492044_+	hypothetical protein	NA	NA	NA	NA
WP_003232872.1\|3492125_3492275_+	sporulation protein YjcZ	NA	NA	NA	NA
WP_003232870.1\|3492407_3492662_+	sporulation-specific transcription regulator SopVIF	NA	NA	NA	NA
WP_032677401.1\|3492735_3495015_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	7.8e-91	34.9
WP_003232866.1\|3495131_3495386_+	hypothetical protein	NA	NA	NA	NA
WP_003232863.1\|3495458_3495881_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003232861.1\|3495884_3496400_-	hypothetical protein	NA	NA	NA	NA
WP_003232859.1\|3496436_3497159_-	esterase family protein	NA	NA	NA	NA
WP_015715681.1\|3497514_3498636_+	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	6.2e-17	26.3

DBSCAN-SWA_267

3504909 : 3507124

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245063.1\|3504909_3505371_+	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	1.8e-23	46.7
WP_003245581.1\|3505636_3506140_+	hypothetical protein	NA	NA	NA	NA
WP_003245536.1\|3506151_3506436_+	hypothetical protein	Q9AYW8	Lactococcus_phage	3.1e-05	33.3
WP_003245120.1\|3506596_3507124_+	hypothetical protein	A0A2H4J4R0	uncultured_Caudovirales_phage	8.2e-36	55.0

DBSCAN-SWA_268

3516708 : 3587242

Bacillus_phage(27.03%)

holin,tRNA,portal,terminase,plate,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244878.1\|3516708_3517188_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_003232825.1\|3517227_3517422_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_003232822.1\|3517587_3517917_-	YjdJ family protein	NA	NA	NA	NA
WP_080481057.1\|3518536_3519526_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_003245601.1\|3519648_3519897_-\|coat	spore coat protein CotT	NA	NA	NA	NA
WP_003245023.1\|3520150_3521554_+	peptidoglycan-N-acetylmuramic acid deacetylase PdaC	NA	NA	NA	NA
WP_042974194.1\|3521593_3522067_-	YjfA family protein	NA	NA	NA	NA
WP_014476499.1\|3522191_3522359_-	putative motility protein	NA	NA	NA	NA
WP_160216285.1\|3522484_3523384_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_009967034.1\|3523392_3523791_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_003245827.1\|3523891_3524467_-	YjgB family protein	NA	NA	NA	NA
WP_160216286.1\|3524612_3527570_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_003232799.1\|3527562_3528123_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_003244850.1\|3528319_3528961_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_010886490.1\|3529039_3529666_+	NUDIX hydrolase	NA	NA	NA	NA
WP_003232791.1\|3529696_3529975_-	hypothetical protein	NA	NA	NA	NA
WP_087614511.1\|3530365_3531556_+	monooxygenase YjiB	NA	NA	NA	NA
WP_003232783.1\|3531578_3532757_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	5.6e-08	28.3
WP_003232781.1\|3532797_3532986_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
WP_003245334.1\|3533159_3533972_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_003232776.1\|3534017_3534770_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_003232774.1\|3534769_3535522_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-18	31.4
WP_003232772.1\|3535641_3536616_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_003232768.1\|3536747_3537245_+	hypothetical protein	NA	NA	NA	NA
WP_003220510.1\|3537633_3538056_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_003232765.1\|3538095_3539274_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003245001.1\|3539472_3540894_+	glucuronate isomerase	NA	NA	NA	NA
WP_003245721.1\|3540961_3542341_+	MFS transporter	NA	NA	NA	NA
WP_046380951.1\|3542445_3543459_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_003245542.1\|3543464_3544484_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_046380952.1\|3544508_3545588_+	mannonate dehydratase	NA	NA	NA	NA
WP_003245605.1\|3545584_3546421_+	SDR family oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
WP_003245531.1\|3546468_3547737_+	MFS transporter	NA	NA	NA	NA
WP_003244946.1\|3547824_3548826_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_003245710.1\|3548902_3550345_+	tagaturonate reductase	NA	NA	NA	NA
WP_019712454.1\|3550341_3551835_+	altronate dehydratase	NA	NA	NA	NA
WP_014476525.1\|3551873_3552638_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_014479541.1\|3552861_3553326_-	hypothetical protein	NA	NA	NA	NA
WP_003245490.1\|3553474_3554746_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_015252291.1\|3554891_3556028_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
WP_003245487.1\|3556017_3556152_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_046380953.1\|3556181_3556424_-	hypothetical protein	NA	NA	NA	NA
WP_046380954.1\|3556551_3557505_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	4.3e-67	74.1
WP_014476529.1\|3557544_3557922_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	4.7e-17	42.3
WP_015252289.1\|3558026_3558629_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
WP_046380955.1\|3558705_3559542_+	manganese catalase	NA	NA	NA	NA
WP_019712456.1\|3559577_3560174_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|3560336_3560678_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_019712457.1\|3560856_3561036_+	hypothetical protein	NA	NA	NA	NA
WP_019712458.1\|3561022_3561859_+\|portal	phage portal protein	NA	NA	NA	NA
WP_080009791.1\|3561758_3562559_+	ATP-binding protein	A6XMI1	Bacillus_virus	3.8e-61	52.2
WP_003245588.1\|3562558_3562726_+	hypothetical protein	NA	NA	NA	NA
WP_021479479.1\|3562810_3563161_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_014476537.1\|3563157_3563364_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
WP_019712460.1\|3563479_3563989_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	2.9e-22	39.2
WP_019712461.1\|3564103_3564901_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	2.7e-59	51.0
WP_019712462.1\|3564897_3566199_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-153	60.5
WP_019712463.1\|3566202_3567690_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.0e-139	55.7
WP_003232691.1\|3567709_3568537_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
WP_019712464.1\|3568562_3569498_+\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	1.9e-104	63.4
WP_003245011.1\|3569519_3569903_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.9e-13	40.2
WP_009967053.1\|3569899_3570256_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_003245226.1\|3570252_3570738_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_003232680.1\|3570750_3571191_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
WP_003232679.1\|3571194_3571413_+	hypothetical protein	NA	NA	NA	NA
WP_003245369.1\|3571409_3572810_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
WP_003232677.1\|3572811_3573255_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003232676.1\|3573346_3573793_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
WP_003239113.1\|3573822_3573972_+	hypothetical protein	NA	NA	NA	NA
WP_080481029.1\|3573973_3577972_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	6.9e-42	43.8
WP_046380957.1\|3577964_3578624_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	6.2e-25	34.0
WP_003245730.1\|3578639_3579617_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|3579616_3579883_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_014663657.1\|3579940_3580366_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	6.6e-12	37.3
WP_015252271.1\|3580358_3581405_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	9.8e-73	44.3
WP_014476551.1\|3581388_3581967_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
WP_029317674.1\|3581963_3582236_+	hypothetical protein	NA	NA	NA	NA
WP_046380958.1\|3582238_3584350_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	1.9e-19	30.1
WP_046380959.1\|3584361_3584691_+\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	3.8e-15	39.8
WP_014479563.1\|3584687_3584852_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
WP_046380960.1\|3584898_3585738_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_015252265.1\|3585790_3586060_+	hypothetical protein	A0A2H4JD40	uncultured_Caudovirales_phage	4.8e-24	64.8
WP_003232653.1\|3586072_3586336_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
WP_003245230.1\|3586348_3587242_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.8e-83	69.7

DBSCAN-SWA_269

3595467 : 3598315

Salmonella_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380963.1\|3595467_3596439_+	glycosyltransferase family 2 protein	A0A2H5BFL1	Salmonella_phage	1.1e-62	41.0
WP_046160313.1\|3596956_3598315_-\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	5.8e-25	33.7

DBSCAN-SWA_270

3602170 : 3603178

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252254.1\|3602170_3603178_+	dipeptide ABC transporter ATP-binding subunit DppD	G9BWD6	Planktothrix_phage	2.4e-15	28.7

DBSCAN-SWA_271

3606970 : 3608863

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069704113.1\|3606970_3607861_+	gamma-D-glutamyl-L-lysine dipeptidyl-peptidase	A0A0A8WIF2	Clostridium_phage	6.9e-19	43.5
WP_029317689.1\|3607873_3608863_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5

DBSCAN-SWA_272

3617525 : 3633039

Streptococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479591.1\|3617525_3618623_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
WP_014479592.1\|3618634_3619882_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.2e-99	50.1
WP_003232574.1\|3620007_3620433_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_014479593.1\|3620463_3620907_-	organic hydroperoxide resistance transcriptional regulator OhrR	NA	NA	NA	NA
WP_014479594.1\|3621048_3621459_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_003245084.1\|3621706_3622177_-	guanine deaminase	S4VYZ2	Pandoravirus	1.8e-26	45.8
WP_046380967.1\|3622351_3624640_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_046380968.1\|3625055_3626015_-\|protease	serine protease Isp	A0A127AWU5	Bacillus_phage	5.6e-75	49.5
WP_003232560.1\|3626237_3627071_+	RsbT co-antagonist RsbRB	NA	NA	NA	NA
WP_019712472.1\|3627101_3627866_-	HMP/thiamine ABC transporter permease ThiX	NA	NA	NA	NA
WP_019712473.1\|3627840_3629484_-	energy-coupling factor ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-19	34.2
WP_003232554.1\|3629470_3630070_-	ECF transporter S component	NA	NA	NA	NA
WP_046380969.1\|3630071_3630674_-	HMP/thiamine ABC transporter substrate-binding protein ThiU	NA	NA	NA	NA
WP_046380970.1\|3630984_3631671_+	two-component system response regulator YkoG	NA	NA	NA	NA
WP_046380971.1\|3631674_3633039_+	two-component system sensor histidine kinase YkoH	A0A1V0SGX0	Hokovirus	6.4e-16	32.4

DBSCAN-SWA_273

3642510 : 3646322

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252230.1\|3642510_3643524_+	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	5.4e-52	41.3
WP_046380976.1\|3643547_3645383_-	DNA ligase D	NA	NA	NA	NA
WP_080481028.1\|3645386_3646322_-	Ku protein	A0A218M9C0	Mycobacterium_phage	2.2e-44	38.4

DBSCAN-SWA_274

3649683 : 3653024

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009967096.1\|3649683_3650658_+	TerC family protein	A0A068EP98	Bacillus_phage	2.5e-30	41.9
WP_003245855.1\|3650921_3651677_+	RNA polymerase sigma factor SigI	NA	NA	NA	NA
WP_046380977.1\|3651673_3652819_+	anti-sigma-I factor RsgI	NA	NA	NA	NA
WP_003218568.1\|3652829_3653024_-	alpha/beta-type small acid-soluble spore protein	A0A217EQS5	Bacillus_phage	1.4e-14	66.7

DBSCAN-SWA_275

3658247 : 3660958

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232504.1\|3658247_3660464_+	sporulation two-component system sensor histidine kinase KinE	W8CYF6	Bacillus_phage	8.8e-23	29.8
WP_029726987.1\|3660460_3660958_+	methylated-DNA--protein-cysteine methyltransferase	A0A0G2Y3R2	Acanthamoeba_polyphaga_mimivirus	2.7e-20	51.4

DBSCAN-SWA_276

3674664 : 3682575

Pneumococcus_phage(40.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046380982.1\|3674664_3676764_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	8.4e-132	42.9
WP_015715790.1\|3677129_3678173_+	membrane protein	NA	NA	NA	NA
WP_015715791.1\|3678486_3679146_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	5.6e-66	58.0
WP_003232462.1\|3679138_3679588_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_003232460.1\|3679580_3680312_+	7-carboxy-7-deazaguanine synthase QueE	E7DN68	Pneumococcus_phage	7.6e-56	47.2
WP_003218613.1\|3680329_3680827_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.4e-56	74.1
WP_003245808.1\|3681303_3681660_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_046380983.1\|3681828_3682575_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.6e-16	32.7

DBSCAN-SWA_277

3687640 : 3698424

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252205.1\|3687640_3688267_+	cell wall hydrolase	A0A141HRV8	Bacillus_phage	1.8e-26	52.7
WP_021479403.1\|3688384_3689722_+	sporulation protein YkvU	NA	NA	NA	NA
WP_029317723.1\|3689772_3690270_+	sporulation thiol-disulfide oxidoreductase StoA	NA	NA	NA	NA
WP_046380985.1\|3690505_3692419_+	metal-transporting ATPase PfeT	E4ZFI9	Streptococcus_phage	3.7e-118	40.7
WP_014476643.1\|3692456_3692660_-	hypothetical protein	NA	NA	NA	NA
WP_015715797.1\|3692825_3693920_+	di/tri-peptidase	NA	NA	NA	NA
WP_046380986.1\|3694201_3695167_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.4e-19	26.9
WP_046380987.1\|3695229_3696096_+	ptsGHI operon transcription antiterminator GlcT	NA	NA	NA	NA
WP_046380988.1\|3696324_3698424_+	PTS glucose transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	2.0e-08	50.0

DBSCAN-SWA_278

3702764 : 3713659

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032721455.1\|3702764_3704732_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-12	33.8
WP_003245029.1\|3704869_3705736_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_003244693.1\|3705775_3706549_-	hypothetical protein	U5Q0C0	Bacillus_phage	1.1e-41	65.6
WP_046380990.1\|3706885_3709006_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_046380991.1\|3709169_3710990_+	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-07	23.6
WP_003232415.1\|3710999_3712181_-	aminotransferase A	NA	NA	NA	NA
WP_003245246.1\|3712382_3712544_-	hypothetical protein	NA	NA	NA	NA
WP_014476655.1\|3712747_3713659_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	8.0e-47	33.8

DBSCAN-SWA_279

3717214 : 3717979

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232398.1\|3717214_3717979_+	2,4-dienoyl-CoA reductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.0e-39	39.0

DBSCAN-SWA_280

3722832 : 3724663

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032721469.1\|3722832_3723309_+	flavodoxin	A7KUZ7	Bacillus_phage	4.7e-14	34.9
WP_032721471.1\|3723298_3724192_+	hypothetical protein	NA	NA	NA	NA
WP_032721472.1\|3724207_3724663_+	flavodoxin	A7KUZ7	Bacillus_phage	3.8e-13	38.2

DBSCAN-SWA_281

3728667 : 3729114

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024571971.1\|3728667_3729114_+	thiol-disulfide oxidoreductase YkuV	A0A127AW88	Bacillus_phage	1.0e-34	47.9

DBSCAN-SWA_282

3735680 : 3741900

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244670.1\|3735680_3737438_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.4e-63	33.5
WP_046380994.1\|3737449_3739264_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.2e-55	30.9
WP_003232360.1\|3739373_3740069_+	YIP1 family protein	NA	NA	NA	NA
WP_038829597.1\|3740073_3741207_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003232356.1\|3741207_3741900_+	ABC transporter ATP-binding protein YknY	G9BWD6	Planktothrix_phage	4.8e-36	39.5

DBSCAN-SWA_283

3748160 : 3749783

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232344.1\|3748160_3749783_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	7.6e-48	27.0

DBSCAN-SWA_284

3753651 : 3755406

Paenibacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160216288.1\|3753651_3753930_+	transcriptional regulator AbhA	A0A2I7SC16	Paenibacillus_phage	9.7e-12	47.3
WP_003232333.1\|3754119_3755406_+	two-component sensor histidine kinase KinC	W8CYF6	Bacillus_phage	4.8e-21	29.7

DBSCAN-SWA_285

3761166 : 3762530

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245153.1\|3761166_3761940_+	Cof-type HAD-IIB family hydrolase	Q0GXW5	Lactococcus_phage	2.0e-06	22.6
WP_003245474.1\|3761975_3762530_-	peptide deformylase	E3SLL2	Synechococcus_phage	3.2e-14	40.8

DBSCAN-SWA_286

3767650 : 3769063

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232309.1\|3767650_3769063_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	7.5e-44	28.3

DBSCAN-SWA_287

3781903 : 3786576

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232278.1\|3781903_3783742_+	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	3.8e-19	38.8
WP_003232274.1\|3783798_3784116_+	membrane protein	NA	NA	NA	NA
WP_003232271.1\|3784171_3784381_-	YlaI family protein	NA	NA	NA	NA
WP_003232269.1\|3784463_3785093_-	YhcN/YlaJ family sporulation lipoprotein	NA	NA	NA	NA
WP_003245272.1\|3785247_3786576_+	PhoH family protein	A0A2I7SAD7	Vibrio_phage	3.1e-55	34.3

DBSCAN-SWA_288

3802162 : 3806347

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015483195.1\|3802162_3803203_+	CAP domain-containing protein	U5Q1E2	Bacillus_phage	9.9e-17	39.5
WP_003232233.1\|3803434_3803833_+	hypothetical protein	NA	NA	NA	NA
WP_046381000.1\|3803848_3804088_+	hypothetical protein	NA	NA	NA	NA
WP_003221370.1\|3804203_3804653_+	competence/sporulation regulator complex protein RicF	NA	NA	NA	NA
WP_015715839.1\|3804707_3804980_+	YlbG family protein	NA	NA	NA	NA
WP_029317761.1\|3805302_3805857_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_003245283.1\|3805861_3806347_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.2e-26	40.5

DBSCAN-SWA_289

3835066 : 3843138

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381007.1\|3835066_3839368_+	bacillopeptidase F	A0A217EQY2	Bacillus_phage	3.5e-23	32.1
WP_003232163.1\|3839562_3840492_+	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_003221446.1\|3840554_3841274_+	RNA polymerase sporulation sigma factor SigE	A0A0A0RV91	Bacillus_phage	8.1e-18	28.3
WP_009967190.1\|3841413_3842196_+	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	2.0e-46	43.9
WP_014479731.1\|3842343_3843138_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-11	27.1

DBSCAN-SWA_290

3849138 : 3859532

Moumouvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029946171.1\|3849138_3851904_+\|tRNA	isoleucine--tRNA ligase	A0A2P1ELB8	Moumouvirus	1.0e-81	26.0
WP_003245479.1\|3852048_3852423_+	sporulation-related RNA polymerase-binding protein YlyA	NA	NA	NA	NA
WP_003245047.1\|3852525_3852990_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_014479742.1\|3852991_3853903_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003232127.1\|3854085_3854631_+	bifunctional pyrimidine operon transcriptional regulator/uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_015483210.1\|3854804_3856112_+	uracil permease	Q9KX94	Enterobacteria_phage	2.6e-59	35.7
WP_046381008.1\|3856256_3857171_+	aspartate carbamoyltransferase catalytic subunit	M1HWF9	Paramecium_bursaria_Chlorella_virus	3.2e-35	35.0
WP_003232117.1\|3857154_3858441_+	dihydroorotase	NA	NA	NA	NA
WP_003232115.1\|3858437_3859532_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.5e-60	38.2

DBSCAN-SWA_291

3865100 : 3869743

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072557155.1\|3865100_3865751_+	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	1.4e-32	37.9
WP_042975738.1\|3866162_3866864_+	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_024572289.1\|3866875_3867940_+	sulfate permease	NA	NA	NA	NA
WP_046381009.1\|3867988_3869137_+	sulfate adenylyltransferase	A0A2K9L4R9	Tupanvirus	1.0e-38	29.2
WP_015252120.1\|3869149_3869743_+	adenylyl-sulfate kinase	A0A1B0XTK9	Freshwater_phage	2.5e-09	41.9

DBSCAN-SWA_292

3873745 : 3883735

Acanthocystis_turfacea_Chlorella_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381012.1\|3873745_3876418_+	calcium-translocating P-type ATPase, SERCA-type	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.3e-86	29.5
WP_015252115.1\|3876500_3877376_+	YicC family protein	NA	NA	NA	NA
WP_003154355.1\|3877452_3877722_+	extracellular matrix/biofilm regulator RemA	NA	NA	NA	NA
WP_003232083.1\|3877729_3878344_+	guanylate kinase	S4W1R9	Pandoravirus	1.1e-12	33.7
WP_003221520.1\|3878347_3878551_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_017694849.1\|3878633_3879854_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.1e-46	34.6
WP_046381013.1\|3879850_3882268_+	primosomal protein N'	NA	NA	NA	NA
WP_072175956.1\|3882279_3882777_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.2e-17	42.7
WP_046381014.1\|3882781_3883735_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	8.2e-10	33.6

DBSCAN-SWA_293

3886924 : 3888871

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252109.1\|3886924_3888871_+	serine/threonine protein kinase PrkC	A0A1B1IUU3	uncultured_Mediterranean_phage	8.3e-25	36.1

DBSCAN-SWA_294

3900295 : 3902242

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381016.1\|3900295_3901036_+	3-oxoacyl-[acyl-carrier-protein] reductase	Q06VL0	Trichoplusia_ni_ascovirus	8.9e-20	30.0
WP_003154310.1\|3901119_3901353_+	acyl carrier protein	M4M9G2	Vibrio_phage	7.1e-08	44.9
WP_003232030.1\|3901492_3902242_+	ribonuclease III	M4QMG4	Micromonas_pusilla_virus	4.2e-25	35.9

DBSCAN-SWA_295

3913230 : 3913998

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038828231.1\|3913230_3913998_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	8.6e-26	43.1

DBSCAN-SWA_296

3918359 : 3925859

Thermus_phage(25.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014479775.1\|3918359_3919253_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.3e-28	37.1
WP_046381022.1\|3919440_3921516_+	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	2.1e-103	39.9
WP_003244725.1\|3921591_3922899_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_003231988.1\|3922966_3923881_+	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	5.2e-30	29.8
WP_003238555.1\|3923893_3924439_+\|protease	ATP-dependent protease subunit ClpQ	NA	NA	NA	NA
WP_046381023.1\|3924455_3925859_+	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	4.9e-43	27.4

DBSCAN-SWA_297

3952272 : 3953037

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015252090.1\|3952272_3953037_+	RNA polymerase sigma-28 factor SigD	A0A0A0PIT2	Bacillus_phage	2.3e-07	26.0

DBSCAN-SWA_298

3956993 : 3957776

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231925.1\|3956993_3957776_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	3.7e-24	43.0

DBSCAN-SWA_299

3962912 : 3974564

Clostridium_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381028.1\|3962912_3967226_+	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	1.6e-23	33.2
WP_003231915.1\|3967555_3968026_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003231912.1\|3968060_3969176_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_009967250.1\|3969189_3969465_+	glucose-induced regulator RulR	NA	NA	NA	NA
WP_003220946.1\|3969466_3969769_+	YlxQ family RNA-binding protein	NA	NA	NA	NA
WP_014479801.1\|3969788_3971939_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.8e-23	25.2
WP_003220950.1\|3971935_3972214_+	DUF503 domain-containing protein	NA	NA	NA	NA
WP_009967251.1\|3972230_3972584_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_015252083.1\|3972665_3973595_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_046381029.1\|3973613_3974564_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	1.2e-08	28.5

DBSCAN-SWA_300

3978395 : 3979625

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245717.1\|3978395_3979625_+	insulinase family protein	G3MBJ8	Bacillus_virus	8.8e-49	32.1

DBSCAN-SWA_301

3988056 : 3996165

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381035.1\|3988056_3990420_+	DNA translocase SpoIIIE	A0A218M9A2	Mycobacterium_phage	1.4e-87	47.1
WP_003245732.1\|3990563_3991289_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003231863.1\|3991406_3992639_+	bacillibactin exporter BcbE	NA	NA	NA	NA
WP_015715896.1\|3992818_3994099_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	1.3e-50	29.1
WP_003244823.1\|3994095_3995382_+	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	6.1e-08	27.9
WP_046381036.1\|3995436_3996165_+	EF-P-5 aminopentanone reductase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-13	28.0

DBSCAN-SWA_302

4000427 : 4008478

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245789.1\|4000427_4001474_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.9e-137	73.7
WP_003245877.1\|4001641_4002817_+	serine hydrolase	A0A0B5A438	Mycobacterium_phage	1.5e-08	24.8
WP_003221010.1\|4003092_4004655_+	ribonuclease Y	NA	NA	NA	NA
WP_003245138.1\|4004723_4005518_+	2',3'-cyclic-nucleotide 2'-phosphodiesterase	NA	NA	NA	NA
WP_003154135.1\|4005717_4005978_+	stage V sporulation protein SpoVS	J9PTX7	Bacillus_phage	1.2e-08	42.5
WP_160216291.1\|4006243_4007287_+	L-threonine 3-dehydrogenase	E3SJ82	Synechococcus_phage	2.3e-21	26.2
WP_003231837.1\|4007299_4008478_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	7.7e-50	33.1

DBSCAN-SWA_303

4011527 : 4016003

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003244841.1\|4011527_4014104_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.4e-40	27.7
WP_003245099.1\|4014119_4016003_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	5.9e-68	31.0

DBSCAN-SWA_304

4028588 : 4094310

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046381038.1\|4028588_4043720_+	non-ribosomal peptide synthetase	D0R7J2	Paenibacillus_phage	3.8e-125	59.6
WP_160216293.1\|4043703_4057332_+	polyketide synthase PksL	D0R7J2	Paenibacillus_phage	8.3e-39	31.3
WP_069704101.1\|4057347_4070130_+	polyketide synthase PksM	D0R7J2	Paenibacillus_phage	9.6e-37	31.7
WP_080481053.1\|4070197_4086661_+	non-ribosomal peptide synthetase	D0R7J2	Paenibacillus_phage	1.2e-119	56.1
WP_069704100.1\|4086675_4094310_+	methyltransferase	D0R7J2	Paenibacillus_phage	2.0e-37	29.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028216

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028215

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection