CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP028231	Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
NZ_CP028234	Lactobacillus plantarum strain SRCM101222 plasmid unnamed5, complete sequence	0 crisprs	csa3	0	3
NZ_CP028229	Lactobacillus plantarum strain SRCM101222 chromosome, complete genome	2 crisprs	cas3,DinG,csa3,csn2,cas2,cas1,cas9,WYL,DEDDh	8	7
NZ_CP028232	Lactobacillus plantarum strain SRCM101222 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0
NZ_CP028230	Lactobacillus plantarum strain SRCM101222 plasmid unnamed1, complete sequence	0 crisprs	NA	0	2
NZ_CP028233	Lactobacillus plantarum strain SRCM101222 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028229_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028229_1

960364-961191

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

12 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP028229_1

>merge|NZ_CP028229|1|960364-961191|CRT,PILER-CR,CRISPRCasFinder
TGTGAAACTGTTTTTGATGTGGCCGTTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTGTCTTGTTCCTTGTTGTACTCCATACCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGGATCAGAAGCGATTTATGAGTACAATGATGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACTCACAAAGGTTCCGTATCTGTCGGTCTAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGTCCTGATCTTACATCTAGCAAGGCTCGGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGTAATTGAGTGTTGATATTCTCTTTACTTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACGTAACTTTAAGCTGTTGCACAAACTGCGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAACTCAGTTCTGAACGGTGCCTTATTGACGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAGAGCAGTAATTGCTTGACTATAGTTACTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTACCGGCTTTACAATAACGTGATATTCCTTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGCCTATTATCCGGCTAGAAAAACCTCCGGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACAGTCAGAATGGACTGGTTATTGGCAACGGGGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028229|1|1|960364-961191|CRT
TGTGAAACTGTTTTTGATGTGGCCGTTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGCCTATTATCCGGCTAGAAAAACCTCCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCAGAATGGACTGGTTATTGGCAACGGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028229|1|1|960430-961191|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGCCTATTATCCGGCTAGAAAAACCTCCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCAGAATGGACTGGTTATTGGCAACGGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028229|1|1|960430-961191|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GGATCAGAAGCGATTTATGAGTACAATGAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACTCACAAAGGTTCCGTATCTGTCGGTCTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCCTGATCTTACATCTAGCAAGGCTCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGAGTGTTGATATTCTCTTTACTTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTAACTTTAAGCTGTTGCACAAACTGCG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAACTCAGTTCTGAACGGTGCCTTATTGAC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAGAGCAGTAATTGCTTGACTATAGTTACT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACCGGCTTTACAATAACGTGATATTCCTT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGCCTATTATCCGGCTAGAAAAACCTCCGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	AGTCAGAATGGACTGGTTATTGGCAACGGG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028229.1\|WP_160231107.1\|969257_970622_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP028229.1\|WP_003641731.1\|956300_956903_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP028229.1\|WP_045351426.1\|950051_950900_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381297
NZ_CP028229.1\|WP_063722121.1\|967637_968420_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP028229.1\|WP_160248267.1\|973276_974017_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP028229.1\|WP_108909660.1\|952400_952766_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP028229.1\|WP_160231106.1\|968444_969152_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028229.1\|WP_003641730.1\|956968_957163_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP028229.1\|WP_160231108.1\|971440_973033_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
NZ_CP028229.1\|WP_003641733.1\|955145_955568_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP028229.1\|WP_060684252.1\|961215_961893_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP028229.1\|WP_015379640.1\|961889_962195_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP028229.1\|WP_003641732.1\|955713_956187_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197670
NZ_CP028229.1\|WP_003641738.1\|951143_952337_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
NZ_CP028229.1\|WP_160231105.1\|963272_967349_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP028229.1\|WP_060684251.1\|962172_963078_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP028229.1\|WP_003646323.1\|954602_955058_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP028229.1\|WP_003641724.1\|970854_971325_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP028229.1\|WP_054399469.1\|952790_954023_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP028229.1\|WP_063204128.1\|957561_960300_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775

Protein	Function_ID	Function_description	E-value
NZ_CP028229.1\|WP_160231107.1\|969257_970622_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP028229.1\|WP_003641731.1\|956300_956903_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	5.27584e-30
NZ_CP028229.1\|WP_045351426.1\|950051_950900_-\|aldo/keto-reductase	gnl\|CDD\|381297	cd19071, AKR_AKR1-5-like, AKR1/2/3/4/5 family of aldo-keto reductase (AKR) and similar proteins. Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. The family includes AKR1A/B/C/D/E/G/I, AKR2A/B/C/D/E, AKR3A/B/C/D/E/G, AKR4A/B/C, AKR5A/B/C/D/E/F/G/H, and similar proteins.	7.60293e-121
NZ_CP028229.1\|WP_063722121.1\|967637_968420_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.17929e-25
NZ_CP028229.1\|WP_108909660.1\|952400_952766_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	3.66649e-14
NZ_CP028229.1\|WP_160248267.1\|973276_974017_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	1.53041e-87
NZ_CP028229.1\|WP_003641730.1\|956968_957163_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP028229.1\|WP_160231108.1\|971440_973033_-\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	1.88552e-17
NZ_CP028229.1\|WP_003641733.1\|955145_955568_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NZ_CP028229.1\|WP_060684252.1\|961215_961893_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.57931e-80
NZ_CP028229.1\|WP_015379640.1\|961889_962195_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NZ_CP028229.1\|WP_003641732.1\|955713_956187_-\|hypothetical-protein	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	4.83323e-10
NZ_CP028229.1\|WP_003641738.1\|951143_952337_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
NZ_CP028229.1\|WP_160231105.1\|963272_967349_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.56856e-128
NZ_CP028229.1\|WP_060684251.1\|962172_963078_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.76066e-89
NZ_CP028229.1\|WP_003646323.1\|954602_955058_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NZ_CP028229.1\|WP_003641724.1\|970854_971325_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
NZ_CP028229.1\|WP_054399469.1\|952790_954023_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.42462e-140
NZ_CP028229.1\|WP_063204128.1\|957561_960300_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0

>NZ_CP028229.1|WP_063204128.1|957561_960300_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHGPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>NZ_CP028229.1|WP_003641730.1|956968_957163_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP028229.1|WP_003641731.1|956300_956903_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>NZ_CP028229.1|WP_003641732.1|955713_956187_-|hypothetical-protein
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGQHGPSRAKTLPVPTGLSQATISRGLTKLARLELATKYRDLTNNKEVLVRLTALGEAGAELHTQLDAAIAAKAQAIVDDYSDAELTRFVSLMRRIREIKL
>NZ_CP028229.1|WP_003641733.1|955145_955568_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP028229.1|WP_003646323.1|954602_955058_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NZ_CP028229.1|WP_054399469.1|952790_954023_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRTVS
>NZ_CP028229.1|WP_108909660.1|952400_952766_-|winged-helix-turn-helix-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKALRLVGLTNTRREAQTKYLSLQLATFDRLLPGFLATL
>NZ_CP028229.1|WP_003641738.1|951143_952337_-|MFS-transporter
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE
>NZ_CP028229.1|WP_045351426.1|950051_950900_-|aldo/keto-reductase
MTVLTTMYQLANGVNIPKVAFGTWQIPGGEATYQAVRAALAAGYRHIDTALAYQNEASVGQAIRDSGIPREQIFVTTKLPAETKSYQGALNDFDRSLKNLGLDYVDLYLVHAPWPWGQVGRVYDEANLDVWQAMEAIYQSGRAKAIGVSNFAVRDLKNILNQATIPPMINQIQYYLGFTEPKITKFSEEHAMLVEAYSPLATGGVLDNPQVQAYADKYGVSVAQLALRFVLQNGVLPLPKAVNPAHIEANTQLDFAISVADMQALNDLPDAAGSYMHNPTQG
>NZ_CP028229.1|WP_060684252.1|961215_961893_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNISHYLDQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP028229.1|WP_015379640.1|961889_962195_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP028229.1|WP_060684251.1|962172_963078_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPDEVSSDAINSHV
>NZ_CP028229.1|WP_160231105.1|963272_967349_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIINNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKYKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFIYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>NZ_CP028229.1|WP_063722121.1|967637_968420_-|alpha/beta-hydrolase
MHFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPQMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NZ_CP028229.1|WP_160231106.1|968444_969152_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQQPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLSQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAEPDDKTRQWLEKLQKLTPQDFNNHVE
>NZ_CP028229.1|WP_160231107.1|969257_970622_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIFAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP028229.1|WP_003641724.1|970854_971325_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP028229.1|WP_160231108.1|971440_973033_-|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP028229.1|WP_160248267.1|973276_974017_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGIDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTISDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028229_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028229_2

1608620-1608705

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028229_2

>merge|NZ_CP028229|2|1608620-1608705|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP028229|2|2|1608620-1608705|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028229.1\|WP_022638460.1\|1608719_1610198_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP028229.1\|WP_011102045.1\|1600741_1601248_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP028229.1\|WP_003642350.1\|1605921_1606716_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP028229.1\|WP_160248307.1\|1611487_1612054_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP028229.1\|WP_160231198.1\|1603178_1603691_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP028229.1\|WP_160231199.1\|1610314_1611268_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP028229.1\|WP_011102043.1\|1603934_1604930_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP028229.1\|WP_003642342.1\|1614091_1614820_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP028229.1\|WP_011102046.1\|1599646_1600483_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP028229.1\|WP_160248309.1\|1616171_1618754_+\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119382
NZ_CP028229.1\|WP_160248305.1\|1602304_1603198_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP028229.1\|WP_011102042.1\|1606952_1607882_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP028229.1\|WP_003642340.1\|1615601_1615886_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP028229.1\|WP_003643398.1\|1608002_1608602_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP028229.1\|WP_003642344.1\|1612202_1613240_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP028229.1\|WP_011102039.1\|1614952_1615318_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP028229.1\|WP_011102040.1\|1613366_1613933_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP028229.1\|WP_003643400.1\|1604926_1605925_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP028229.1\|WP_003642355.1\|1601264_1602011_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP028229.1\|WP_003642338.1\|1619024_1620437_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418

Protein	Function_ID	Function_description	E-value
NZ_CP028229.1\|WP_022638460.1\|1608719_1610198_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.10264e-72
NZ_CP028229.1\|WP_011102045.1\|1600741_1601248_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	7.15338e-54
NZ_CP028229.1\|WP_003642350.1\|1605921_1606716_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP028229.1\|WP_160248307.1\|1611487_1612054_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	4.3842e-29
NZ_CP028229.1\|WP_160231198.1\|1603178_1603691_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	4.00107e-08
NZ_CP028229.1\|WP_160231199.1\|1610314_1611268_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.22089e-131
NZ_CP028229.1\|WP_011102043.1\|1603934_1604930_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.80019e-78
NZ_CP028229.1\|WP_003642342.1\|1614091_1614820_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
NZ_CP028229.1\|WP_011102046.1\|1599646_1600483_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.88105e-54
NZ_CP028229.1\|WP_160248309.1\|1616171_1618754_+\|glycoside-hydrolase-family-25	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	3.0351e-70
NZ_CP028229.1\|WP_160248305.1\|1602304_1603198_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.78108e-130
NZ_CP028229.1\|WP_011102042.1\|1606952_1607882_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	1.50683e-56
NZ_CP028229.1\|WP_003642340.1\|1615601_1615886_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP028229.1\|WP_003643398.1\|1608002_1608602_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP028229.1\|WP_003642344.1\|1612202_1613240_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP028229.1\|WP_011102039.1\|1614952_1615318_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
NZ_CP028229.1\|WP_011102040.1\|1613366_1613933_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
NZ_CP028229.1\|WP_003643400.1\|1604926_1605925_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP028229.1\|WP_003642355.1\|1601264_1602011_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP028229.1\|WP_003642338.1\|1619024_1620437_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0

>NZ_CP028229.1|WP_003643398.1|1608002_1608602_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP028229.1|WP_011102042.1|1606952_1607882_+|ABC-transporter-substrate-binding-protein
MTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP028229.1|WP_003642350.1|1605921_1606716_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP028229.1|WP_003643400.1|1604926_1605925_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP028229.1|WP_011102043.1|1603934_1604930_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP028229.1|WP_160231198.1|1603178_1603691_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLHHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP028229.1|WP_160248305.1|1602304_1603198_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEELITIAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP028229.1|WP_003642355.1|1601264_1602011_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP028229.1|WP_011102045.1|1600741_1601248_+|acetyltransferase
MQTIQPIVDANQRRIQALNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIKLADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP028229.1|WP_011102046.1|1599646_1600483_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVILPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP028229.1|WP_022638460.1|1608719_1610198_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAETYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP028229.1|WP_160231199.1|1610314_1611268_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNRDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP028229.1|WP_160248307.1|1611487_1612054_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMGSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP028229.1|WP_003642344.1|1612202_1613240_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP028229.1|WP_011102040.1|1613366_1613933_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>NZ_CP028229.1|WP_003642342.1|1614091_1614820_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP028229.1|WP_011102039.1|1614952_1615318_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP028229.1|WP_003642340.1|1615601_1615886_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP028229.1|WP_160248309.1|1616171_1618754_+|glycoside-hydrolase-family-25
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADATNATTTSSSAASTASSASVATSSAASDATTKATSVSSSAATQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAATSTSATATSQATSVASSTATTTQVSHTASSTAASAASSTATVKAVKAASSTVSSAATTATKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEITTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTAAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP028229.1|WP_003642338.1|1619024_1620437_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_LM651913	Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence	2768-2797	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042423	Leuconostoc lactis strain CBA3622 plasmid unnamed3	9348-9377	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042423	Leuconostoc lactis strain CBA3622 plasmid unnamed3	21371-21400	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042423	Leuconostoc lactis strain CBA3622 plasmid unnamed3	60461-60490	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042423	Leuconostoc lactis strain CBA3622 plasmid unnamed3	72484-72513	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042423	Leuconostoc lactis strain CBA3622 plasmid unnamed3	35844-35873	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP016600	Leuconostoc lactis strain WiKim40 plasmid pWK40-2, complete sequence	3905-3934	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_010467	Leuconostoc citreum KM20 plasmid pLCK3, complete sequence	16313-16342	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_LN890332	Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1 plasmid II, complete sequence	32645-32674	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_KF559315	Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence	1742-1771	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_014133	Leuconostoc kimchii IMSNU 11154 plasmid LkipL4719, complete sequence	11951-11980	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042422	Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence	13499-13528	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_014131	Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence	4846-4875	0	1.0
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NZ_CP028984	Lactobacillus plantarum strain LQ80 plasmid pLQ807, complete sequence	201-230	0	1.0
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	122437-122466	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_017472	Lactobacillus amylovorus GRL1118 plasmid p2, complete sequence	67077-67106	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	AP018703	Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid4 DNA, complete genome	1462-1491	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP017198	Leuconostoc gelidum subsp. gasicomitatum strain TMW 2.1619 plasmid pL21619-1, complete genome	26245-26274	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP031207	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence	2607-2636	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_014135	Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence	2640-2669	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_019900	Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence	2434-2463	1	0.967
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_LN890332	Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1 plasmid II, complete sequence	19919-19948	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP014614	Leuconostoc mesenteroides subsp. jonggajibkimchii strain DRC1506 plasmid pDRC3, complete sequence	8118-8147	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP037937	Leuconostoc kimchii strain NKJ218 plasmid pLKN2, complete sequence	2096-2125	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_JN106352	Leuconostoc mesenteroides subsp. mesenteroides strain KCTC 13302 plasmid pMBLT00, complete sequence	17178-17207	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP017200	Leuconostoc gelidum subsp. gasicomitatum strain TMW 2.1619 plasmid pL21619-3, complete genome	16013-16042	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP021969	Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713103, complete sequence	12367-12396	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP021969	Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713103, complete sequence	26571-26600	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042397	Leuconostoc citreum strain CBA3623 plasmid unnamed4, complete sequence	921-950	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042388	Leuconostoc lactis strain CBA3625 plasmid unnamed, complete sequence	5171-5200	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP016330	Leuconostoc garlicum strain KFRI01 plasmid unnamed1, complete sequence	4661-4690	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP016599	Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence	1655-1684	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_AP017938	Leuconostoc mesenteroides strain LK-151 plasmid pLm151-b, complete sequence	2189-2218	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP027428	Weissella cibaria strain BM2 plasmid pBM2, complete sequence	1242-1271	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042391	Leuconostoc lactis strain CBA3626 plasmid unnamed, complete sequence	142-171	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042391	Leuconostoc lactis strain CBA3626 plasmid unnamed, complete sequence	33674-33703	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP038167	Enterococcus faecium strain SC3-1 plasmid pSC3-1, complete sequence	17464-17493	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_010466	Leuconostoc citreum KM20 plasmid pLCK2, complete sequence	2378-2407	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP012368	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 2, complete sequence	16845-16874	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP012386	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 2, complete sequence	29341-29370	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP026848	Weissella koreensis strain WiKim0080 plasmid pWKW_1, complete sequence	11436-11465	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_014132	Leuconostoc kimchii IMSNU 11154 plasmid LkipL4704, complete sequence	130-159	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042398	Leuconostoc citreum strain CBA3623 plasmid unnamed5, complete sequence	10595-10624	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	7413-7442	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	20507-20536	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP023006	Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence	33601-33630	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042376	Leuconostoc carnosum strain CBA3620 plasmid unnamed2, complete sequence	27545-27574	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042376	Leuconostoc carnosum strain CBA3620 plasmid unnamed2, complete sequence	49346-49375	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP016331	Leuconostoc garlicum strain KFRI01 plasmid unnamed2, complete sequence	10831-10860	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_004528	Leuconostoc citreum pLC22R plasmid, complete genome	6314-6343	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_016828	Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE04, complete sequence	11642-11671	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_AP017937	Leuconostoc mesenteroides strain LK-151 plasmid pLm151-a, complete sequence	13840-13869	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP020461	Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2	12190-12219	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP012875	Weissella cibaria strain CH2 plasmid pMKC02, complete sequence	8184-8213	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP012875	Weissella cibaria strain CH2 plasmid pMKC02, complete sequence	22706-22735	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP035269	Weissella cibaria strain SRCM103448 plasmid unnamed2, complete sequence	8121-8150	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	188026-188055	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP014604	Leuconostoc mesenteroides subsp. mesenteroides strain DRC0211 plasmid pDSK4, complete sequence	18589-18618	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP038162	Enterococcus faecium strain GZ8 plasmid pGZ8, complete sequence	34177-34206	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NZ_CP042402	Weissella hellenica strain CBA3632 plasmid unnamed3, complete sequence	13848-13877	2	0.933
NZ_CP028229_1	1.11\|961060\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961060-961089	30	NC_019353	Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence	1482-1511	4	0.867
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NZ_KM272265	Lactobacillus plantarum strain ATIT-023 plasmid pLP-8, complete sequence	1497-1526	4	0.867
NZ_CP028229_1	1.10\|960994\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960994-961023	30	MG744354	Lactobacillus phage Satyr, complete genome	2429-2458	5	0.833
NZ_CP028229_1	1.10\|960994\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960994-961023	30	MG765274	Lactobacillus phage Maenad, complete genome	2444-2473	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_024985	Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence	593-622	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_014919	Lactobacillus brevis strain D11 plasmid pSD11, complete sequence	1174-1203	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_016035	Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-1, complete sequence	563-592	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_007593	Pediococcus damnosus plasmid pF8801, complete sequence	4466-4495	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_012722	Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1	1972-2001	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_009666	Lactobacillus plantarum M4 plasmid pM4, complete sequence	975-1004	5	0.833
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NZ_CP013167	Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence	713-742	5	0.833
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	MF999224	Lactobacillus phage LJ, complete genome	20190-20219	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_041973	Erwinia phage vB_EamM_RAY, complete genome	149726-149755	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NC_042098	Erwinia phage vB_EamM_Desertfox, complete genome	151166-151195	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	MG655267	Erwinia phage vB_EamM_Bosolaphorus, complete genome	150858-150887	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	KU886225	Erwinia phage vB_EamM_Deimos-Minion, complete genome	151397-151426	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	MG655269	Erwinia phage vB_EamM_MadMel, complete genome	151177-151206	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	KF806589	Erwinia phage Ea35-70, complete genome	149255-149284	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	MG655270	Erwinia phage vB_EamM_Mortimer, complete genome	152217-152246	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	MK514281	Erwinia phage Rebecca, complete genome	151327-151356	6	0.8
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	KU886223	Erwinia phage vB_EamM_Simmy50, complete genome	149553-149582	6	0.8
NZ_CP028229_1	1.6\|960730\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960730-960759	30	NZ_CP013615	Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence	137496-137525	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NZ_CP032297	Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence	438717-438746	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NZ_CP036488	Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence	130158-130187	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NC_017060	Rahnella aquatilis HX2 plasmid PRA1, complete sequence	206520-206549	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NC_015062	Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence	209307-209336	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NZ_CP034838	Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence	195905-195934	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NZ_CP034839	Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence	195905-195934	7	0.767
NZ_CP028229_1	1.7\|960796\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960796-960825	30	NZ_CP034837	Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence	156219-156248	7	0.767
NZ_CP028229_1	1.8\|960862\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960862-960891	30	CP040041	Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence	44809-44838	7	0.767
NZ_CP028229_1	1.9\|960928\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960928-960957	30	NC_019909	Yersinia phage phiR1-RT complete genome	58003-58032	7	0.767
NZ_CP028229_1	1.10\|960994\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960994-961023	30	JX486088	Lactobacillus phage ATCC 8014-B2, complete genome	78901-78930	7	0.767
NZ_CP028229_1	1.5\|960664\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	960664-960693	30	MN693541	Marine virus AFVG_25M436, complete genome	21215-21244	8	0.733
NZ_CP028229_1	1.12\|961126\|30\|NZ_CP028229\|CRT,PILER-CR,CRISPRCasFinder	961126-961155	30	NZ_CP045407	Roseovarius sp. THAF9 plasmid pTHAF9_c, complete sequence	79868-79897	8	0.733

1. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_LM651913 (Leuconostoc citreum strain NRRL B-1299 plasmid 1, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

2. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042423 (Leuconostoc lactis strain CBA3622 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

3. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042423 (Leuconostoc lactis strain CBA3622 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

4. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042423 (Leuconostoc lactis strain CBA3622 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

5. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042423 (Leuconostoc lactis strain CBA3622 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

6. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042423 (Leuconostoc lactis strain CBA3622 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

7. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP016600 (Leuconostoc lactis strain WiKim40 plasmid pWK40-2, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

8. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_010467 (Leuconostoc citreum KM20 plasmid pLCK3, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

9. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_LN890332 (Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1 plasmid II, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

10. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_KF559315 (Lactobacillus sakei strain KCA311 plasmid pKCA3, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

11. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_014133 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL4719, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

12. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042422 (Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

13. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_014131 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence) position: , mismatch: 0, identity: 1.0

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccgg	Protospacer
******************************

14. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP028984 (Lactobacillus plantarum strain LQ80 plasmid pLQ807, complete sequence) position: , mismatch: 0, identity: 1.0

agtcagaatggactggttattggcaacggg	CRISPR spacer
agtcagaatggactggttattggcaacggg	Protospacer
******************************

15. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccga	Protospacer
*****************************.

16. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_017472 (Lactobacillus amylovorus GRL1118 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccga	Protospacer
*****************************.

17. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to AP018703 (Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid4 DNA, complete genome) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctccga	Protospacer
*****************************.

18. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP017198 (Leuconostoc gelidum subsp. gasicomitatum strain TMW 2.1619 plasmid pL21619-1, complete genome) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctatcatccggctagaaaaacctccgg	Protospacer
*******.**********************

19. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP031207 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_I, complete sequence) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaaactccgg	Protospacer
*********************** ******

20. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_014135 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL48, complete sequence) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctaggaaaacctccgg	Protospacer
******************.***********

21. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_019900 (Lactobacillus plantarum strain BFE 5092 plasmid pMRI 5.2, complete sequence) position: , mismatch: 1, identity: 0.967

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaacctctgg	Protospacer
***************************.**

22. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_LN890332 (Leuconostoc gelidum subsp. gasicomitatum KG16-1 isolate LEKG1 plasmid II, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

23. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP014614 (Leuconostoc mesenteroides subsp. jonggajibkimchii strain DRC1506 plasmid pDRC3, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

24. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP037937 (Leuconostoc kimchii strain NKJ218 plasmid pLKN2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

25. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_JN106352 (Leuconostoc mesenteroides subsp. mesenteroides strain KCTC 13302 plasmid pMBLT00, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

26. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP017200 (Leuconostoc gelidum subsp. gasicomitatum strain TMW 2.1619 plasmid pL21619-3, complete genome) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

27. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP021969 (Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713103, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

28. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP021969 (Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713103, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

29. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042397 (Leuconostoc citreum strain CBA3623 plasmid unnamed4, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

30. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042388 (Leuconostoc lactis strain CBA3625 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

31. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP016330 (Leuconostoc garlicum strain KFRI01 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

32. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP016599 (Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

33. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_AP017938 (Leuconostoc mesenteroides strain LK-151 plasmid pLm151-b, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

34. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP027428 (Weissella cibaria strain BM2 plasmid pBM2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

35. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042391 (Leuconostoc lactis strain CBA3626 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

36. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042391 (Leuconostoc lactis strain CBA3626 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

37. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP038167 (Enterococcus faecium strain SC3-1 plasmid pSC3-1, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

38. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_010466 (Leuconostoc citreum KM20 plasmid pLCK2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

39. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP012368 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

40. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP012386 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

41. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP026848 (Weissella koreensis strain WiKim0080 plasmid pWKW_1, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

42. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_014132 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL4704, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

43. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042398 (Leuconostoc citreum strain CBA3623 plasmid unnamed5, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

44. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

45. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

46. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP023006 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1302, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

47. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042376 (Leuconostoc carnosum strain CBA3620 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

48. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042376 (Leuconostoc carnosum strain CBA3620 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

49. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP016331 (Leuconostoc garlicum strain KFRI01 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctcgtaaaacctccgg	Protospacer
**************** * ***********

50. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_004528 (Leuconostoc citreum pLC22R plasmid, complete genome) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

51. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_016828 (Leuconostoc mesenteroides subsp. mesenteroides J18 plasmid pKLE04, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgcaaaacctccgg	Protospacer
**************** * ***********

52. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_AP017937 (Leuconostoc mesenteroides strain LK-151 plasmid pLm151-a, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

53. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP020461 (Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

54. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP012875 (Weissella cibaria strain CH2 plasmid pMKC02, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

55. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP012875 (Weissella cibaria strain CH2 plasmid pMKC02, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

56. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP035269 (Weissella cibaria strain SRCM103448 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

57. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

58. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP014604 (Leuconostoc mesenteroides subsp. mesenteroides strain DRC0211 plasmid pDSK4, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgcaaaacctccgg	Protospacer
**************** * ***********

59. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP038162 (Enterococcus faecium strain GZ8 plasmid pGZ8, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

60. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP042402 (Weissella hellenica strain CBA3632 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggcttgtaaaacctccgg	Protospacer
**************** * ***********

61. spacer 1.11|961060|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_019353 (Leuconostoc mesenteroides subsp. mesenteroides plasmid pMBLR00, complete sequence) position: , mismatch: 4, identity: 0.867

cgcctattatccggctagaaaaacctccgg	CRISPR spacer
cgcctattatccggctagaaaaaacctccg	Protospacer
*********************** *..* *

62. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_KM272265 (Lactobacillus plantarum strain ATIT-023 plasmid pLP-8, complete sequence) position: , mismatch: 4, identity: 0.867

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggactggatattggcaacgag	Protospacer
*. ************* ***********.*

63. spacer 1.10|960994|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MG744354 (Lactobacillus phage Satyr, complete genome) position: , mismatch: 5, identity: 0.833

taccggctttacaataacgtgatattcctt	CRISPR spacer
agccggctttacaacaacgtggtattcctg	Protospacer
 .************.******.*******

64. spacer 1.10|960994|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MG765274 (Lactobacillus phage Maenad, complete genome) position: , mismatch: 5, identity: 0.833

taccggctttacaataacgtgatattcctt	CRISPR spacer
agccggctttacaacaacgtggtattcctg	Protospacer
 .************.******.*******

65. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_024985 (Lactobacillus plantarum subsp. plantarum strain Zhang-11 plasmid pZL2, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggactagatattggcaacgag	Protospacer
*. ***********.* ***********.*

66. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_014919 (Lactobacillus brevis strain D11 plasmid pSD11, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aaacagaatggactagatattggcaacgag	Protospacer
*. ***********.* ***********.*

67. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_016035 (Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-1, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggaccgggtattggcaacgag	Protospacer
*. **********.** ***********.*

68. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_007593 (Pediococcus damnosus plasmid pF8801, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggaccgggtattggcaacgag	Protospacer
*. **********.** ***********.*

69. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_012722 (Lactobacillus pentosus p1-4 plasmid complete sequence, strain F121-1) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggactagatattggcaacgag	Protospacer
*. ***********.* ***********.*

70. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_009666 (Lactobacillus plantarum M4 plasmid pM4, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aaacagaatggactagatattggcaacgag	Protospacer
*. ***********.* ***********.*

71. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP013167 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-12, complete sequence) position: , mismatch: 5, identity: 0.833

agtcagaatggactggttattggcaacggg	CRISPR spacer
aagcagaatggactagatattggcaacgag	Protospacer
*. ***********.* ***********.*

72. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MF999224 (Lactobacillus phage LJ, complete genome) position: , mismatch: 6, identity: 0.8

acgt-aactttaagctgttgcacaaactgcg	CRISPR spacer
-cgtcaaccttaagctgtttcacaaacttta	Protospacer
 *** ***.********** ******** ..

73. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_041973 (Erwinia phage vB_EamM_RAY, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

74. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_042098 (Erwinia phage vB_EamM_Desertfox, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

75. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MG655267 (Erwinia phage vB_EamM_Bosolaphorus, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

76. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to KU886225 (Erwinia phage vB_EamM_Deimos-Minion, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

77. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MG655269 (Erwinia phage vB_EamM_MadMel, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

78. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to KF806589 (Erwinia phage Ea35-70, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

79. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MG655270 (Erwinia phage vB_EamM_Mortimer, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

80. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MK514281 (Erwinia phage Rebecca, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

81. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to KU886223 (Erwinia phage vB_EamM_Simmy50, complete genome) position: , mismatch: 6, identity: 0.8

agtcagaatggactggttattggcaacggg	CRISPR spacer
cgtttgaaggtactggttattggcaacggc	Protospacer
 **. *** * ******************

82. spacer 1.6|960730|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP013615 (Clostridium perfringens strain JP838 plasmid pJFP838A, complete sequence) position: , mismatch: 7, identity: 0.767

gtaattgagtgttgatattctctttacttt	CRISPR spacer
taaattgagtttttatattctctttcttct	Protospacer
  ******** ** *********** .*.*

83. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP032297 (Rahnella aquatilis strain ZF7 plasmid pRAZF7, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

84. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP036488 (Rahnella aquatilis strain MEM40 plasmid pMEM40-1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

85. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_017060 (Rahnella aquatilis HX2 plasmid PRA1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

86. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_015062 (Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

87. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP034838 (Rahnella aquatilis strain KM12 plasmid pKM12v1, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

88. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP034839 (Rahnella aquatilis strain KM25 plasmid pKM12v2, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

89. spacer 1.7|960796|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP034837 (Rahnella aquatilis strain KM05 plasmid pKM05, complete sequence) position: , mismatch: 7, identity: 0.767

acgtaactttaagctgttgcacaaactgcg	CRISPR spacer
cggtgcctttaagctgtggcaaaaactgcc	Protospacer
  **. *********** *** *******

90. spacer 1.8|960862|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to CP040041 (Acinetobacter baumannii strain VB958 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

taactcagttctgaacggtgccttattgac	CRISPR spacer
caaggaagttctgaacggtggcttgttgat	Protospacer
.**   ************** ***.****.

91. spacer 1.9|960928|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NC_019909 (Yersinia phage phiR1-RT complete genome) position: , mismatch: 7, identity: 0.767

tagagcagtaattgcttgactatagttact	CRISPR spacer
acgagtagtaatagcttgactatagtaatc	Protospacer
  ***.****** ************* *..

92. spacer 1.10|960994|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to JX486088 (Lactobacillus phage ATCC 8014-B2, complete genome) position: , mismatch: 7, identity: 0.767

taccggctttacaataacgtgatattcctt	CRISPR spacer
ggctggctttacaataacatggtattctct	Protospacer
 .*.**************.**.*****..*

93. spacer 1.5|960664|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to MN693541 (Marine virus AFVG_25M436, complete genome) position: , mismatch: 8, identity: 0.733

agtcctgatcttacatctagcaaggctcgg	CRISPR spacer
attgatgatcttacatctagcaatgcaaca	Protospacer
* *  ****************** **   .

94. spacer 1.12|961126|30|NZ_CP028229|CRT,PILER-CR,CRISPRCasFinder matches to NZ_CP045407 (Roseovarius sp. THAF9 plasmid pTHAF9_c, complete sequence) position: , mismatch: 8, identity: 0.733

agtcagaatggactggttattggcaacggg	CRISPR spacer
gccgagaatggtctggtgattggcaaccgc	Protospacer
. . ******* ***** ********* *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

492914 : 501538

Streptococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355240.1\|492914_493910_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|494048_494834_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|494837_495734_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|495832_496180_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|496204_497224_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|497240_497570_-	hypothetical protein	NA	NA	NA	NA
WP_011101140.1\|497566_498232_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|498629_498881_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|498895_499495_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|499510_499819_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|499840_501538_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_2

638305 : 698060

uncultured_Mediterranean_phage(20.0%)

tRNA,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060684287.1\|638305_639577_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.6e-96	43.9
WP_003642042.1\|640043_641657_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|641829_642438_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|642482_642923_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003643833.1\|643285_644218_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003643832.1\|644232_645585_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|645604_646414_+	sugar-phosphatase	NA	NA	NA	NA
WP_160231069.1\|646582_647569_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|647651_648674_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|648962_649943_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_085438943.1\|650308_651133_-	serine hydrolase	NA	NA	NA	NA
WP_003642031.1\|651368_652751_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|652819_653656_-	pur operon repressor	NA	NA	NA	NA
WP_063722866.1\|654148_654412_-	hypothetical protein	NA	NA	NA	NA
WP_063722867.1\|654426_654969_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003642024.1\|656149_656953_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|656939_657638_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|657905_658850_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|659159_660026_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|660158_660410_-	Veg protein	NA	NA	NA	NA
WP_011101015.1\|660514_661405_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|661401_661965_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|661951_662728_-	TatD family hydrolase	NA	NA	NA	NA
WP_160231070.1\|662850_664035_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|664266_666318_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_011101012.1\|666639_667029_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|667625_668468_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|668467_669172_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_160231071.1\|669193_670153_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_011101011.1\|670145_671420_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_011101010.1\|671465_672383_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003643820.1\|672552_673347_-	hypothetical protein	NA	NA	NA	NA
WP_011101008.1\|673351_674584_-	hypothetical protein	NA	NA	NA	NA
WP_011101007.1\|674939_675953_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|676065_676812_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011101006.1\|676961_677858_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|677978_679415_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003643816.1\|679432_680788_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|681010_681433_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|681422_681611_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|681617_682979_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_011101005.1\|683051_683762_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011101004.1\|684169_685186_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003643814.1\|685624_686401_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_011101002.1\|686659_688969_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646479.1\|689258_689552_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_063722041.1\|689563_689851_-	hypothetical protein	NA	NA	NA	NA
WP_057136860.1\|689966_690653_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160231073.1\|690746_691427_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_063721086.1\|691513_692182_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_062688861.1\|693026_694403_-	HlyD family secretion protein	NA	NA	NA	NA
WP_063721087.1\|694418_696569_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|696835_697006_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_021356667.1\|697030_697189_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_021356666.1\|697286_698060_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

701478 : 750602

Paramecium_bursaria_Chlorella_virus(50.0%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641979.1\|701478_701625_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641978.1\|701960_702149_-	hypothetical protein	NA	NA	NA	NA
WP_003641977.1\|702502_703249_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160231076.1\|703279_704479_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|704596_704764_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|704891_705092_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641973.1\|705953_706121_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|706151_706325_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641971.1\|706321_706990_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003643803.1\|707014_707167_+	hypothetical protein	NA	NA	NA	NA
WP_160231077.1\|707385_707601_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|707985_709170_-	cation:proton antiporter	NA	NA	NA	NA
WP_011100994.1\|709214_710591_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|711116_711932_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_160231078.1\|712091_712964_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011100993.1\|713034_713826_+	HAD family hydrolase	NA	NA	NA	NA
WP_003641963.1\|713829_714984_+	MFS transporter	NA	NA	NA	NA
WP_160231079.1\|714987_715605_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_011100991.1\|715931_716210_-	hypothetical protein	NA	NA	NA	NA
WP_011100990.1\|717480_717888_-	hypothetical protein	NA	NA	NA	NA
WP_160231080.1\|717964_718111_-	TNT domain-containing protein	NA	NA	NA	NA
WP_003641955.1\|718040_718241_-	hypothetical protein	NA	NA	NA	NA
WP_003646454.1\|718572_718728_-	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|718953_719340_-	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|719721_719925_-	hypothetical protein	NA	NA	NA	NA
WP_011100988.1\|720041_720305_-	hypothetical protein	NA	NA	NA	NA
WP_160231081.1\|720319_720862_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_016526893.1\|721406_721580_-	hypothetical protein	NA	NA	NA	NA
WP_011100986.1\|721586_722504_-	hypothetical protein	NA	NA	NA	NA
WP_074161480.1\|722627_722744_-	hypothetical protein	NA	NA	NA	NA
WP_015639936.1\|723124_723331_-	hypothetical protein	NA	NA	NA	NA
WP_044428967.1\|725250_728946_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_003641945.1\|729532_730255_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003643774.1\|730269_732099_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|732113_733631_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_003646444.1\|734096_735428_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|735505_736477_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003643770.1\|736477_738004_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_011100979.1\|738859_740740_-	hypothetical protein	NA	NA	NA	NA
WP_015379753.1\|741179_742079_-	oxidoreductase	NA	NA	NA	NA
WP_011100977.1\|742215_743136_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003641936.1\|743301_743874_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100976.1\|743977_744433_-	hypothetical protein	NA	NA	NA	NA
WP_003646440.1\|744451_744922_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100975.1\|745031_746228_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|746880_747249_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_013355172.1\|747513_749019_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_024002428.1\|749176_749845_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|750038_750602_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_4

1942103 : 1950617

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642585.1\|1942103_1942589_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_011101896.1\|1942572_1943703_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1943705_1944437_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1944438_1944693_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_011101895.1\|1944692_1945373_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_021356102.1\|1945365_1947585_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.5e-144	39.1
WP_003642591.1\|1947569_1949024_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642592.1\|1949020_1950046_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642593.1\|1950038_1950617_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0

DBSCAN-SWA_5

2137352 : 2179789

Lactobacillus_phage(68.75%)

portal,holin,integrase,terminase,tail,capsid

attL 2137113:2137133|attR 2180024:2180044

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2137113:2137133	attL	NA	NA	NA	NA
WP_160248339.1\|2137352_2138474_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	8.4e-46	32.1
WP_053566836.1\|2138695_2139709_-	acyltransferase	NA	NA	NA	NA
WP_160248341.1\|2140126_2140918_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_011101078.1\|2141404_2141581_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.2e-07	53.4
WP_160248343.1\|2141721_2142441_-	hypothetical protein	NA	NA	NA	NA
WP_160248345.1\|2142544_2143408_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_160248347.1\|2143461_2143893_-	ImmA/IrrE family metallo-endopeptidase	O03904	Lactobacillus_phage	2.3e-76	95.8
WP_076638543.1\|2143901_2144300_-	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	2.2e-41	62.9
WP_160248349.1\|2144464_2144725_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_160248351.1\|2144903_2145209_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_160248354.1\|2145275_2145788_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	8.0e-28	42.9
WP_046947675.1\|2145854_2146025_+	hypothetical protein	NA	NA	NA	NA
WP_046947676.1\|2146157_2146271_+	hypothetical protein	NA	NA	NA	NA
WP_160248356.1\|2146288_2146819_+	hypothetical protein	E9LUU0	Lactobacillus_phage	7.9e-55	59.2
WP_160248358.1\|2146830_2147805_+	hypothetical protein	A6M982	Geobacillus_virus	1.8e-57	49.6
WP_160248360.1\|2147884_2148793_+	DnaD domain protein	NA	NA	NA	NA
WP_003642800.1\|2148789_2149077_+	hypothetical protein	NA	NA	NA	NA
WP_160248362.1\|2149073_2149592_+	hypothetical protein	O03915	Lactobacillus_phage	5.4e-40	53.9
WP_013355743.1\|2149588_2149969_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_160248364.1\|2149961_2150129_+	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	4.4e-12	79.6
WP_160248366.1\|2150131_2150386_+	hypothetical protein	A0A2H4PBA1	Lactobacillus_phage	5.7e-35	81.9
WP_160248368.1\|2150388_2150496_+	hypothetical protein	NA	NA	NA	NA
WP_160248370.1\|2150507_2150891_+	hypothetical protein	NA	NA	NA	NA
WP_160248373.1\|2150868_2151276_+	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	6.5e-33	52.9
WP_160248485.1\|2151275_2151767_+	DUF1642 domain-containing protein	A0A2K9VC51	Lactobacillus_phage	1.0e-40	56.0
WP_160248375.1\|2151884_2152052_+	hypothetical protein	E9LUP4	Lactobacillus_phage	1.4e-13	85.1
WP_076633972.1\|2152179_2152641_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	3.1e-39	56.3
WP_015380624.1\|2153708_2153906_+	hypothetical protein	NA	NA	NA	NA
WP_160248377.1\|2153883_2154081_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.0e-07	58.0
WP_060417502.1\|2154247_2154913_+	hypothetical protein	A0A1S5SAA7	Streptococcus_phage	1.2e-44	53.3
WP_160248379.1\|2154893_2156219_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	2.9e-138	55.7
WP_160248381.1\|2156221_2157817_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	9.9e-85	37.5
WP_160248384.1\|2157809_2158895_+	hypothetical protein	A0A059T7W2	Listeria_phage	2.4e-37	30.2
WP_041153370.1\|2158958_2159561_+	hypothetical protein	NA	NA	NA	NA
WP_160248386.1\|2159574_2160522_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	1.6e-90	60.2
WP_065980404.1\|2160881_2161286_+	hypothetical protein	A5GYM1	Lactococcus_phage	3.4e-05	26.7
WP_065980405.1\|2161286_2161676_+	hypothetical protein	NA	NA	NA	NA
WP_160248388.1\|2161672_2162074_+	hypothetical protein	NA	NA	NA	NA
WP_015380612.1\|2162073_2162499_+	hypothetical protein	NA	NA	NA	NA
WP_160248390.1\|2162516_2163134_+	hypothetical protein	A0A2I7QIP9	Bacillus_phage	9.4e-07	33.3
WP_065980407.1\|2163252_2163771_+	hypothetical protein	NA	NA	NA	NA
WP_160248392.1\|2163767_2164409_+	hypothetical protein	U3PFU8	Lactobacillus_phage	1.7e-06	28.2
WP_160248394.1\|2164424_2170055_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	7.7e-23	25.1
WP_160248396.1\|2170055_2170874_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_160248398.1\|2170885_2172013_+	hypothetical protein	O03938	Lactobacillus_phage	4.0e-72	42.6
WP_160248400.1\|2172005_2172227_+	hypothetical protein	NA	NA	NA	NA
WP_160248402.1\|2172223_2172514_+	hypothetical protein	NA	NA	NA	NA
WP_160248404.1\|2172514_2174323_+	hypothetical protein	O03968	Lactobacillus_phage	1.7e-210	66.5
WP_160248406.1\|2174338_2175124_+	hypothetical protein	O03971	Lactobacillus_phage	2.2e-125	85.4
WP_160248408.1\|2175123_2175444_+	DUF2977 domain-containing protein	Q7M292	Lactobacillus_phage	9.1e-30	72.6
WP_160248436.1\|2175440_2175587_+	XkdX family protein	NA	NA	NA	NA
WP_160248486.1\|2175596_2176757_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	5.1e-38	37.2
WP_160248438.1\|2176757_2177054_+	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	4.9e-38	75.5
WP_063964066.1\|2177040_2177415_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	1.5e-20	71.8
WP_160248487.1\|2177558_2177891_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_063964065.1\|2177991_2178639_+	hypothetical protein	NA	NA	NA	NA
WP_063964064.1\|2178646_2179789_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	4.0e-35	32.2
2180024:2180044	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3012431 : 3025209

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356804.1\|3012431_3013376_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	6.7e-73	45.8
WP_013355473.1\|3013400_3014066_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_021356352.1\|3014775_3015468_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.3e-35	37.6
WP_021356351.1\|3015460_3016828_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.0e-25	31.4
WP_021356350.1\|3017218_3017659_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	4.4e-75	95.9
WP_021356349.1\|3017729_3018290_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.0e-100	99.5
WP_160231001.1\|3018377_3020816_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.4
WP_063723106.1\|3020818_3021433_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	2.4e-111	99.5
WP_003643099.1\|3021775_3022723_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_015825455.1\|3022908_3023880_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_065080349.1\|3023970_3025209_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	3.0e-214	96.4

DBSCAN-SWA_7

3044352 : 3113012

Lactobacillus_phage(84.09%)

portal,tRNA,head,holin,integrase,terminase,tail,protease,capsid

attL 3065942:3065958|attR 3107287:3107303

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248470.1\|3044352_3046041_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	5.2e-76	32.9
WP_160231007.1\|3046312_3046759_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643130.1\|3047147_3047393_-	hypothetical protein	NA	NA	NA	NA
WP_003643131.1\|3047519_3048911_-	MATE family efflux transporter	NA	NA	NA	NA
WP_003644260.1\|3049186_3050962_-	SLC13 family permease	NA	NA	NA	NA
WP_003645241.1\|3051471_3053211_-	aryl-sulfate sulfotransferase	NA	NA	NA	NA
WP_075060694.1\|3053432_3054410_-	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003643136.1\|3054378_3055002_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.3e-27	40.6
WP_044430280.1\|3055004_3056180_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	3.8e-49	31.7
WP_003643138.1\|3056157_3057795_-	sulfotransferase family protein	NA	NA	NA	NA
WP_160231008.1\|3058683_3060990_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_011101376.1\|3061003_3062860_+	bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase	NA	NA	NA	NA
WP_003645248.1\|3062932_3063292_+	YisL family protein	NA	NA	NA	NA
WP_011101375.1\|3063390_3063906_-	GtrA family protein	NA	NA	NA	NA
WP_003644258.1\|3063960_3065031_+	membrane protein	NA	NA	NA	NA
WP_003643144.1\|3065063_3065183_+	hypothetical protein	NA	NA	NA	NA
WP_011101374.1\|3065195_3065621_+	lipoprotein	NA	NA	NA	NA
3065942:3065958	attL	NA	NA	NA	NA
WP_016058344.1\|3066665_3067196_-	hypothetical protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
WP_003644510.1\|3067208_3067472_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_072534410.1\|3068502_3068715_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.6e-19	83.6
WP_072534409.1\|3068711_3069752_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	1.8e-58	96.1
WP_160231012.1\|3069900_3070149_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.6e-29	95.8
WP_160231013.1\|3070141_3072661_-\|tail	phage tail protein	A0A2K9VDD0	Lactobacillus_phage	8.6e-216	69.9
WP_160231014.1\|3072677_3075092_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	92.9
WP_122036799.1\|3075158_3076934_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	1.5e-299	89.3
WP_146708716.1\|3077005_3081940_-	tape measure protein	E9LUR1	Lactobacillus_phage	0.0e+00	83.0
WP_016058335.1\|3081952_3082144_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
WP_057137284.1\|3082140_3082524_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	1.5e-63	99.2
WP_021732001.1\|3082725_3083364_-\|tail	major tail protein	E9LUQ8	Lactobacillus_phage	3.7e-107	92.9
WP_022638398.1\|3083364_3083748_-	DUF806 family protein	E9LUQ7	Lactobacillus_phage	1.0e-64	96.9
WP_021732003.1\|3083744_3084185_-	hypothetical protein	E9LUQ6	Lactobacillus_phage	3.2e-78	97.9
WP_021732004.1\|3084174_3084537_-\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	1.5e-65	99.2
WP_016058329.1\|3084520_3084859_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	7.0e-57	100.0
WP_114619779.1\|3084931_3086164_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	1.9e-200	87.7
WP_033608392.1\|3086163_3086922_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-126	94.4
WP_160231015.1\|3086899_3088096_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.5e-205	89.7
WP_033608390.1\|3088098_3088293_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.0e-24	92.2
WP_122036924.1\|3088282_3090190_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	9.8e-180	49.7
WP_033608389.1\|3090176_3090638_-\|terminase	phage terminase small subunit P27 family	A0A286QRF4	Streptococcus_phage	6.5e-45	58.2
WP_122036801.1\|3090858_3091371_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	6.6e-83	93.6
WP_122036802.1\|3091339_3091519_-	hypothetical protein	E9LUP6	Lactobacillus_phage	8.6e-14	71.2
WP_160248472.1\|3091565_3091769_-	hypothetical protein	NA	NA	NA	NA
WP_122036804.1\|3091840_3092458_-	DUF4145 domain-containing protein	Q20DE2	Lactobacillus_phage	7.8e-54	49.0
WP_122036805.1\|3092880_3093306_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	7.7e-61	79.4
WP_152707026.1\|3093650_3093848_-	hypothetical protein	NA	NA	NA	NA
WP_160231017.1\|3093920_3094301_-	hypothetical protein	A0A2P0ZKS9	Lactobacillus_phage	8.8e-32	56.9
WP_076637232.1\|3094541_3095033_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	1.2e-84	89.9
WP_160231018.1\|3095117_3095426_-	hypothetical protein	E9LUN7	Lactobacillus_phage	6.0e-47	93.1
WP_122036806.1\|3095561_3096347_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	3.5e-131	90.8
WP_122036807.1\|3096346_3097144_-	replication protein	Q9AZA0	Lactobacillus_prophage	1.3e-53	68.9
WP_063487248.1\|3097193_3097886_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.5e-117	88.7
WP_063487249.1\|3097905_3098211_-	hypothetical protein	NA	NA	NA	NA
WP_072534386.1\|3098424_3098655_-	hypothetical protein	E9LUT8	Lactobacillus_phage	1.3e-22	78.1
WP_063487251.1\|3098657_3098912_-	hypothetical protein	NA	NA	NA	NA
WP_063487252.1\|3099001_3099331_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.4e-48	81.7
WP_072534385.1\|3099423_3100143_+	hypothetical protein	NA	NA	NA	NA
WP_080466786.1\|3100306_3101050_-	hypothetical protein	A0A1P8BM06	Lactococcus_phage	9.7e-51	44.9
WP_080382821.1\|3101523_3101751_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_003644552.1\|3101836_3102052_-	hypothetical protein	NA	NA	NA	NA
WP_003641361.1\|3102307_3102634_+	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003641360.1\|3102664_3103054_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_160231019.1\|3103118_3103319_+	hypothetical protein	E9LUS6	Lactobacillus_phage	3.2e-25	98.5
WP_128536997.1\|3103608_3103803_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.3e-11	60.3
WP_160248474.1\|3103946_3104444_+	hypothetical protein	NA	NA	NA	NA
WP_080488510.1\|3104650_3105055_-	hypothetical protein	NA	NA	NA	NA
WP_072534383.1\|3105044_3105503_-	SocA family protein	NA	NA	NA	NA
WP_072534382.1\|3105578_3105920_-	hypothetical protein	NA	NA	NA	NA
WP_064775478.1\|3106033_3107170_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	4.0e-213	99.2
WP_011101373.1\|3107814_3110085_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.7e-119	31.5
3107287:3107303	attR	NA	NA	NA	NA
WP_003643147.1\|3110146_3110434_-	hypothetical protein	NA	NA	NA	NA
WP_003643148.1\|3110548_3111061_+	hypothetical protein	NA	NA	NA	NA
WP_003644254.1\|3111174_3111654_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011101372.1\|3112346_3113012_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028234

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1589

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080280589.1\|796_931_-	hypothetical protein	NA	NA	NA	NA
WP_006844823.1\|930_1254_-	thioredoxin family protein	NA	NA	NA	NA
WP_015474701.1\|1274_1589_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.0e-13	41.0

DBSCAN-SWA_2

6935 : 10274

Bacillus_phage(66.67%)

transposase,integrase

attL 3078:3091|attR 10904:10917

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3078:3091	attL	NA	NA	NA	NA
WP_160248640.1\|6935_7523_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	3.7e-21	35.4
WP_160248642.1\|7610_7874_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001748110.1\|7867_8212_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_080241820.1\|8465_8747_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.6e-06	42.3
WP_160248645.1\|9104_10274_+	SH3 domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.5e-34	47.6
10904:10917	attR	NA	NA	NA	NA

DBSCAN-SWA_3

14780 : 17529

Bacillus_phage(50.0%)

integrase

attL 10381:10395|attR 15448:15462

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
10381:10395	attL	NA	NA	NA	NA
WP_160248649.1\|14780_15368_-\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.2e-20	34.8
WP_027822197.1\|15444_15723_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
15448:15462	attR	NA	NA	NA	NA
WP_027822196.1\|15722_16079_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_050340448.1\|16197_17529_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.2e-20	24.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP028230

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6085

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_050557824.1\|1180_1783_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.8e-50	53.9
WP_072535832.1\|2924_4697_-	adenine deaminase	NA	NA	NA	NA
WP_080488660.1\|4732_6085_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.3e-48	32.3

DBSCAN-SWA_2

25476 : 51783

Enterococcus_phage(45.45%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248500.1\|25476_28362_-	DEAD/DEAH box helicase	Q9T1H9	Lactobacillus_phage	3.9e-23	24.7
WP_072535843.1\|28348_28774_-	(deoxy)nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_011031953.1\|29059_29398_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_160248502.1\|29355_29736_+\|transposase	transposase	NA	NA	NA	NA
WP_057717082.1\|30559_31348_+	AAA family ATPase	F0PIG8	Enterococcus_phage	7.9e-35	36.9
WP_072535827.1\|31340_31574_+	hypothetical protein	NA	NA	NA	NA
WP_072535828.1\|31815_32058_+	hypothetical protein	NA	NA	NA	NA
WP_123808968.1\|32119_32476_-	hypothetical protein	NA	NA	NA	NA
WP_072535830.1\|33740_34616_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.4e-24	77.8
WP_020923829.1\|36477_37032_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
WP_072540920.1\|37173_37473_-	hypothetical protein	NA	NA	NA	NA
WP_160248504.1\|37619_38540_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.6e-50	37.9
WP_016378676.1\|39290_39395_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_160248506.1\|39627_40929_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	5.1e-79	40.0
WP_039107792.1\|40921_41242_+	hypothetical protein	NA	NA	NA	NA
WP_072540898.1\|41234_41621_+	hypothetical protein	NA	NA	NA	NA
WP_072540899.1\|41738_42476_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_072540900.1\|42821_43793_+	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.1e-13	28.6
WP_106904955.1\|43851_43995_-	hypothetical protein	NA	NA	NA	NA
WP_072540901.1\|44264_44561_-	hypothetical protein	NA	NA	NA	NA
WP_016527441.1\|45343_45961_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003646148.1\|46021_46972_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	5.0e-100	55.3
WP_024971945.1\|46986_47913_-	ribonucleoside-diphosphate reductase	A0A096XT60	Enterococcus_phage	1.3e-41	33.7
WP_033615749.1\|48018_50166_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.8e-253	60.1
WP_072535998.1\|50193_50646_-	ribonucleotide reductase assembly protein NrdI	NA	NA	NA	NA
WP_003646115.1\|51096_51783_-\|transposase	IS6 family transposase	A0A0N9RU54	Staphylococcus_phage	9.9e-58	49.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028229

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028234

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP028230

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection