CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP028249	Pediococcus acidilactici strain SRCM102732 chromosome, complete genome	3 crisprs	DinG,csa3,cas9,cas2,csn2,DEDDh,cas3	1	0	5	0
NZ_CP028250	Pediococcus acidilactici strain SRCM102732 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028249_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028249_1

836802-836951

Orphan

Consensus_repeat	Method
GAAAACACGTTTCAACTACCTAGCAACAGAACACAGAGGCATTAATCGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028249_1

>merge|NZ_CP028249|1|836802-836951|CRISPRCasFinder
GAAAACACGTTTCAACTACCTAGCAACAGAACACAGAGGCATTAATCGCGGGTTTAGCAATTGGTGCCTTAATTTGGTTAGCCGGAGGAAGTTGGGGCCGAAAACACGTTTCGACTACCTAGCAACAGAACACAGAGGCATTAATCGCGG

>NZ_CP028249|1|1|836802-836951|CRISPRCasFinder
GAAAACACGTTTCAACTACCTAGCAACAGAACACAGAGGCATTAATCGCGG	GTTTAGCAATTGGTGCCTTAATTTGGTTAGCCGGAGGAAGTTGGGGCC
GAAAACACGTTTCGACTACCTAGCAACAGAACACAGAGGCATTAATCGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028249.1\|WP_128211592.1\|835412_836396_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NZ_CP028249.1\|WP_128211589.1\|829727_830579_-\|SAM-dependent-methyltransferase	unknown	unknown	unknown
NZ_CP028249.1\|WP_128211594.1\|839886_840996_+\|YibE/F-family-protein	unknown	unknown	gnl\|CDD\|377940
NZ_CP028249.1\|WP_005919600.1\|834295_835252_-\|nucleoside-hydrolase	unknown	unknown	gnl\|CDD\|239116
NZ_CP028249.1\|WP_053905756.1\|840988_841753_+\|YibE/F-family-protein	unknown	unknown	gnl\|CDD\|377940
NZ_CP028249.1\|WP_002831068.1\|839455_839887_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP028249.1\|WP_004166721.1\|845989_846364_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319916
NZ_CP028249.1\|WP_128211591.1\|832227_834204_-\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP028249.1\|WP_160212197.1\|836480_836627_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|215145
NZ_CP028249.1\|WP_002830030.1\|841946_842885_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361
NZ_CP028249.1\|WP_002830027.1\|843769_844099_+\|thioredoxin	unknown	unknown	gnl\|CDD\|200072
NZ_CP028249.1\|WP_002830029.1\|842994_843729_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|274742
NZ_CP028249.1\|WP_002831060.1\|828482_828713_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028249.1\|WP_053905757.1\|837111_839268_-\|LTA-synthase-family-protein	unknown	unknown	gnl\|CDD\|224287
NZ_CP028249.1\|WP_002830039.1\|830582_831002_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP028249.1\|WP_005919616.1\|828747_829392_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
NZ_CP028249.1\|WP_002830025.1\|844986_845769_+\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP028249.1\|WP_063504684.1\|827821_828496_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
NZ_CP028249.1\|WP_053905758.1\|831176_832109_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223999
NZ_CP028249.1\|WP_036671522.1\|844085_844946_+\|DegV-family-protein	unknown	unknown	gnl\|CDD\|273257

Protein	Function_ID	Function_description	E-value
NZ_CP028249.1\|WP_128211592.1\|835412_836396_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	2.18898e-64
NZ_CP028249.1\|WP_005919600.1\|834295_835252_-\|nucleoside-hydrolase	gnl\|CDD\|239116	cd02650, nuc_hydro_CaPnhB, NH_hydro_CaPnhB: A subgroup of nucleoside hydrolases similar to Corynebacterium ammoniagenes Purine/pyrimidine nucleoside hydrolase (pnhB). Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. .	7.04994e-138
NZ_CP028249.1\|WP_002830025.1\|844986_845769_+\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	5.26257e-133
NZ_CP028249.1\|WP_002831068.1\|839455_839887_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.54434e-16
NZ_CP028249.1\|WP_128211591.1\|832227_834204_-\|sodium:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	3.39939e-72
NZ_CP028249.1\|WP_160212197.1\|836480_836627_+\|hypothetical-protein	gnl\|CDD\|215145	PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED.	0.00347717
NZ_CP028249.1\|WP_002830030.1\|841946_842885_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.26616e-81
NZ_CP028249.1\|WP_002830027.1\|843769_844099_+\|thioredoxin	gnl\|CDD\|200072	TIGR01068, Thioredoxin-like_protein_slr0233, thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin. [Energy metabolism, Electron transport].	9.9487e-40
NZ_CP028249.1\|WP_002830029.1\|842994_843729_+\|TerC-family-protein	gnl\|CDD\|274742	TIGR03716, R_switched_YkoY, integral membrane protein, YkoY family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains proteins YceF and YkoY from Bacillus subtilis. A transport function is proposed.	1.65532e-77
NZ_CP028249.1\|WP_053905756.1\|840988_841753_+\|YibE/F-family-protein	gnl\|CDD\|377940	pfam07907, YibE_F, YibE/F-like protein. The sequences featured in this family are similar to two proteins expressed by Lactococcus lactis, YibE and YibF. Most of the members of this family are annotated as being putative membrane proteins, and in fact the sequences contain a high proportion of hydrophobic residues.	1.62281e-55
NZ_CP028249.1\|WP_053905757.1\|837111_839268_-\|LTA-synthase-family-protein	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	8.68044e-171
NZ_CP028249.1\|WP_005919616.1\|828747_829392_-\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.14371e-34
NZ_CP028249.1\|WP_002830039.1\|830582_831002_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.83527e-10
NZ_CP028249.1\|WP_128211594.1\|839886_840996_+\|YibE/F-family-protein	gnl\|CDD\|377940	pfam07907, YibE_F, YibE/F-like protein. The sequences featured in this family are similar to two proteins expressed by Lactococcus lactis, YibE and YibF. Most of the members of this family are annotated as being putative membrane proteins, and in fact the sequences contain a high proportion of hydrophobic residues.	2.65815e-66
NZ_CP028249.1\|WP_004166721.1\|845989_846364_-\|glyoxalase	gnl\|CDD\|319916	cd07253, GLOD5, Human glyoxalase domain-containing protein 5 and similar proteins. Uncharacterized subfamily of VOC family contains human glyoxalase domain-containing protein 5 and similar proteins. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	8.61287e-24
NZ_CP028249.1\|WP_063504684.1\|827821_828496_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	1.83881e-28
NZ_CP028249.1\|WP_053905758.1\|831176_832109_+\|alpha/beta-hydrolase	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	5.80089e-27
NZ_CP028249.1\|WP_036671522.1\|844085_844946_+\|DegV-family-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	1.9064e-72

>NZ_CP028249.1|WP_160212197.1|836480_836627_+|hypothetical-protein
MVNRRELGISARFAYLSVARQALIAGLAIGALIWLTGGSWGQKHVSTT
>NZ_CP028249.1|WP_128211592.1|835412_836396_+|NAD(P)/FAD-dependent-oxidoreductase
MTEIYDITIVGGGPAGLFAGFYAGMRTAKTQIIESLAQVGGQAAALYPEKVIYDVGGYAGVKAADLAKSLEKQTRLVNVPIRLNETVVNITPNGELYDVETTKAKYQSRAILLATGNGAFNPRKLAVKGLEKLEGDKIFYHVPELAQFKDQDVLVAGGGDSAIDVALMLEKVAHQVSLVHRREQFRGLELSVQRLKESSVEILTPFLIHDVREEAAGVTVDLKEVGTEELTTRKYNQVVVNYGFTSSNKIIKQWDVELEQAHRMFAVDNLMKTNLPNVYAIGDGIEYQGKLRLIATAFGEGPIAVDQIMKKLYPGKRGPVHSTSMFK
>NZ_CP028249.1|WP_005919600.1|834295_835252_-|nucleoside-hydrolase
MASKKMILDLDTGIDDAMAIAYALAAPDVDLIGIISTYGNVLTPDAGINSLKILELLGHTDIPVFLGDEHSQTTDHFEVMPISAQIHGKNGIGEVDLPTPQRKLEEQSGIDFLIEAAHQYNSDLILVPTGPLTNLAAAIRKDPEITDLIGKVTLMGGALTVPGNVSPVAEANINQDPHAANEVFTRQKNLTMVGLDVTLRTLLTKKETQQWRDLGTNAGQKFADIVDYYIDVYKITSPHLGGCALHDPLAVGVALDPSLVQTLALNMFVDTTDAMWGRTIGDPARLTDPEPNVNVAINVDADRYLQRFMEYLTNLFSK
>NZ_CP028249.1|WP_128211591.1|832227_834204_-|sodium:proton-antiporter
MNVLFFILTLMLAVIVANILDSRIKFLPRAIVQILVGLLLSFVPNFNHFVLEPEIFMLAIIAPLMFHDGANTDINKLKLTLGNTFSLAVGLALTTILGVGYLSYLMLPHIPLALAFALAAIITPTDAVAVSSVTDNLEIPPDAMLNLKNESLFNDASGIVAFDLALTAFQTGHFSPLISIFDYLYVFLGGLIIGWIIGWAFLRLQFLLIESNIDDANIVVPINLIKPFAIYLAAELCGTSGILAAVAAGLVQSTQTPFLRLTSTKIQIVSKTTTENLNELLNGFVFILLGVSLPTVIYDIVNNSRQVASLTDLVLIGIVLYVTMIVIRYVWVSLRLASIRIRPQERFLNRFLIAINGIHGTITLAMAFSIPLVFKKAAFPFRNDLIFIAATVIVLSLCVPSIILPLVLPKKTVSYSADDISKYRQQMINYAIQQVKDANEDPIETQAAIATLQSQESMFQRPKRRTIFKLLQKCFSLEEQLLQEMVDQGEISSKLQTLYERMTFFQSYQLRQSLFYQILYRIKYSLIRLKHRLRHKAVHVNNQAIKRKIKIARDDIANVEAKIIPRILEELHNQITEENQAEVHWIESYYRERHRRLQNNKQANRIQDELFISAFQNEYNFIQNQLSKQNISRELANLLYEQVANDEWIYMQNDYIYA
>NZ_CP028249.1|WP_053905758.1|831176_832109_+|alpha/beta-hydrolase
MKKFWKWLLVVLAVLLVVDLGAGMYFFHVAEVRGTKSFIKNDGKITKNDPLRTQKLWYQRVKKEKWTMKSASGNLKLEAYYIPAAHPTNKTVILAHGFLQNKDGEGAPAAMFHDLGYNVLAPDDRAHGNSEGKLIGYGWLDRRDYIKWMNKLLREKGEHQKLVMYGVSMGGATTMMISGEPDVPHQVKAYIEDCGYTSVEDEITYQAKSMYHLPKWPLVPTVSLISKVRAGYSYGEASAMKQLAKNYQPMMFIHGGKDDFVPTKMIDQLYAATKGPKEKYVVKDAGHAKAMQTDYQQYRDRVKKFLEKNV
>NZ_CP028249.1|WP_002830039.1|830582_831002_-|helix-turn-helix-transcriptional-regulator
MFPERLRALRHGKHITLEVLAQELNELFPDENPNTANQIGNWERGIRTPSYLEVKKLAEYFDVSMDYLCGRSALNAYDLSKLFLSGRQLSFDHKTLSSDDRYEVFQLINGYFHGKKRRPINSSTEQEELDLNWQKRNDD
>NZ_CP028249.1|WP_128211589.1|829727_830579_-|SAM-dependent-methyltransferase
MNPKKLKKLRRQLKKAQTTQSSDRYLRQLTNYRNLFKDYGSIVFLINQVLESERLIRQNLLPQQLPLLELPDDVQEQIFNRLKERFPLGDPRGDRLWEKLTRELPKLDKLLRSYRDFLEERYGMWAYISAPLISDLTAYLAGRPTLEIMAGNGYISHGLRMKDQPVIATDSLAWQSENETGRHLVTEVEPLDALAAIEKYGPQVDYVIMAWAPDGLDIDVQVLKKLRSLPNQPLLICIGEQNGATNSNEFWQIAQLVEPQAAAKLNQHFQPFDLIHDQVYLIK
>NZ_CP028249.1|WP_005919616.1|828747_829392_-|hypothetical-protein
MLNLIWGFLVHPLSYLTPLTTQLNQWVYLILFIWIFLETAFIFFSFLPGQSVLFLTGTIASTAPAHLNIFLLLLTFIAAATTGAMVKYWYGVNLESKNKIAQKISDSPQLDQTQKLFDKNTKKSLVFSRFIPFVGLFVPIIAGTTQMDWRRFNKLNFAGVLLWVLTCCFAGYFFGRTAFVRQYFTLIFLMLIFVPFMIELIWRKIKGRVQTDAT
>NZ_CP028249.1|WP_002831060.1|828482_828713_+|hypothetical-protein
MKYIKMIQEWLHRPRHFIVEVGWGLGLLLGLLLVVKIIGRLVLHTTFIGFGTILGVMVLYLVIIFGLRALEIKLRK
>NZ_CP028249.1|WP_063504684.1|827821_828496_+|L,D-transpeptidase
MKRRFELIIGLAIVLFVGAVFTSARAYQKQVRHDAKVELQKSAKQKALPKSSAKDTGLAGDEAPTAETAKASTKTKMNPVNWKKSSQKNDYPDLDKHPQAYLKVSIAKQRVYVMDGKKVLYTMYASTGSKDSPTPTGTFHIQKERGDFFYNAASKEGAKYWVSFKDHGIYLFHTVPTDKNGKFIPKEAQQLGKEAQSHGCVRLSVPDAKWIYKNVPEGMKVEIH
>NZ_CP028249.1|WP_053905757.1|837111_839268_-|LTA-synthase-family-protein
MKSLKSRIDTRFGFFILISVLFWLKTLFAYFTDISLGVSGIFQWIILLINPIATTMLIFGLALYVRPKRAFYWTAMLLDLANTVLLYLNVIYFREFSDFMTVNTMLGYSKVNQGLSASSMSLTNFHDIFYWLDLLVIFLLLVLKKIKMDPHPLPKKFGFQITSVGILFFAFNLMLAEMDRPQLITRTFDRSYVVKYMGIDAFTAYDGVQLERNIKMRSEAKKSELTSIEKYVKQHYAKPSDVSFGKAKGKNVIIIHLESFQQFLIDDKVEGQTVTPFLNSIYHSKSTYSFSNFFHQVGQGKTSDAENMLETSTFGTPQGSLFAQLGSDQTFQAAPAILKQHGNYTSAVFHGNTASFWNRNNTYKNMGYENFFSASNFDVSGDKSTTYGLKDKLLFKDSVKYLQHLQQPFYAKYITVSNHIPYTLDAEDSDFKTPDTGDATVDGYFKTANYLDQSIEEFFNFLKKSGLYDNSMIVLYGDHYGISNSSNKALAKTFAQDPNHFKQFGDNPTENWNSWDNAQLQRVPLMIHIPGMKDGGIQNQYGGEIDVLPTLLHLLGISNKNYIQFGTDLLSKQHSQIVAFRNNDFVTPTYSSIGNTLYDQNGNEITDPSNAFLKKVKKDRKAAHKQLEMSDSLNEKNLLRFYKNPDFKKVNSADYNYSDGLDKAIKIEDKLKLKSTSMYSRNQDKSLEDLYKTDAPEVNHKSTSENRIKITNPDSNGS
>NZ_CP028249.1|WP_002831068.1|839455_839887_+|GNAT-family-N-acetyltransferase
MEAKMVKGATGPIYMDALALRRQVFVEEQGIDPALEFGADEDFYTYFVGYEDDTPVVTARTRRTEPNTWTVQRVATAKESRRHGLAQELFEYIETQGRQAGIEKIRLHAQATAEPFYFALNYERTGGPEMEAGLLHYWMEKKL
>NZ_CP028249.1|WP_128211594.1|839886_840996_+|YibE/F-family-protein
MRWKSQIGLILVVILTGLLVVGLVQHDDVIYRTPLGRIERVTNLKKVPQTDNFNNHDYRAKQRLQIKILNGKHRGQMVSVKNEYSGSQATDLKYRPGQTVLLHFNGTGQRVKGATILDLKRDVAITILVVIAVGLLILMRRTGIHAIVSVLLNMVLFFIAVEIDVQESGYAVLAIFSVVAVLFSAITLALVLGWNKKMMVSLLTTLAGTFSAMLIGGLVFSLTGNGGLHFETMEYVTQNPEPLFLAETVLGSLGAVMDESTDIIVSLAKLRKENPQISMKQLWISGRNIGKTIMGPLLNVLFMIFMADTFSMMVLYLRNGNSWQYAFEMNMQLGFVQSLISGIGIVLTVPIASWLTGVFFKNKGVPTNG
>NZ_CP028249.1|WP_053905756.1|840988_841753_+|YibE/F-family-protein
MVSATLILMIILAVLMVIVGGATGLRAFLSIILNFAVLFVNIALISWGFPALTVTIISSLVILAITIFMGSDDDQITQNAFYSSVLVLIVLIGLILIIHPHLMIQGFGNENNEDLEGMSLLIGIKFSDVITSTMIISSLGAIAEASIAVSTGIQELIETTPDLDLTKLFSHGYEIGKEIIGTALNTLFFGFFGSFLGLFIWYVKLNYRFSEFFNNKIFAAEFSMILIGFIGVISAVPLTAWVTQLRVRKNSGSL
>NZ_CP028249.1|WP_002830030.1|841946_842885_-|magnesium-transporter-CorA-family-protein
MLKVSKTVNDFSLIQVSNPSTLELQTLVKTYHATSETLSYAIDPNERARAEIDEENNSFLIIFHALSSLYNAGIQTEPAAFLFLPKALVIFTHDSTHYVNKIMDRNLKTLLRKTLNKPVQLNSSLMVNAVFNTIYELTMRFNDAVSRINYDRQAIQDKFKTRLNHSGIQSMLQLETSLIYLLTSLKSNTSLLNSMMRLPNLNLTKAQRNRLEEIIIESEQSQEMAQLSSDIIEQVSKSYSDILDNNLNNTMKFLTILSIVLAVPNIVFGFFGQNVKLPLADQGWSWLVTLEISSLLILIVYLIVNWSNFFKK
>NZ_CP028249.1|WP_002830029.1|842994_843729_+|TerC-family-protein
MNILTNLYGPFFDLNNWKTVLESSSDWLVILSLVMIECLLSVDNAVVLATQTQVLGDKVEREKSLFYGLWGAYLFRFLVIGIGTYLIHLWEIKIIGALYLAYLVFRYFDKRKRGRRTRKLVKPRGKISLFWRVVIQIEFMDIVFSIDSVLASLAISSNPVIVLLGGLIGILAMRGIAEVIMKLMHRIPELETMAYVLIGIIALKLFLSIPAIDIEINSGIFAGIVVLAFLITIAIHYLRKSVRK
>NZ_CP028249.1|WP_002830027.1|843769_844099_+|thioredoxin
MAATVTSENLAEVTKDGLTIVDFWAPWCGPCKMMEPILENLEQSYGDQVHFGKLNVDHNQELAQSFKVMSIPSLVLFKDGKAIEKVTGVYPEAKLAKYIEKKINENESK
>NZ_CP028249.1|WP_036671522.1|844085_844946_+|DegV-family-protein
MNQSKTAIVIDSSANLDPAIARKYNITVVNQPIMFGKHVYHENVDIDADEFYRMLKLEKYHPTTSQIPIKEMQRVFAELAAKGYKAALCIGLSGGLSGFINSLSASVPVIKELQVYPYDSGSILAGQSNAAILAANLLDSGVDIHEVLRQLRKYRSQTEVYLAVNNVKELQISGNIASRTSLVSSFFGMRPILTINRQGRLEMVGKERKIKNAMEAISEIFAQQVVDYRHLTVTVVDADDVDRSMQWQSELKVQYPGLHVESCPIGPYVGTYTGSKAIGLIWSPKL
>NZ_CP028249.1|WP_002830025.1|844986_845769_+|type-I-methionyl-aminopeptidase
MITLKSEREIEGMRKAGAVLAGMHIGLRDVIKPGISSWDIEKFALRYLDEHGAVPEEKGFEGYEYATCVSVNNEVCHGFPRKDLILKEGDLVKVDTVVSVDGYMADSCWAFAVGEVSDEVKKLMEVTKKALYLGIDQAVEGNRIGDIGHAIQTYVEDEMGYGDVREFVGHGIQPTMHEDPMVPGYGEAGHGPRLRNGMTITIEPMVNTGSWQCDTSAPDGWTVTTMDGSLSCQYEHTLVVTPDGPKILTSQDPVGDAKYL
>NZ_CP028249.1|WP_004166721.1|845989_846364_-|glyoxalase
MNIREIDHITLTVADVARSERFYHEVFDMPILTDAPYPGVRAGKQRIYFTTKETQPAIAPAQPTSGSIALSLVAKNPMNEIVNHLKSYFVEIVDEPKQRQGTHGKVQSLLIKDPDGNVVEVANY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028249_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028249_2

897586-897687

TypeII

Consensus_repeat	Method
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	CRISPRCasFinder

1 spacers

csn2,cas2,cas9

The CRISPR arrays of NZ_CP028249_2

>merge|NZ_CP028249|2|897586-897687|CRISPRCasFinder
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATCGGATGTAATCACGCTTTTCACCGAATTAGTGTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC

>NZ_CP028249|2|2|897586-897687|CRISPRCasFinder
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC	GGATGTAATCACGCTTTTCACCGAATTAGT
GTTTCAGAAGGATGTTAAATCAATAAGGTTAAGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028249.1\|WP_128211536.1\|880485_882408_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NZ_CP028249.1\|WP_053905932.1\|899631_900279_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP028249.1\|WP_002831107.1\|896583_896889_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP028249.1\|WP_053905934.1\|896885_897557_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP028249.1\|WP_128688327.1\|898329_898467_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222853
NZ_CP028249.1\|WP_005916102.1\|885163_886573_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP028249.1\|WP_053906418.1\|884326_884971_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187554
NZ_CP028249.1\|WP_053906422.1\|890118_894219_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP028249.1\|WP_053905927.1\|906664_907984_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|226583
NZ_CP028249.1\|WP_053905931.1\|900775_902398_+\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NZ_CP028249.1\|WP_160212200.1\|894854_895928_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP028249.1\|WP_053906417.1\|882480_884034_+\|glutamine-hydrolyzing-GMP-synthase	unknown	unknown	gnl\|CDD\|234614
NZ_CP028249.1\|WP_002829957.1\|902697_904530_+\|APC-family-permease	unknown	unknown	gnl\|CDD\|372624
NZ_CP028249.1\|WP_053905933.1\|897993_898236_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379188
NZ_CP028249.1\|WP_053906420.1\|886599_889134_+\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341064
NZ_CP028249.1\|WP_159210312.1\|898524_898665_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028249.1\|WP_002829956.1\|904751_905927_+\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP028249.1\|WP_053906421.1\|889359_889935_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236304
NZ_CP028249.1\|WP_053905928.1\|905994_906633_-\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|224653
NZ_CP028249.1\|WP_002829962.1\|900468_900753_+\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988

Protein	Function_ID	Function_description	E-value
NZ_CP028249.1\|WP_128211536.1\|880485_882408_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP028249.1\|WP_053905932.1\|899631_900279_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.38765e-10
NZ_CP028249.1\|WP_002831107.1\|896583_896889_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	3.63081e-29
NZ_CP028249.1\|WP_053905934.1\|896885_897557_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	9.82259e-102
NZ_CP028249.1\|WP_128688327.1\|898329_898467_-\|hypothetical-protein	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.45117e-06
NZ_CP028249.1\|WP_005916102.1\|885163_886573_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.10183e-48
NZ_CP028249.1\|WP_053906418.1\|884326_884971_+\|SDR-family-oxidoreductase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.8558e-42
NZ_CP028249.1\|WP_053906422.1\|890118_894219_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.23328e-144
NZ_CP028249.1\|WP_053905927.1\|906664_907984_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|226583	COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair].	4.44435e-172
NZ_CP028249.1\|WP_053905931.1\|900775_902398_+\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NZ_CP028249.1\|WP_160212200.1\|894854_895928_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.09441e-68
NZ_CP028249.1\|WP_053906417.1\|882480_884034_+\|glutamine-hydrolyzing-GMP-synthase	gnl\|CDD\|234614	PRK00074, guaA, GMP synthase; Reviewed.	0
NZ_CP028249.1\|WP_002829957.1\|902697_904530_+\|APC-family-permease	gnl\|CDD\|372624	pfam13520, AA_permease_2, Amino acid permease.	4.05738e-28
NZ_CP028249.1\|WP_053905933.1\|897993_898236_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	0.00618685
NZ_CP028249.1\|WP_053906420.1\|886599_889134_+\|M1-family-metallopeptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
NZ_CP028249.1\|WP_002829956.1\|904751_905927_+\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	3.97227e-87
NZ_CP028249.1\|WP_053906421.1\|889359_889935_-\|hypothetical-protein	gnl\|CDD\|236304	PRK08581, PRK08581, amidase domain-containing protein.	0.00147765
NZ_CP028249.1\|WP_053905928.1\|905994_906633_-\|YigZ-family-protein	gnl\|CDD\|224653	COG1739, COG1739, Uncharacterized conserved protein [Function unknown].	1.88558e-58
NZ_CP028249.1\|WP_002829962.1\|900468_900753_+\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	1.42388e-45

>NZ_CP028249.1|WP_053905934.1|896885_897557_+|type-II-A-CRISPR-associated-protein-Csn2
MKLTYRTHEPVEIKPHAITVLGTNNSTVYTDLVNGMQERNELILAFDENYKELEISKVFDWIGDVGTQDLVIQKYLTKIERVFAEGLVDEQRNQIHDQVNQLFNTVAEQLFMLDLPISVNYDFDLKKLLKYCGVHFDPLSVGNPYGIIEAILKIHEECAINSCVVLTNVAHYLTATQIEELTQLVSQTNQALLLIEFTEIGNQEAYGNSEFYYIDNDFVDWHQ
>NZ_CP028249.1|WP_002831107.1|896583_896889_+|CRISPR-associated-endonuclease-Cas2
MRLMIMFDLPVETAVQRKQYRQFRKALINEGFLMIQYSVYVRVCVNKKSATFMENRIKTYLPENGTIQALTLTEKQYNDMHFLVGERVKDVRNTSDRTVIL
>NZ_CP028249.1|WP_160212200.1|894854_895928_-|IS30-family-transposase
MKEVFVLMQEQSITPRPKGHHLSEIERGQIAAWHIEGCSARQIAIRLGVCHQTVNNELKRGRVTQVKRVNNQKHYFEIYSPEAAQNRYEIKRQNCGRPLKFSQVTAFLAYFDDKFCHEGWSPDAAVGYARKHRLFKPAKMVCTKTLYNYIDAQLLEIRNLDLLEKTKRRTTQHHSHQHQRLLGRSIEERPKRVETRHEFGHFEIDTVIGKRAGSESVLLTFTERKTRYEIVRLIEGKDAESVAYAMQNITAEFGDVMRTVTADNGTEFTTLTAALEGVAETYYTHPYSSAERATNEVHNRILRRYFPKGQSLDLATPSLARQAESRLNHLPRRLLKFCTPAEVFRKELARARKGRAA
>NZ_CP028249.1|WP_053906422.1|890118_894219_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MGDRKYNLGLDIGTSSIGFAAVDENNQPIRVKGKTAIGVRLFEEGKTAADRRGFRTTRRRLSRRRWRINLLNEIFDAHLAEVDPTFLARLKESNRSNLDPKKSFQGSLLFPERKDYQFYEEYPTIYHLRKALMEKDRKFDIREIYLAVHHIIKYRGNFLNGTPMRSFKVENIELDTLFDQLNQLYAEIVPDNELAFDLAQVADVKDVLSSTTIYKMDKKKQLVKMMLLPASNKALQSENKKIVTQFVNAILNYKFKLDVLLQVETDADWSLKLNDEGADDKLEEFTGDLDENRLEIIDLLQRLHNWFSLNEITKDGNSLSAAMVEKYENHHHHLGLLKKVIENHPDAKKAKALKETYTAYVGKTDDKTQNQDDFYKAVEKNLDDSPEAKEIKRLIQLDQFMPKQRTGQNGAIPHQLHQQELDQIIEKQSKYYPFLAEPNPNVKRQKDAPYKLDELIAFKIPYYVGPLVTPEEQAQNGENVFAWMKRKAAGPITPWNFDEKVDRMESANRFIRRMTTKDTYLFGEDVLPAESMIYEKFVVLNELNNLKINGRHLSLKDKQDVYNDLFKQQKTVSIKALQNYYVTKKKAATAPTVGGLADPKKFLSSLSTYIDFKNMFGERVNDPQFQEDLEQIVEWSTIFEDRGIFKAKLQALGWLSEKQIQQLVAKRYKGWGRLSKKLLTGLKNAEGYSILDEMWRSTENFMQIQTRPEFAALIQQANEKQFEGNDPNNVWENIENILGDAYTSPQNKKAIRQVVKVVQDIEKAVGNPPEKIAIEFTREAAANPQRTQSRLRALEKLYESAEEVVDAGLTAELAEFKENKHVLSDKYYLYFTQLGRDVYTGDRIRLDQLNDYDVDHILPQSFIKDDSLDNRVLTIRAVNNGKSDNVPAKMFGKKMGSFWRYLLDNGMISKRKYNNLITDPDNISKYAQKGFINRQLVETSQVIKLTANILNGIYDKDTEIIEVPAKMNSQMRKMFDLVKVREVNDYHHAFDAYLTIFIGNYLYKCYPKLQPYFVYGKFKKFSDNEDIEVGDGRFNFLNRIERLKNVTDPETGEILWSNVAPNETIKQIKKVYNYKFMIVSREITTRRAELFNQTVYPKNYRGKLIPIKEDRPTDLYGGYSGNTDAYLAIVALEDKKKGKYFKVVGIPTRAAAKLEKLKQQDSQQYLQALHEVIAPQFTKSTKKGIKKTEFEIVLDKVHYRQLVQDGPVKMMLGSSTYKYNAKQLVLSEKALQVIADDRKFDETQKDSNLIAVYDEILSIVNQSFDLYDINGFRKKLNDNRNQFIDLPAETKYEGRKVVAHGKREMILEILKGLHANASFGNLKPIGFATPFGQMQSKNGIELSENAFLIHQSPSGLFEHKIKLSDL
>NZ_CP028249.1|WP_053906421.1|889359_889935_-|hypothetical-protein
MKKIASIAILAVLPLTLASCGNHSTSSSDTSSNSSKTEKVAKSSSKSSASKDAKSSSADKATNSSASANSSKDSTNSSSNSNSASSSTSSATDSSSSADNQMSRSDLTKAEKKNGNRPLADEKIQNEQAAVALLTEKYGNQNWKVAFSSIGKSSPIYFHITSPKHGSYYVYANGDVQSADGDLSNHQIVNK
>NZ_CP028249.1|WP_053906420.1|886599_889134_+|M1-family-metallopeptidase
MANIERFYTKFHPTSYQIKLAISRETKEIKGTTTITGEALSSQIDIHQKDLQIEELRVDGTAGDFTVDQAAEAIHVKLPHTGTVTLEIKYTTKLTDTMMGIYPSYYEVNGETKQLVGTQFETTFARQAFPCVDEPEAKAAFDLAIKFDEHPGEVVLSNMPETKVEDGYHYFERTVKMSTYLIAFAFGDLQSKQTKTKSGVQVGVFATKAHQPQELDFALDIAKRAIEFYEDFYQTPYPLPHSWQLALPDFSAGAMENWGLVTYREAYLLLDPKNTTLRTKQVVATVIAHELAHQWFGDLVTMQWWDDLWLNESFANMMEYVAVDALEPDWQIWELFQNSEAGAALQRDATDGVQSVHVQVNDPAEIDALFDGAIVYAKGARMLVMVRALIGDDALRQGLQKYFASHQYGNATGNDLWQALGEAANMPIGDIMHTWLDQPGYPVVTAQVENGDLVLEQQQFFIGEGQDQQRQWQIPLNGNYAEVPALLQTKTLNLGNYQDLRDRNQQPFRLNVGNSSHFIVRYDQRLLDDILADWEQLTAIDQLQLLQDLRLLAEGKQISYAEIVPLLPRFAKTDSALVTEMLYRVANDLKKFVAPQSSAEKQLKKFFGELSQAPAQRLGWQAAPGETNDDQLMRPMVLKAALYAENPAVTAQAHQLFEENEAQLPKLPAAIRSLVIRNEVEHFGSPELFARLLKEYQRTSDASYKSDLCQALTATPSLPLIQQLVQQFENAQVIKPQDLRAWFRGVLANPQGQGPAWNWIRDEWQWLEDTVGGDMEFATYITVIAGIFQTPTRLAEFKAFFEPKLATPGLTREITMDIKVIETRVALIETERDAVQAAVAQAIK
>NZ_CP028249.1|WP_005916102.1|885163_886573_+|MFS-transporter
MEAQNTRHTNPMIVVAVVALMSFMGILTETSMNVTFPALMKEFHVPLNTVQWVTAGYLLMAALVMLTSAYMKRRFTNRQLFTAAAILFSSGDLICGLATNFWVLLAGRLIQAGCVGLCTPLMVNIILDVVPQHKLGTYIGMANLIILIAPALGPTFGGAVVAFNSWRMIFWSTLPVALVLMLLGMKVIKQYAPTDQHYAFDWTRFLLLGMALVSLIVGLNALGEMQLGTFVGLLIVSIGLTILFVKRSHTATKALFSLQVFKQPAFLYSFLPYIMLQFANVGINFLLPNYVQDVFQATSLVGGLILLPGSLFNGFGQPLYGWLLDRFGGKVPLYTGDILFTLALVGLMCWGPQLGVVGITIAYLIFAIGRSMAFGNSVAYGLKHIDKEFQNDANALYNTGQQVTGAIGTTVLALLMGSVKRPGYTHAQNVSAGSQLAFILLVIFGCVIFVFFHHLVNLKNLPEDKGVDL
>NZ_CP028249.1|WP_053906418.1|884326_884971_+|SDR-family-oxidoreductase
MAKIFIAGGSGRVATALIKNLVADGNEVVAGARHPENVVEMDHVNAVKLDLHDGVDAIADLMKGSDAVYFTAGSRGADLLQTDAMGAVKTMQAAEKLGIKRYVMLSSLYTLESERKWHEGGLADLLDYTTAKFFADNYLVHDTDLDYTIVQPTSLTEEAGSGQIYIGKELPQKTNPIPDVARVLAEVLKQPNTVKKVFMMSSGSQAIDQALANV
>NZ_CP028249.1|WP_053906417.1|882480_884034_+|glutamine-hydrolyzing-GMP-synthase
MASTDLSNFDKIIVLDFGSQYNQLITRRIREFGVYSELLSHKITAEEIKQINPKGIIFSGGPNSVYDDDAFRVDPEIYQLGIPILGICYGMQLMAYNLGGRVESADNREYGHADINVTDDQAALFKGLPATQTVWMSHGDLVREVPAGFKTVATSANCPIASMADDDRKFYGVQFHAEVRNTQYGNDILRHFAFDVCQAQANWSMNDFIDMQVEKIREEVGDRKVLLGLSGGVDSSVVGVLLNKAIGDQLVCIFVDHGLLRKGEAKQVMDSLEGKFGLNIIKVDAQDRFLSKLAGVTDPEQKRKIIGNEFIEVFNDEAQKLKGIDFLAQGTLYTDVIESGTDTAQTIKSHHNVGGLPEDMHFELIEPLRTLFKDEARDLGEKLGMPEDLVWRQPFPGPGLGIRVLGEITEDKLQIVRDSDLILREEIKNAGLDRDIWQYFTVLPGIRSVGVMGDGRTYDYTVGIRAVNSIDGMTADFARIPWDVLQKISVRIVNEVDHVNRVVYDITSKPPATVEWE
>NZ_CP028249.1|WP_128211536.1|880485_882408_+|heavy-metal-translocating-P-type-ATPase
MKMIKMQRWFTRFANPLLGVAALLTAVGWLLQHSGEFPEAAGMAYGIATLVAGMPILLKAIAALRARLASIELLVSIAVLGALIIGELEEAAMVTFLFGLGNYLERRTLKQTHRALANLTEMQPTQALLVSEGQTRTVAIDDVEVGDQLLVRIGDQVPVDGRVVTGTAAVNEAAITGEARVVNKTPTDQVYTGTIVENGQMVVEAQKVGEETTFGKIIELVEEAQDNQAPVSRFIDQFARYYTPLVLVLALLTQLVTQDFRLAITILVLACPGALVIGTPVSNVAGIGRGAQSGILIKGGQVIDQLAKVRTILMDKTGTITTGKPTVQNFYQYSQQDWLAVAAQLEKQTNHPLAAAVVEFYEQRTGQPVQNHDIAITTIKGIGVTATWHGHQVKLGSPRILEPSAQKLSNKQTADLQKLRENGQSVILMTVDGALVLAMGLSDQVRPGVASALKQLRQTGVTNQWMVTGDQLKVAQSVAHAVGITQVKAGQLPNEKAQFLKEFQASGQPVLFVGDGINDSPAIAQAAVGIAMGSGTDVAIETSDVVLINPDFKNVVFARQIAQATLRNMMENVGIAVGTVALLMLGVSLGWVNMASGMFFHEVSILVVIFNAMRLLKLKRPAWENFSTKTGGESPSSKTI
>NZ_CP028249.1|WP_053905933.1|897993_898236_+|helix-turn-helix-domain-containing-protein
MSLLKEYLDSNNITGYRIAKDNNITQSTMTRVINRDLDNLSFKYLKAIAISLEKDIGTVAKELNSLQNKTVRNYEVQQKS
>NZ_CP028249.1|WP_128688327.1|898329_898467_-|hypothetical-protein
MSHKGNCHDNAPIKSFLNLMQKECLYRTTIDNLDDSKRIVTEYNT
>NZ_CP028249.1|WP_159210312.1|898524_898665_-|hypothetical-protein
MDETSHLLITTVISEHARLNQLAFTTDDLAVKLPINSKPISHPDQG
>NZ_CP028249.1|WP_053905932.1|899631_900279_-|CPBP-family-intramembrane-metalloprotease
MKISKSSLLTLITYLAIFLLPSVINLFVRLGASFIWVETIDYLVGAALLVVINLKNNEINQIETRRIPFFRAIAWGIIGTALVIVLQFVVSYVAFILGQNPASANTATLVTLAKINPFFVLAITVGAPIMEELVFRKVLFGNLSTLFGMRSNLGLTIMAIISSLAFAFMHNDSHIFLYAAIGLLFCWLYHKTGRIQTSMIAHILMNGLVVLPLVM
>NZ_CP028249.1|WP_002829962.1|900468_900753_+|co-chaperone-GroES
MLKPLGDRVILEAKDEEEQTVGGIVLASNAKEKSQTGKVVAVGNGRVLDDGKTLPMNVKVGDTVVYDKYAGTEVTYEDQKYLVVHEKDLVAVVE
>NZ_CP028249.1|WP_053905931.1|900775_902398_+|chaperonin-GroEL
MAKEIKFSEDARTKMLKGVDKLADTVKSTIGPKGRNVVLEQSYGSPTITNDGVTIAKSIELEDHFENMGAKLVSEVASKTNDIAGDGTTTATVLTQAIVNEGMKNVTAGANPVGIRRGIEKATEKAVAALHNMSHEVKTKDDIAQIASISSANPEVGKLIADAMEKVGNDGVITIEESRGVDTTLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITDKKIANIQDILPLLQSVVEQSRSLLIIADDITGEALPTLVLNKMRGTFNVVAVKAPGFGDRRKEQLEDIAILTGGTVITDDLGLNLKDVTIEQLGQANKVTVTKDDTTIVEGSGSQEQIAERVTMIKQQISETTSDFDKEKLQERLAKLAGGVAVIRVGAATETELKEKKYRIEDALNATRAAVEEGFVPGGGTALVNVIASLEDLDAEGDELTGINIVRRALEEPVRQIAENAGEEGSVIVTKLKTQKDGVGYNAATDEWVDMIEAGIVDPTKVTRSALQNAASVSALLLTTEAVVADLPEEKPAAPAAPNPGMGGMM
>NZ_CP028249.1|WP_002829957.1|902697_904530_+|APC-family-permease
MFSYLKRILIGKPLKTLDESGQALTKFKALALLSSDALSSIAYGTEEILSVLIVLSAAATWYSIPIAAIVLVLLFAITVSYRQIIKAYPSGGGAYVVASKNWGTSAGLVAGGSLLVDYMLTVAVSVTSGTEAITSAIPALQKYHVAIAVLIVLGIMALNLRGLRESASFLTIPVYLFVVVISIMIIVGLYNIVTGQVTYHAAAAIGSTVPGMTFVLFMRALSSGSSSLTGVEAISNAVPNFKKPRRKNAAATLAIMSLILASFFAGITFLAYYSGITPMSSQTVLSQIGVTVFGHGIFYYILQLSTALILAVAANTGFSAFPMLAYNLAKDKFMPHAYMDRGDRLGYSNGIISLAAGAIVLILIFGGQTGLLIPLYAIGVFVPFTLSQSGMIVHWKREGGAHWWINASANLLGALLSAVLVVCLLFLHFSNVWPYFVVMPLLLRMFYKIRKHYDEVADQLRVVEKGKVNLHDYDGSTVIVLVSNVTQVTSGAINYARSIGDYVIAMHVSFDANPEKEHKTAMEFKAEYPDVRFIDIHSSYRSITNPTLRFCDVIAKRAAERNYTTTVLVPQFVPRKPWQNILHNQTGLRLRAALNSRENIIVSTYNYHLK
>NZ_CP028249.1|WP_002829956.1|904751_905927_+|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MRFEIVVSLFATMIISAILTPFVRRIAFKIGAVDKPNARRVNKVPMPTMGGLAIFLAFNFSLFFLLRNQIPNPQFYGIFFGECIIMLTGIIDDIFELKPSQKMIGILLAALAVYWFAEVQMTTLTLPFIGIVHLGWLSLPITLLWIAAITNAINLLDGLDGLATGVTIIALFTTGFTGLFFLPSTNIYIVIMIFTLVAAEVGFLPYNFFPARIYLGDTGALFIGFMIAVFSLSGLKNATFISVLIPVMILGVPLTDTIYAILRRLLNKQSIAHADKRHLHHRLMQMGLTHRQTVLVIYGISMIFSFIALLYPLSTLWGSVLLTIGILVGIELFVEAIGLVGENRTPMLSWIKRLVRTTTSKTASNEFKEEDTLKDRVRSRSERHQQKKHHD
>NZ_CP028249.1|WP_053905928.1|905994_906633_-|YigZ-family-protein
MKLILSVKEPVTTEQDIKKSRFISRIIPVQTEEEAQTKLQDIREIEVKATHNCFAYVLGDHQDIQRASDDGEPSGTAGAPILEVLKRENLTNVLVVVTRYFGGIKLGAGGLIRAYGSSTSLAVQSATLMESVDQKLLAITIDYQNNDQLTYYLEQHQITQVNHEYTTQVITTVAVDQDQVADLKAELTGLFSGNVSFKDGGQQRVQVPYQPQ
>NZ_CP028249.1|WP_053905927.1|906664_907984_+|DEAD/DEAH-box-helicase
MEAKIKEKYYGRLVPVNQAEATDSTVNYFPAVIVKKRRIQCQRCGATTKLKEGSLPNQQYYCRHCINLGRMSTLVKLGNLPEPNHFPVGRSYLKWQGQLTPDQQRCANEIISSIKQQTDRLLWAVTGAGKTEMLFPGINFALKKALRVAIASPRIDVVLELHPRIQAAFPEIAIALLHGRTSTPYTYTQLVLCTTHQLLRFYHAFDVLIIDEVDSFPFAMNPALHYAAHQARKECGTTIYLTATPDGQLLKESRAHRLPTSYLTRRFHGYPLPEIKVVSGCNWQKLIHRQRLPERLRQFLMAQVKAQRQFLVFVPRIDQLSSVLQAIQKQFPELGLATVYAEDPERIEKVSAMREGQLTGLITTTILERGVTFPGIDVAVLGADDEIFSMAALVQIAGRVGRSPKRPTGTVLFIGQMLTRRIKRAQRQIKFMNQQAFKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP028249_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028249_3

1109613-1109716

Orphan

Consensus_repeat	Method
TTAGCTCAGTTGGGAGAGCATCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028249_3

>merge|NZ_CP028249|3|1109613-1109716|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTGCCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCTCCATTATCTTGAGCCGTTAGCTCAGTTGGTAGAGCATCTG

>NZ_CP028249|3|3|1109613-1109716|CRISPRCasFinder
TTAGCTCAGTTGGGAGAGCATCTG	CCTTACAAGCAGGAGGTCACAGGTTCGAGCCCTGTATCCTCCATTATCTTGAGCCG
TTAGCTCAGTTGGTAGAGCATCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028249.1\|WP_005919135.1\|1121415_1122135_+\|16S-rRNA-pseudouridine(516)-synthase	unknown	unknown	gnl\|CDD\|211327
NZ_CP028249.1\|WP_128211579.1\|1117048_1119466_+\|leucine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234743
NZ_CP028249.1\|WP_128211738.1\|1095075_1097283_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
NZ_CP028249.1\|WP_005917413.1\|1093768_1094746_+\|GMP-reductase	unknown	unknown	gnl\|CDD\|235479
NZ_CP028249.1\|WP_128211577.1\|1122240_1123071_-\|NAD(P)H-hydrate-dehydratase	unknown	unknown	gnl\|CDD\|238576
NZ_CP028249.1\|WP_008842201.1\|1098095_1099820_+\|phosphoenolpyruvate--protein-phosphotransferase	unknown	unknown	gnl\|CDD\|224006
NZ_CP028249.1\|WP_128211583.1\|1113902_1115372_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_CP028249.1\|WP_036667749.1\|1103031_1104036_+\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP028249.1\|WP_128211581.1\|1116007_1116643_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP028249.1\|WP_070366758.1\|1099892_1100666_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP028249.1\|WP_128211585.1\|1111633_1112365_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028249.1\|WP_005919128.1\|1123196_1123658_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP028249.1\|WP_128211740.1\|1101969_1102986_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP028249.1\|WP_008842208.1\|1115451_1116015_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377744
NZ_CP028249.1\|WP_008842200.1\|1097498_1097687_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028249.1\|WP_002829785.1\|1092896_1093151_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028249.1\|WP_002830674.1\|1119722_1121405_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP028249.1\|WP_002829774.1\|1100751_1101939_+\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340844
NZ_CP028249.1\|WP_002829779.1\|1097829_1098096_+\|phosphocarrier-protein-HPr	unknown	unknown	gnl\|CDD\|237503
NZ_CP028249.1\|WP_002830669.1\|1112536_1113727_+\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374

Protein	Function_ID	Function_description	E-value
NZ_CP028249.1\|WP_005919135.1\|1121415_1122135_+\|16S-rRNA-pseudouridine(516)-synthase	gnl\|CDD\|211327	cd02553, PseudoU_synth_RsuA, Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. E.coli RsuA makes psi516 in 16S RNA. Psi at this position is not generally conserved in other organisms.	1.20075e-86
NZ_CP028249.1\|WP_128211579.1\|1117048_1119466_+\|leucine--tRNA-ligase	gnl\|CDD\|234743	PRK00390, leuS, leucyl-tRNA synthetase; Validated.	0
NZ_CP028249.1\|WP_008842208.1\|1115451_1116015_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|377744	pfam06962, rRNA_methylase, Putative rRNA methylase. This family contains a number of putative rRNA methylases. Note that many family members are hypothetical proteins.	1.83868e-70
NZ_CP028249.1\|WP_005917413.1\|1093768_1094746_+\|GMP-reductase	gnl\|CDD\|235479	PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional.	0
NZ_CP028249.1\|WP_128211577.1\|1122240_1123071_-\|NAD(P)H-hydrate-dehydratase	gnl\|CDD\|238576	cd01171, YXKO-related, B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily.	2.3491e-74
NZ_CP028249.1\|WP_008842201.1\|1098095_1099820_+\|phosphoenolpyruvate--protein-phosphotransferase	gnl\|CDD\|224006	COG1080, PtsA, Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism].	0
NZ_CP028249.1\|WP_128211583.1\|1113902_1115372_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.68329e-65
NZ_CP028249.1\|WP_036667749.1\|1103031_1104036_+\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	1.83962e-32
NZ_CP028249.1\|WP_128211581.1\|1116007_1116643_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	2.59284e-49
NZ_CP028249.1\|WP_070366758.1\|1099892_1100666_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.22543e-30
NZ_CP028249.1\|WP_005919128.1\|1123196_1123658_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.49532e-25
NZ_CP028249.1\|WP_128211738.1\|1095075_1097283_-\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP028249.1\|WP_128211740.1\|1101969_1102986_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	7.77323e-35
NZ_CP028249.1\|WP_002830674.1\|1119722_1121405_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.8869e-140
NZ_CP028249.1\|WP_002829774.1\|1100751_1101939_+\|glycosyltransferase-family-4-protein	gnl\|CDD\|340844	cd03817, GT4_UGDG-like, UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.	8.27925e-139
NZ_CP028249.1\|WP_002829779.1\|1097829_1098096_+\|phosphocarrier-protein-HPr	gnl\|CDD\|237503	PRK13780, PRK13780, phosphocarrier protein HPr; Provisional.	7.13708e-55
NZ_CP028249.1\|WP_002830669.1\|1112536_1113727_+\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0

>NZ_CP028249.1|WP_036667749.1|1103031_1104036_+|flippase-like-domain-containing-protein
MILAGLVIFGYSLRGVNLHQVSHDILNLNVGWLLVALLCIILYLGFEAVATKVLVESNGDRLSWKDAIRIPLIEQLFNGLTPFSSGGQPAQLVALMQSGIEGGRASSVLLMKFVVFQSMVVLNFIFSLLIGFQYLEDKIKFLSWFVLFGFLIHLAVIIGLLMIMYWHNFTKKMFDLIFIPIKRFTKPERYLRWKTSIDAKVDTFYLESVRMKSQWRLLAKVALLTFLQLLFYYLIPYFILLALGKTHVHLIMVTCLHVLIFMVISLFPIPGGAGGAEYGFSVIFAQFVGNSSKLVLAMIIWRLLTYYFGMFAGMFATVIKPNRINRIAPKKTSE
>NZ_CP028249.1|WP_128211740.1|1101969_1102986_+|glycosyltransferase-family-4-protein
MPIKVNMFSSASKVKGQGVGSAYEELIRLLKTHFPKEIDLSINRYTQADISHYHTIDPQFFASTFTKKRGVKVGYVHFLPETIEGSLKIPQPFRWLFYKYIIAFYKRMDQIVVVNPTFIDQLVKYGIKREIITYIPNFVRKDEFYQYDAEQRRQVRERLGVQNRFTILGIGQVQERKGVKDFIKLAQQHPEMYFIWAGGFSFGRLTDGYADLKKVVDNPPANLKFTGIVDRNKLVEYYNAADLFLLPSYNELFPMSVLEAFSCGTPVMLRDLALYHSIIKGYYIAADNYAEMDQKLSALVKNPAQLRDYQQRADQASAEYSEDHLAEIWLKYYSSLLK
>NZ_CP028249.1|WP_002829774.1|1100751_1101939_+|glycosyltransferase-family-4-protein
MNIGLFTDTYFPQVSGVATSIKTLRDQLEKQGHQVYIFTTTDPKVDTNVYERNVFRFTSIPFVSFTDRRIAISGFIRATQIAKELNLDIVHTQTEFSLGWMGKFVAKALKIPVIHTYHTMYEDYLHYVANGKLLKPYHVKQMTRAFCYHIDGIVAPSERVQRTIQRYGIQVPTRIIPTGVNLEQYQKDSNPQQCREALGYDAKTPVLLSLSRLAYEKNIQEVIDCFPAILKEVPDAQLLIVGDGPARTSLENQVHDLGLEKHVKFTGEINNDQVYRYYQAADLFVSASDSESQGLTYIEAMASHLKVVAKSGPYTDELLDDPSLGKVFDTEAQLVQAIKRYIEHPDEFNDPRPREKKLYEISADYFGKRIVDYYNSAISAHADLEHGSKKESELE
>NZ_CP028249.1|WP_070366758.1|1099892_1100666_+|alpha/beta-hydrolase
MEFILKTGETIYYEDQGEGIPILFLTGFGGNTEIWSGQVNFFLQHGYRVIRLDYLNHGRSDRVDYDLKIGDLADEVLQLVDALEIKEPIGIGNSMGAAVLWNILSIRSWDFVSKAIFVDQSPRMMNDDQWHYGFKNLSEANFEQLMSEPILRPAYRRIEGYVYKNSKAIDSKYPFSQPKNRSLVKGHARKDWRPVLRAATKPVLFILGEKSPFFNPQMGDALKQLNSRIQVEVMPNVGHIPMAEEPAQFNQLVLRFL
>NZ_CP028249.1|WP_008842201.1|1098095_1099820_+|phosphoenolpyruvate--protein-phosphotransferase
MTGTLKGIAASDGIAIAKAYLMVDPDLSFEKKTITDVDAEINRLHDALEQSKKELTLIKAKAAENLGAEEAEVFEAHLTILSDPELIGNIEDKIKNDTINAEEATKEVTDNFIAMFEAMTDNAYMQERAADIRDVTKRLMSHLLGVELPNPALIDSEVIIVAHDLTPSDTAQLDRRYVKGFITDIGGRTSHSAIMSRTLEIPAVVGSEKATTSVKQGDMMIVDGLTGDALINPSDDEIKEYEQKSADFKAQKAEWEKLKNERTVSKDGVHFDLAANVGTPDDLQGVLDNGGEAVGLFRSEFLYMNASELPSEDQQFEAYKKVVEGMNGKQVVVRTMDIGGDKDLPYLPLPEEMNPFLGYRAIRISLDRTDLFRTQLRALLRASAYGKLAIMFPMIATVAEFKKARAIYDDERQKMIDAGTKVGEIQVGMMMEIPAAAMIADKLAKYVDFFSIGTNDLIQYSFAADRGNEKVSYLYQPYNPSLLRLIKQTIDASHAEGKWTGMCGEMAGDQIAVPILMGLGLDEFSMSATSILKTRSLMKKLSTDDMKKLAEKAITEAETNEDVIKLVEETVNNK
>NZ_CP028249.1|WP_002829779.1|1097829_1098096_+|phosphocarrier-protein-HPr
MEKRDFHVIAETGIHARPATLLVQAASKFNSDIQLTYKDKSVNLKSIMGVMSLGVGQGADVTISADGDDEADAIAALEDTMKKEGLSE
>NZ_CP028249.1|WP_008842200.1|1097498_1097687_+|hypothetical-protein
MRDYLKLLNDLKDGVLDELTITAEEFQDFQPVFMDFPERKQLIGEAQRGGTITYRYENNKKQ
>NZ_CP028249.1|WP_128211738.1|1095075_1097283_-|ATP-dependent-Clp-protease-ATP-binding-subunit
MLCQNCHKNEATIHLYTNVNGRRTEVNLCQNCYQLLKNQQLNNNNGNGGARMAQDPFGFGNLDDIFRAMQGGNVSRPEDMYGQQVPPTQAGRGGGNNPNGGNGSSLLGQYGLNLTDLAKQGKIDPVIGRDKEIERVIEILNRRTKNNPVLIGEAGVGKTAVVEGLAQRIVEGSVPQKLLNKQIIRLDVVSLVQGTGIRGQFEQRMQELMKEVQNNPDLIVFIDEIHEIVGAGNAEGGMDAGNVLKPALARGDFQLVGATTLKEFRDIEKDAALARRLQPVQVDEPSEEEAIKILKGIQKKYEDYHHVHYTDDAIVAAVKLSKRYIQDRYLPDKAIDLLDEAGSKKNLTINVADPETIQKKIDEAEAEKKKALESEDYEKAAYYRDQVSKLEKNKDGATNKEDEPTITAEDMEKIIESKTDIPVGDLQKQEQEQLQNLASNLKAHVIGQDEAVDKISRAIRRNRIGLNGTGRPIGSFLFVGPTGVGKTELAKQLADQLFGSKDAMIRFDMSEYMEPHSISKLIGSPPGYVGYEEAGQLTEQIRRHPYSLILLDEVEKAHPDVMHMFLQILDDGRLTDSQGRTVSFKDTIIIMTSNAGSGDVEADVGFGAAMQGKTHSVLDKLGNYFKPEFLNRFDDIVEFHALTKDNLMQIVDLMIADVNKMLATQGLHVNVTKPVEERLVELGYDPKMGARPLRRVIQEQIEDRIADFYLDHPSEKQLIARIKDDKIEVAPDDKK
>NZ_CP028249.1|WP_005917413.1|1093768_1094746_+|GMP-reductase
MKVFDYEDIQLIPAKCVVRSRSECDPTVELGKHTFKLPVVPANMQTIINEEIAEKLAADGYFYIMHRFEPETRLAFVKKMKAKGLISSISVGVKDGEYDFIDELAAKNLVPDYITIDVAHGHAQTVIDMIHYIKEKLPESFVIAGNVGTPEGVRELESAGADATKIGIGPGKVCITKLKTGFGTGGWQLSALRWCAKVARKPLIADGGIRNHGDIAKSIRFGATMVMIGSLFAGHIESPGETKVEDGVTYKEYFGSASQYQKGEAKNVEGKKIWIHQRGHLADTLKAMREDLQSAISYAGGRDLESIRKVDYVIVKNSIFNGDIL
>NZ_CP028249.1|WP_002829785.1|1092896_1093151_+|hypothetical-protein
MSKNLKIDLNTDELIGSREASLMWGKQKDYVRTIYNKYPERFPTGTIRKFGKQLIVTREGMESVTGIKYEDLDKKNIEKAKLPR
>NZ_CP028249.1|WP_128211585.1|1111633_1112365_-|hypothetical-protein
MNKIKIPKINYHVDRKSYLPAILAVILTSTIWYFSGHFSSEPFKHNLTVQIIFFLASFMANFITFDQLTNKTNLRLIAPLAVIPVAFFIILLVSKERYVSLLGLLTLVPFVSVFLPFQGKNGVGLISFAFSISVLSPIAFFYIRNAFVSSMFLKTCLLLCLVFLMILFSVFVAHPEQFIYLEIGLLAVITIFGFVLFKQWSAVLYPMIGILGWYLPRVKLPRNFILLVLIILICVTFLFTAGH
>NZ_CP028249.1|WP_002830669.1|1112536_1113727_+|methionine-adenosyltransferase
MSERHLFTSESVSEGHPDKIADQISDAILDELLKNDPDARVACETTVTTGLVVVVGEISTTAYIDIQKVVRKTIKDIGYVGGEYGFDGENCAVIVAIDEQSPDIAQGVDDSLETREGHEDRLNRIGAGDQGLMFGYATDETKELMPLPIMLSHHLMQRIAKLRKEQVISYLRPDAKAEVTVEYDDNDQPVRVDTVVLSTQHDPDVTLEQIRKDVIEKVIKEVIPAELLDEKTNFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGAAHHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQIAYAIGVAEPVSVMVDTFGTGKVSEEALTKAVRQIFDLRPAGIIEMLDLKRPIYKQTAAYGHFGRTDVDLPWEKTDKVAELKAFFQK
>NZ_CP028249.1|WP_128211583.1|1113902_1115372_+|MFS-transporter
MKKKQTNVALVTVAIFVATFMSAIEGTIVSTAMPTIVGDLHGVNLMNWVISIFLLTNAIFTPIYGKLSDIFGRKRVFIIGIIIFLIGSMLSGLAHSMTTLIIWRALQGIGAGSIMPVSNTIIADIYSLEKRAKVMGLNGSAWGIASIIAPLLGGFIVDNLSWHWIFFINLPIGIITIILIQLYLKEEVSVHRKKIDYWGSVWLMLSLLGLMYGFQLLGESTASKLILGLSFIIFVVAGALFIRQERRAEDPIIFLDLFNDRTFVIQNVATMLVSGLLIGFEVYLPTWTQGILGLPASLAGFAVTPSSVLWIFGSFLAGKMLVKLKDNQILRISLTILAIGSFLLAVIPASTPFVAFFFIAAILGVGFGITITSTLVISQQLVSKDRIGVATSFNTLAKTLGQTIMMSVFGIIMNGTINMGIAHHPRINMTMMNQVINPQTAKQLPADLLPTLRDILYSALHNIYICGFILIIVAIVINAFSRPRTQKNK
>NZ_CP028249.1|WP_008842208.1|1115451_1116015_-|methyltransferase-domain-containing-protein
MLDNAMQYSHRLLAEVVQPGDHVVDATMGNGHDTLFLANLVQSQGRVFSFDIQAAALSATEARLEKQLPDHQHVQLIQDSHDQLAQYVDTPISGAVFNLGYLPGGNKQIITHSASTIAAVQQCLQLLKVGGRVVLVCYYGHPGGAAELAKLLEFTANLDQHQFTCLRYEFINQVHQPPILLAIERRK
>NZ_CP028249.1|WP_128211581.1|1116007_1116643_-|phosphatase-PAP2-family-protein
MRFKKFGWLILNWLPLLGLLTLVISVSNRWNWVHTYDHYLQKIIHGWQSPGLTPLVKIYTQLGNAKPFIFISIVILGMLLWRGYDRLAAFFLANVVLGNAINHLIKLWIQRPRPHFRLITIGGYSFPSGHSVAAMLLFGSLIFITTQTVRSPKWRISWILTCIILMLLLGLSRVYLNVHYPSDVTAGLLLGLVILQTTHWIFYRKKESQHA
>NZ_CP028249.1|WP_128211579.1|1117048_1119466_+|leucine--tRNA-ligase
MAYNHKEIEPKWQRYWQKHETFKTVESEQKPKYYALDMFPYPSGQGLHVGHPEGYTATDIMSRMKRMQGYKVLHPMGWDAFGLPAEQYAMKTGNNPKDFTAHNIKNFKRQIQSLGFSYDWSREVNTTDPEYYKWTQWIFEQLYKKGLAYEKETLVNWAPDLMGGTVVANEEVVNGKTERGGFPVYRKPMKQWILKITAYADRLIDDLDLVDWPDSIKEMQKNWIGRSIGASVFFDVEDSDQKIEIFTTRADTLYGATYLVISPEHPLVDQLTTLESKAAVEEYKQAVATKSDLERTDLNKDKTGVFTGSYAVNPVNGKKIPIWIADYVLASYGTGAVMAVPAHDPRDYEFARKFKIDIVPVIGGGNLDEEAYTGDGPHINSGFLDGLNKQEAIDKMLDWLEEHGAGHKKVNYRLRDWVFSRQRYWGEPIPVIHWEDGETTLVPEDELPLRLPATDNIKPSGTGESPLANLEDWLNVVDENGRKGRRETNTMPQWAGSSWYFLRYVDPKNQNKIADEDLLKEWLPVDLYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLVNQGMILGSNHEKMSKSKGNVVNPDDIVERFGADTLRLYEMFMGPLTESVAWSEEGLNGSRKWIERVWRLMIDDNNHLRDRITMINDHKLDLIYNQTVKKVTEDYENMRFNTAISQMMVFVNEAYKADALPMVYMEGLVKLLSPIVPHVAEEIWQIMGHDETITYEAWPTYDENKLVQDTVQVILQVNGKVRSKVEVEKDLDQAELEKIALADERIQQWTAEKDIKKVIVIPNKIVNIVAK
>NZ_CP028249.1|WP_002830674.1|1119722_1121405_+|polysaccharide-biosynthesis-protein
MDKPSEFDTAESQYLGSQPLRENSGNSSSKAKMLEGSAWMTAGSIFSRILGAIYIIPWVIWFGVYSDQANALYTKGYNIYSFFLIAAIAGIPSAISKQVAHYNAINEFALGQRLYKRGLLLSVGTGVVCAAILFFGAPFLNDGDPNVTTVLHALAWAVLVIPTMSLTRGFFQGYQEMGPSAVSQFIEQLARVAYMLVTAYLIMYKNHGDWVYGVAQSTFAAFIGALGGLLVLIGYFVKYRRRLRYLSQHSVNGLAISTTSLYKEIIAQAVPFIIIGSAITIFQLIDQYTFFRIMRSVSDYSATVLNNMFAIFAFNANKLVMIVISLASALAVTSVPILSEAKTRGDRAEISRQVADSILLFAFLMIPSALGMAAVAQPAYTLFYHLSDVGTAILQFNSYVAIVLGLFTVISAVMQGIGENVLAVKYFVVGMIVKFIFQFPMVAIFSAVGSLISTAIGFAVVNWLILRHINREYGLDYDKINGFIGKIITYSFGTFFIAFVVTNGLYLVMNPANKVQALIVILVAATLGGLFYVVCVLKSRLADEIIGGRAAGLRRMLKIK
>NZ_CP028249.1|WP_005919135.1|1121415_1122135_+|16S-rRNA-pseudouridine(516)-synthase
MRVDKFLHDMNVGTRSQIRKLIKEKAVFVNDVVAKSGRVKVDPVVDQVRLGEQVITYQQYFYFMMNKPLGVVTATEDRKQKTVMDLFNKVDFRKDLFPVGRLDKDTEGLLLITNNGPLAHQLLAPERHVQKTYEAVVTGQITDPAVKQFADGMVLKDGTQLKPADLTILNYSALDEQTLVHVTLKEGKYHQVRRMFGSLGERVVSLKRISFGPLQLEEGLLPGTYRELSDEEIEKLKTE
>NZ_CP028249.1|WP_128211577.1|1122240_1123071_-|NAD(P)H-hydrate-dehydratase
MLKINRQTLKSHWPVRQNQSHKGTYGHLLLIAGNAQYGGAGILAASAAVYAGGGLVTLATAKNNFTAVRATLAEIMLIDFTDFDQLSQSLANATGVVIGPGLGTDSTSLAVLNFTLAHIAEGVPLIIDGSAIDLVAQHDLQVSHHPTIYTPHQMEWQRLSGIKIADQSVGRNQAVVDQLNATVVLKHYHTEIYAPAAPVAQIMAGNPGMATGGSGDSLTGILLALIAQANSVNEGVRLGTFLHSYTADLIYEHEAVVLPHRLIRRLPAVLKQLTQP
>NZ_CP028249.1|WP_005919128.1|1123196_1123658_+|universal-stress-protein
MDYKKILFGYDGSPESMAAFNRAVEIAKSNHAKLIIASVMKKQHANTASVSLGFGVIETGIDLQDTLDQWKTTLEKLKQDAQQQGLPAEDIEVVFKQGSPKSMLSYTLPKEYDVDLIVLGATGMGTVAQVILGSTASYVVENAAPDVVIVKNN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP028249_1	1.1\|836853\|48\|NZ_CP028249\|CRISPRCasFinder	836853-836900	48	NZ_CP028249.1	836557-836604	1	0.979

1. spacer 1.1|836853|48|NZ_CP028249|CRISPRCasFinder matches to position: 836557-836604, mismatch: 1, identity: 0.979

gtttagcaattggtgccttaatttggttagccggaggaagttggggcc	CRISPR spacer
gtttagcaattggtgccttaatttggttaaccggaggaagttggggcc	Protospacer
*****************************.******************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

800 : 37678

Lactobacillus_phage(45.83%)

terminase,plate,tail,portal,integrase,capsid,holin

attL 4834:4849|attR 42053:42068

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212151.1\|800_2054_-	1,4-beta-N-acetylmuramidase	D2IYY2	Enterococcus_phage	1.1e-70	58.3
WP_160212152.1\|2037_2292_-\|holin	holin	NA	NA	NA	NA
WP_144235585.1\|2291_2537_-	hypothetical protein	NA	NA	NA	NA
WP_065124781.1\|2612_4103_-	hypothetical protein	NA	NA	NA	NA
WP_065124782.1\|4118_4940_-	collagen-like protein	NA	NA	NA	NA
4834:4849	attL	NA	NA	NA	NA
WP_065124783.1\|4952_5990_-\|plate	BppU family phage baseplate upper protein	E9LUJ9	Lactobacillus_phage	6.8e-18	35.5
WP_065124784.1\|5979_6390_-	hypothetical protein	NA	NA	NA	NA
WP_065124785.1\|6370_6601_-	hypothetical protein	NA	NA	NA	NA
WP_160212153.1\|6593_7715_-	hypothetical protein	O03938	Lactobacillus_phage	1.7e-78	42.4
WP_159225198.1\|7720_8545_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	1.3e-16	25.9
WP_160212154.1\|8545_13642_-	tape measure protein	O03937	Lactobacillus_phage	6.7e-26	29.3
WP_160212155.1\|13675_14296_-	hypothetical protein	O03936	Lactobacillus_phage	3.2e-31	41.6
WP_160212156.1\|14305_14698_-	hypothetical protein	NA	NA	NA	NA
WP_160212157.1\|14768_15236_-	Ig domain-containing protein	A0A220BZ11	Staphylococcus_phage	1.8e-18	43.0
WP_160212158.1\|15855_16251_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_160212159.1\|16250_16595_-\|capsid	capsid protein	O03933	Lactobacillus_phage	1.0e-15	43.2
WP_160212160.1\|16594_16945_-\|capsid	capsid protein	O03932	Lactobacillus_phage	1.5e-25	54.6
WP_160212161.1\|16941_17361_-	hypothetical protein	NA	NA	NA	NA
WP_160212162.1\|17432_18329_-	hypothetical protein	Q6SED2	Lactobacillus_prophage	5.9e-111	65.7
WP_160212163.1\|18340_18904_-\|capsid	capsid protein	A0A059T7N8	Listeria_phage	6.5e-15	42.9
WP_160212164.1\|18994_20110_-\|capsid	capsid protein	U3PFU0	Lactobacillus_phage	5.2e-40	29.3
WP_160212165.1\|20127_21681_-\|portal	phage portal protein	O03928	Lactobacillus_phage	5.9e-167	59.2
WP_160212166.1\|21693_23001_-\|terminase	PBSX family phage terminase large subunit	A0A059T5E2	Listeria_phage	1.6e-133	54.9
WP_160212167.1\|22987_23680_-\|terminase	terminase	V5URT8	Oenococcus_phage	1.6e-15	44.4
WP_160212168.1\|23963_24530_-	hypothetical protein	NA	NA	NA	NA
WP_160212169.1\|24903_25335_-	hypothetical protein	NA	NA	NA	NA
WP_160212170.1\|25540_25951_-	hypothetical protein	NA	NA	NA	NA
WP_160212171.1\|26335_26578_-	hypothetical protein	NA	NA	NA	NA
WP_160212172.1\|26570_26762_-	hypothetical protein	NA	NA	NA	NA
WP_159206544.1\|26762_26954_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_160212173.1\|27092_27257_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.2e-15	73.6
WP_160212174.1\|27426_27858_-	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	3.2e-38	57.1
WP_160212175.1\|27860_28268_-	hypothetical protein	NA	NA	NA	NA
WP_160212176.1\|28212_28935_-	hypothetical protein	E9LUU3	Lactobacillus_phage	2.6e-85	66.5
WP_160212177.1\|28939_29818_-	helix-turn-helix domain-containing protein	A0A097BYA5	Leuconostoc_phage	2.4e-40	46.6
WP_160212178.1\|29810_30638_-	hypothetical protein	Q8SDH6	Lactococcus_phage	7.1e-10	34.1
WP_160212179.1\|30637_31531_-	DUF1351 domain-containing protein	U5U3Y3	Lactobacillus_phage	5.0e-25	31.6
WP_160212180.1\|31717_31861_-	hypothetical protein	NA	NA	NA	NA
WP_160212181.1\|31874_32141_-	hypothetical protein	NA	NA	NA	NA
WP_160212182.1\|32122_32590_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_160212183.1\|32672_32888_-	hypothetical protein	NA	NA	NA	NA
WP_004165747.1\|32884_33127_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004165746.1\|33288_33660_+	helix-turn-helix transcriptional regulator	A8ATX5	Listeria_phage	6.0e-09	35.2
WP_159225223.1\|33671_34079_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_160212184.1\|34152_34671_+	hypothetical protein	NA	NA	NA	NA
WP_160212185.1\|34679_35105_+	SHOCT domain-containing protein	NA	NA	NA	NA
WP_159216943.1\|35424_36102_+	hypothetical protein	A0A173G9H4	Propionibacterium_phage	6.0e-07	67.6
WP_159216930.1\|36190_36415_+	hypothetical protein	NA	NA	NA	NA
WP_160212186.1\|36502_37678_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9I5L3	Streptococcus_phage	4.8e-36	26.1
42053:42068	attR	NA	NA	NA	NA

DBSCAN-SWA_2

974934 : 1030182

unidentified_phage(26.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_128212102.1\|974934_976008_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-43	35.2
WP_128211732.1\|976028_976616_+	phenolic acid decarboxylase	NA	NA	NA	NA
WP_002829878.1\|976637_977162_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_053905821.1\|977351_978140_-	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	2.2e-13	28.7
WP_002831159.1\|978344_978578_-	hypothetical protein	NA	NA	NA	NA
WP_053905820.1\|979013_980405_+\|tRNA	asparagine--tRNA ligase	A0A1V0SDB6	Indivirus	4.9e-72	35.7
WP_128211730.1\|980504_981884_-	C69 family dipeptidase	NA	NA	NA	NA
WP_004166656.1\|982016_982319_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_002831165.1\|982471_983125_-	ABC transporter permease	NA	NA	NA	NA
WP_053905819.1\|983108_984536_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.5e-10	26.3
WP_053905818.1\|984546_985122_-	ABC transporter permease	NA	NA	NA	NA
WP_128211776.1\|986834_988985_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.5e-256	59.9
WP_002829866.1\|988995_989583_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	2.6e-51	53.8
WP_053905816.1\|989597_990374_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.8e-07	24.6
WP_053905815.1\|990354_991416_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_128211778.1\|991363_992593_+	cysteine desulfurase	Q2XUY6	environmental_halophage	4.2e-83	41.2
WP_053905813.1\|992589_993030_+	SUF system NifU family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_002831175.1\|993022_994429_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_002831177.1\|994671_995295_-	MarC family protein	NA	NA	NA	NA
WP_053905812.1\|995523_996411_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053905811.1\|996526_998002_+	UbiD family decarboxylase	NA	NA	NA	NA
WP_053905810.1\|998064_998661_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_053905809.1\|998653_999070_+	hypothetical protein	NA	NA	NA	NA
WP_053905808.1\|999204_999573_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_053905822.1\|999920_1000112_+	addiction module toxin, HicA family	NA	NA	NA	NA
WP_119178960.1\|1000153_1000528_+	antitoxin HicB	A0A1L2JY34	Aeribacillus_phage	8.4e-11	35.9
WP_053905806.1\|1000628_1000961_+	hypothetical protein	NA	NA	NA	NA
WP_053905805.1\|1001044_1002187_-	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_053905804.1\|1002600_1003536_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_002829849.1\|1003711_1004749_+	zinc-dependent alcohol dehydrogenase family protein	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	6.4e-08	29.5
WP_004166638.1\|1005088_1006258_-	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_128211920.1\|1006404_1006731_-	hypothetical protein	NA	NA	NA	NA
WP_004166637.1\|1006740_1007202_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_004166634.1\|1009054_1010071_-	general stress protein	NA	NA	NA	NA
WP_004166633.1\|1010092_1011463_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_036671510.1\|1011628_1011877_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_160212201.1\|1012448_1013378_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.6e-18	29.9
WP_128474541.1\|1013670_1015335_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_126130461.1\|1015556_1016486_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.2e-18	29.9
WP_126130462.1\|1016463_1017402_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_008842402.1\|1019212_1020547_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	2.2e-29	27.2
WP_005919347.1\|1020699_1021230_-	MFS transporter	NA	NA	NA	NA
WP_075139729.1\|1021244_1021478_-	hypothetical protein	NA	NA	NA	NA
WP_065124623.1\|1022075_1023026_+	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_080561955.1\|1022941_1023472_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	7.2e-16	38.7
WP_008842398.1\|1023441_1024035_+	AlwI family type II restriction endonuclease	NA	NA	NA	NA
WP_128472081.1\|1026164_1027730_-	AAA family ATPase	NA	NA	NA	NA
WP_024862528.1\|1028168_1028534_-	hypothetical protein	NA	NA	NA	NA
WP_002831219.1\|1028688_1028919_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_128212102.1\|1029108_1030182_+\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-43	35.2

DBSCAN-SWA_3

1503469 : 1512032

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053906056.1\|1503469_1504051_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.5e-22	35.2
WP_053906057.1\|1504050_1505097_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FC27	Synechococcus_phage	2.7e-54	37.7
WP_053906058.1\|1505099_1506569_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-57	34.3
WP_053906059.1\|1506553_1508758_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.1e-145	41.2
WP_128211717.1\|1508775_1509450_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002831740.1\|1509446_1509707_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_053906060.1\|1509693_1510428_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D7SLB8	Cyanophage	1.4e-41	42.5
WP_053906061.1\|1510405_1511566_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_053906062.1\|1511549_1512032_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-18	41.0

DBSCAN-SWA_4

1542125 : 1549446

Staphylococcus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002830297.1\|1542125_1542971_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	2.1e-17	35.6
WP_053906266.1\|1543365_1543848_-	dihydrofolate reductase	G9J252	Bacillus_phage	1.0e-21	35.4
WP_002831862.1\|1543865_1544816_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	5.1e-113	59.9
WP_053906265.1\|1544820_1546716_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.5e-50	30.3
WP_053906264.1\|1546718_1547927_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.1e-43	35.1
WP_053906263.1\|1548042_1548912_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-54	37.6
WP_002830304.1\|1548975_1549446_-	nucleoside deoxyribosyltransferase	K4I206	Lactobacillus_phage	2.7e-14	34.6

DBSCAN-SWA_5

1573283 : 1658110

100

Lactobacillus_phage(39.53%)

terminase,plate,protease,tRNA,tail,portal,integrase,head,holin,capsid

attL 1618670:1618690|attR 1658252:1658272

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002830328.1\|1573283_1573994_-\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
WP_002830329.1\|1574089_1575229_-	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	8.5e-38	35.1
WP_053906253.1\|1575246_1577103_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	8.6e-56	33.1
WP_053906252.1\|1577448_1579521_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_002830333.1\|1579520_1580420_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_002830334.1\|1580705_1581467_-	DNA repair protein RecO	NA	NA	NA	NA
WP_002830335.1\|1581469_1582384_-	GTPase Era	NA	NA	NA	NA
WP_004165942.1\|1582408_1582792_-	diacylglycerol kinase family protein	NA	NA	NA	NA
WP_002830337.1\|1582775_1583246_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_053906251.1\|1583250_1584219_-	phosphate starvation-inducible protein PhoH	L7TP00	Rhizobium_phage	1.8e-49	47.6
WP_002830339.1\|1584230_1584674_-	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	1.5e-14	35.9
WP_002830340.1\|1584732_1584918_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_002830341.1\|1585117_1585927_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_053906250.1\|1585949_1586354_+	hypothetical protein	NA	NA	NA	NA
WP_053906249.1\|1586571_1587462_-	deoxyribonuclease IV	A0A2L2DJK8	Acanthamoeba_polyphaga_mimivirus	6.2e-28	32.3
WP_128211461.1\|1587464_1588670_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_053906247.1\|1588662_1589820_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_002830347.1\|1589832_1590711_-	YitT family protein	NA	NA	NA	NA
WP_053906246.1\|1590992_1592774_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
WP_002830351.1\|1592789_1594064_-\|tRNA	histidine--tRNA ligase	A0A2K9L0H9	Tupanvirus	7.8e-24	25.7
WP_128211936.1\|1594477_1595347_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	2.2e-22	38.7
WP_002830353.1\|1595331_1595955_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_002830354.1\|1596045_1596495_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_002830361.1\|1596504_1598736_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	7.6e-06	38.5
WP_002830362.1\|1598843_1599173_-	hypothetical protein	NA	NA	NA	NA
WP_160212216.1\|1599187_1599925_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_053906245.1\|1599934_1600882_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_053906244.1\|1601207_1602506_-	uracil permease	Q9KX94	Enterobacteria_phage	1.3e-63	37.1
WP_002831915.1\|1602729_1602960_-	hypothetical protein	NA	NA	NA	NA
WP_002830367.1\|1603774_1603975_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	1.3e-10	54.8
WP_053906243.1\|1604511_1605696_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_053906242.1\|1605927_1606923_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	8.4e-74	44.4
WP_002830371.1\|1606945_1608529_-	sodium:proton antiporter	NA	NA	NA	NA
WP_002831922.1\|1608703_1609162_-	flavodoxin	NA	NA	NA	NA
WP_002831923.1\|1609263_1609713_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_053906241.1\|1609815_1611453_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-28	23.0
WP_128211754.1\|1611782_1612520_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_128211752.1\|1612731_1613109_-	general stress protein	NA	NA	NA	NA
WP_002831926.1\|1613701_1614211_+	membrane protein	NA	NA	NA	NA
WP_002831927.1\|1614333_1614600_+	membrane protein	NA	NA	NA	NA
WP_053906569.1\|1615059_1615482_+	hypothetical protein	NA	NA	NA	NA
WP_053906572.1\|1616163_1616802_-	carbonic anhydrase family protein	NA	NA	NA	NA
WP_002830382.1\|1617205_1618315_-	L-lactate oxidase	NA	NA	NA	NA
1618670:1618690	attL	NA	NA	NA	NA
WP_128211675.1\|1619415_1620537_-	N-acetylmuramoyl-L-alanine amidase	A0A0N7IR99	Lactobacillus_phage	3.0e-96	52.7
WP_128211673.1\|1620520_1620763_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	7.6e-05	57.9
WP_128211677.1\|1620762_1621047_-	hypothetical protein	NA	NA	NA	NA
WP_075139822.1\|1621096_1621243_-	XkdX family protein	NA	NA	NA	NA
WP_128211671.1\|1621242_1621521_-	hypothetical protein	NA	NA	NA	NA
WP_128211669.1\|1621520_1622480_-	hypothetical protein	NA	NA	NA	NA
WP_128211667.1\|1622472_1624206_-\|plate	phage baseplate upper protein	O03968	Lactobacillus_phage	3.0e-66	49.4
WP_128211665.1\|1624205_1624517_-	hypothetical protein	NA	NA	NA	NA
WP_128211663.1\|1624517_1624838_-	hypothetical protein	NA	NA	NA	NA
WP_159215560.1\|1624827_1625913_-	hypothetical protein	A0A0M7RDS2	Lactobacillus_phage	2.8e-75	43.5
WP_128211658.1\|1625971_1626805_-\|tail	phage tail family protein	A0A0M7RF73	Lactobacillus_phage	2.5e-47	36.8
WP_128211656.1\|1626817_1631932_-	peptidoglycan DD-metalloendopeptidase family protein	A0A0K0MWQ1	Streptococcus_phage	1.2e-86	33.3
WP_128211654.1\|1632138_1632543_-	hypothetical protein	NA	NA	NA	NA
WP_159215558.1\|1632679_1633282_-\|tail	phage tail protein	O36159	Streptococcus_virus	8.4e-45	48.2
WP_159215557.1\|1633294_1633669_-	DUF806 family protein	Q38220	Leuconostoc_phage	1.3e-14	32.4
WP_128211804.1\|1633671_1634085_-\|tail	phage tail protein	A0A286QQY0	Streptococcus_phage	4.0e-30	54.5
WP_159216229.1\|1634084_1634441_-\|head	phage head closure protein	A8YQJ4	Lactobacillus_phage	4.3e-12	35.5
WP_128211808.1\|1634421_1634745_-\|head,tail	phage gp6-like head-tail connector protein	Q9AZM1	Lactococcus_phage	3.7e-07	33.3
WP_128211810.1\|1634760_1635231_-	Ig domain-containing protein	A0A1D6Z291	Staphylococcus_phage	1.9e-20	47.0
WP_128211818.1\|1635313_1636528_-\|capsid	phage major capsid protein	D2KRA9	Lactobacillus_phage	1.1e-83	59.6
WP_128211820.1\|1636648_1637239_-\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	5.0e-42	49.2
WP_128211812.1\|1637222_1638335_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	9.7e-63	36.3
WP_128211814.1\|1638535_1640410_-\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	3.0e-141	41.4
WP_128211816.1\|1640409_1640874_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	4.5e-46	61.3
WP_128212003.1\|1641072_1641372_-	hypothetical protein	NA	NA	NA	NA
WP_128212001.1\|1641368_1641824_-	HNH endonuclease	Q9AZM8	Lactococcus_phage	5.4e-28	38.6
WP_159215554.1\|1641908_1642229_-	hypothetical protein	NA	NA	NA	NA
WP_128211997.1\|1642450_1642885_-	RNA polymerase subunit sigma-70	O03925	Lactobacillus_phage	1.2e-13	34.8
WP_128211995.1\|1643221_1643485_-	hypothetical protein	A0A2K9VC51	Lactobacillus_phage	1.1e-20	58.1
WP_159215567.1\|1643498_1643741_-	hypothetical protein	A8ASM5	Listeria_phage	4.9e-12	55.2
WP_159215553.1\|1643810_1644176_-	hypothetical protein	NA	NA	NA	NA
WP_128211852.1\|1644192_1644393_-	hypothetical protein	NA	NA	NA	NA
WP_159215552.1\|1644392_1644533_-	hypothetical protein	NA	NA	NA	NA
WP_128211854.1\|1644535_1644907_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_128211856.1\|1645039_1645441_-	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	5.3e-27	46.3
WP_128211858.1\|1645421_1646054_-	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_128211860.1\|1646171_1646987_-	ATP-binding protein	O03914	Lactobacillus_phage	6.9e-58	45.3
WP_128211862.1\|1646967_1647720_-	hypothetical protein	A0A1W6JNI1	Staphylococcus_phage	2.3e-52	49.8
WP_128211864.1\|1647758_1647989_-	hypothetical protein	NA	NA	NA	NA
WP_128211866.1\|1647972_1648656_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.7e-81	64.8
WP_128211868.1\|1648667_1649093_-	single-stranded DNA-binding protein	A0A2D1GPB7	Lactobacillus_phage	2.1e-42	58.2
WP_128211870.1\|1649085_1649784_-	ERF family protein	I6TJU2	Staphylococcus_virus	7.6e-21	38.3
WP_128211872.1\|1649784_1650240_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_159215551.1\|1650463_1651126_+	hypothetical protein	NA	NA	NA	NA
WP_128211987.1\|1651235_1651490_-	hypothetical protein	NA	NA	NA	NA
WP_128211985.1\|1651590_1651920_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_128211989.1\|1652216_1652999_-	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	4.9e-85	58.8
WP_128211983.1\|1653104_1653299_+	hypothetical protein	NA	NA	NA	NA
WP_159215550.1\|1653290_1653428_-	hypothetical protein	NA	NA	NA	NA
WP_002831840.1\|1653441_1653651_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_128211981.1\|1653718_1654027_+	hypothetical protein	NA	NA	NA	NA
WP_159215549.1\|1654016_1654223_-	hypothetical protein	NA	NA	NA	NA
WP_002831842.1\|1654479_1654821_+	helix-turn-helix transcriptional regulator	D2IZV9	Enterococcus_phage	2.3e-15	38.1
WP_128212081.1\|1654829_1655237_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.0e-14	36.1
WP_159215548.1\|1655299_1656427_+	hypothetical protein	NA	NA	NA	NA
WP_053905909.1\|1656573_1656771_+	hypothetical protein	NA	NA	NA	NA
WP_128212073.1\|1656994_1658110_+\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	1.5e-100	52.2
1658252:1658272	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028250

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

23355 : 28259

Lactobacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212222.1\|23355_23868_-	alcohol dehydrogenase	A8ATW6	Listeria_phage	4.2e-21	40.4
WP_053906092.1\|23897_24182_-	cytosolic protein	NA	NA	NA	NA
WP_128211906.1\|24557_24683_+	helix-turn-helix domain-containing protein	Q6J1X3	Lactobacillus_phage	9.3e-15	90.2
WP_085058321.1\|24851_25556_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	2.2e-129	98.3
WP_128211902.1\|25592_25694_+	hypothetical protein	Q6J1X2	Lactobacillus_phage	4.2e-10	97.0
WP_024863179.1\|26116_26719_+	recombinase family protein	M9Q1K0	Clostridium_phage	2.5e-20	41.4
WP_128212102.1\|27185_28259_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	6.3e-43	35.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028249

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028250

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection