CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP028255	Leuconostoc mesenteroides strain SRCM102735 chromosome, complete genome	0 crisprs	DEDDh,RT,cas3,csa3	0	146
NZ_CP028256	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP028257	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence	1 crisprs	csa3	1	3
NZ_CP028258	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 13254

Clostridium_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325161.1\|376_985_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_014325160.1\|1327_1876_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_061515098.1\|2279_3896_+	leucine-rich repeat protein	NA	NA	NA	NA
WP_011680450.1\|3957_4896_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_160211990.1\|5093_6455_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_010292026.1\|6599_7217_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025268519.1\|7339_10087_+	ABC transporter permease	NA	NA	NA	NA
WP_014325156.1\|10106_11231_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_014325154.1\|12260_12701_+	hypothetical protein	NA	NA	NA	NA
WP_050884390.1\|12864_13254_+	helix-turn-helix transcriptional regulator	A0A0A7RUJ5	Clostridium_phage	5.5e-05	43.9

DBSCAN-SWA_2

18059 : 18983

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325146.1\|18059_18983_-	cation transporter	M1Q1N9	Streptococcus_phage	3.5e-34	31.4

DBSCAN-SWA_3

25169 : 27589

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002815634.1\|25169_25370_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	73.8
WP_011680438.1\|25477_26191_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_036092568.1\|26317_27589_+	hypothetical protein	Q9KX94	Enterobacteria_phage	3.0e-60	38.1

DBSCAN-SWA_4

35002 : 37913

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680432.1\|35002_35641_+	LysM peptidoglycan-binding domain-containing protein	K7QMG8	Staphylococcus_phage	4.8e-06	40.8
WP_025268506.1\|35701_36946_+	NADH-dependent flavin oxidoreductase	NA	NA	NA	NA
WP_002815619.1\|37145_37913_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	2.3e-18	29.0

DBSCAN-SWA_5

51289 : 52576

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680417.1\|51289_52576_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	9.1e-105	48.7

DBSCAN-SWA_6

60426 : 63472

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680410.1\|60426_61017_+	guanylate kinase	U5J9X2	Bacillus_phage	2.0e-14	37.0
WP_025268497.1\|61292_62486_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_025268496.1\|62482_63472_+	D-2-hydroxyacid dehydrogenase	M1HST2	Paramecium_bursaria_Chlorella_virus	1.2e-40	35.1

DBSCAN-SWA_7

71016 : 78311

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680408.1\|71016_74625_+	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.8e-49	24.2
WP_011680407.1\|74648_78311_+	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	5.1e-68	25.0

DBSCAN-SWA_8

82616 : 85347

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268492.1\|82616_84146_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	2.8e-36	27.2
WP_025268491.1\|84138_85347_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-19	26.0

DBSCAN-SWA_9

89028 : 99456

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680398.1\|89028_89730_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-30	35.4
WP_025268489.1\|89710_91009_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.5e-25	31.7
WP_025268488.1\|91101_91959_+\|protease	trypsin-like serine protease	W5SAB9	Pithovirus	4.3e-10	29.3
WP_002815833.1\|92052_92379_-	thioredoxin family protein	NA	NA	NA	NA
WP_025268487.1\|92887_93805_+	homoserine O-succinyltransferase	NA	NA	NA	NA
WP_025268486.1\|93801_94911_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	2.4e-13	27.5
WP_011680396.1\|94907_96047_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_025268485.1\|96098_97226_+	vitamin B12 independent methionine synthase	A0A218MNE0	uncultured_virus	1.7e-67	40.7
WP_025268484.1\|97427_97904_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_025268483.1\|98328_99456_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	4.3e-74	41.5

DBSCAN-SWA_10

118740 : 129153

Pandoravirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268476.1\|118740_119343_+	thymidine kinase	C1KFH3	Lactobacillus_virus	2.9e-45	50.0
WP_025268475.1\|119432_120503_+	peptide chain release factor 1	NA	NA	NA	NA
WP_025268474.1\|120499_121492_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_025268473.1\|121488_122502_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	3.9e-50	38.5
WP_160211992.1\|122652_124143_+	carboxypeptidase M32	NA	NA	NA	NA
WP_002815800.1\|124402_124672_+	phosphocarrier protein HPr	NA	NA	NA	NA
WP_011680377.1\|124673_126389_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.6e-16	31.4
WP_011680376.1\|126504_127215_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_014325103.1\|127198_127756_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011680374.1\|127733_128144_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_011680373.1\|128136_129153_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A291ATS8	Pandoravirus	7.8e-35	33.2

DBSCAN-SWA_11

138549 : 146107

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002815782.1\|138549_138834_+	co-chaperone GroES	A0A221S331	uncultured_virus	3.7e-11	37.8
WP_011680362.1\|138862_140482_+	chaperonin GroEL	A0A240F779	uncultured_virus	2.8e-159	54.3
WP_011680361.1\|140558_141362_-	DUF2785 domain-containing protein	NA	NA	NA	NA
WP_025268465.1\|141387_142725_-	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	1.5e-62	31.5
WP_011680359.1\|142858_143302_+	DUF3290 domain-containing protein	NA	NA	NA	NA
WP_160211993.1\|143298_143937_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_010281711.1\|144034_144925_+	prenyltransferase	NA	NA	NA	NA
WP_011680357.1\|145111_146107_+	D-2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	9.1e-44	34.2

DBSCAN-SWA_12

153635 : 154025

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680351.1\|153635_154025_-	helix-turn-helix domain-containing protein	D6PSS9	Lactobacillus_phage	6.7e-19	43.3

DBSCAN-SWA_13

168223 : 168862

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325085.1\|168223_168862_+	nicotinate-nucleotide adenylyltransferase	G3MA22	Bacillus_virus	4.2e-10	22.6

DBSCAN-SWA_14

172472 : 179582

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680336.1\|172472_173162_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.7e-31	34.1
WP_011680335.1\|173174_174275_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.6e-25	29.6
WP_025268449.1\|174261_174534_+	acylphosphatase	NA	NA	NA	NA
WP_025268448.1\|174605_175529_+	membrane protein insertase YidC	NA	NA	NA	NA
WP_002815751.1\|175588_176362_+	RNA methyltransferase	NA	NA	NA	NA
WP_031296004.1\|176433_176676_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_025268447.1\|176781_179106_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.8e-93	42.9
WP_025268446.1\|179117_179582_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.5e-37	55.6

DBSCAN-SWA_15

184905 : 191034

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268444.1\|184905_187308_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	1.3e-16	43.9
WP_010279689.1\|187463_187814_+	hypothetical protein	NA	NA	NA	NA
WP_011680325.1\|187877_188954_+	hypothetical protein	NA	NA	NA	NA
WP_010291209.1\|189004_189331_-	hypothetical protein	NA	NA	NA	NA
WP_011680324.1\|189587_190184_+	guanylate kinase	A0A0M5KCK5	Mollivirus	3.5e-11	38.9
WP_011680323.1\|190194_190407_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_011680322.1\|190446_191034_+	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	5.9e-27	44.2

DBSCAN-SWA_16

197386 : 254911

Leuconostoc_phage(38.24%)

head,tail,portal,holin,terminase,tRNA,capsid,protease,integrase

attL 198973:198990|attR 223537:223554

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325076.1\|197386_197821_+	Spx/MgsR family RNA polymerase-binding regulatory protein	G3MAU4	Bacillus_virus	8.6e-07	29.9
WP_011680318.1\|197877_198585_+	adaptor protein MecA	NA	NA	NA	NA
WP_011680317.1\|198652_199057_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
198973:198990	attL	NA	NA	NA	NA
WP_002815399.1\|199085_199268_-	DUF3042 family protein	NA	NA	NA	NA
WP_025268441.1\|199351_200095_+	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	3.2e-17	32.8
WP_025268440.1\|200087_200981_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_025268439.1\|201026_201854_-	hypothetical protein	NA	NA	NA	NA
WP_011680314.1\|202215_203373_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.5e-122	59.9
WP_025268438.1\|203391_204351_+	ADP-ribosylglycohydrolase	NA	NA	NA	NA
WP_025268437.1\|204368_205280_-	diacylglycerol kinase	NA	NA	NA	NA
WP_014325070.1\|205377_206892_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_010286910.1\|207809_208199_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_050884625.1\|208378_209425_-\|integrase	site-specific integrase	E3W8I1	Leuconostoc_phage	1.2e-51	35.9
WP_128739733.1\|209533_211285_-	hypothetical protein	NA	NA	NA	NA
WP_111303579.1\|211330_211765_-	ImmA/IrrE family metallo-endopeptidase	E3W8B8	Leuconostoc_phage	4.8e-74	94.4
WP_025268432.1\|211761_212109_-	transcriptional regulator	E3W8B9	Leuconostoc_phage	1.2e-24	53.8
WP_025268431.1\|212374_212605_+	hypothetical protein	NA	NA	NA	NA
WP_155246466.1\|212621_212768_+	hypothetical protein	NA	NA	NA	NA
WP_010284703.1\|212745_212955_-	hypothetical protein	NA	NA	NA	NA
WP_025268430.1\|213023_213266_+	hypothetical protein	NA	NA	NA	NA
WP_051394935.1\|213229_214048_+	phage antirepressor KilAC domain-containing protein	A0A0A7DN31	Lactobacillus_phage	1.6e-75	64.4
WP_025268428.1\|214378_214609_-	hypothetical protein	NA	NA	NA	NA
WP_025268427.1\|214734_214941_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025268426.1\|215033_215216_+	hypothetical protein	NA	NA	NA	NA
WP_096639503.1\|215218_215620_+	hypothetical protein	A0A097BYE9	Leuconostoc_phage	4.9e-33	51.1
WP_061515063.1\|215612_216263_+	ERF family protein	A0A2H4J439	uncultured_Caudovirales_phage	9.8e-15	42.3
WP_150280073.1\|216228_216654_+	single-stranded DNA-binding protein	A0A097BYB0	Leuconostoc_phage	4.5e-53	73.8
WP_160211996.1\|216664_217420_+	DNA replication protein	D7RWG1	Brochothrix_phage	1.9e-86	70.4
WP_153245440.1\|217416_218190_+	ATP-binding protein	D2KRE5	Lactobacillus_phage	1.7e-34	41.2
WP_160211997.1\|218345_219047_+	hypothetical protein	E3W8D3	Leuconostoc_phage	5.5e-96	68.7
WP_102753474.1\|219165_219387_+	hypothetical protein	A0A097BYE4	Leuconostoc_phage	2.8e-14	64.1
WP_153245439.1\|219379_219778_+	hypothetical protein	NA	NA	NA	NA
WP_153245438.1\|219780_220221_+	hypothetical protein	NA	NA	NA	NA
WP_153245437.1\|220386_220530_+	hypothetical protein	NA	NA	NA	NA
WP_153245436.1\|220908_221082_+	hypothetical protein	NA	NA	NA	NA
WP_153245435.1\|221081_221387_+	hypothetical protein	NA	NA	NA	NA
WP_160211998.1\|221396_221717_+	DUF3850 domain-containing protein	A0A097BYG6	Leuconostoc_phage	1.9e-35	70.5
WP_160211999.1\|222387_222780_+	DUF722 domain-containing protein	A0A097BYG4	Leuconostoc_phage	5.7e-58	86.2
WP_160212000.1\|223489_224710_+	helix-turn-helix domain-containing protein	A0A097BYC5	Leuconostoc_phage	1.0e-193	81.0
223537:223554	attR	NA	NA	NA	NA
WP_160212001.1\|224719_224923_+	hypothetical protein	NA	NA	NA	NA
WP_160212002.1\|225014_225569_+	hypothetical protein	NA	NA	NA	NA
WP_025268413.1\|225798_225999_+	hypothetical protein	A0A097BY73	Enterococcus_phage	7.2e-17	68.2
WP_160212003.1\|226065_226383_+	hypothetical protein	NA	NA	NA	NA
WP_160212004.1\|226383_226914_+	HNH endonuclease	A8YQN7	Lactobacillus_phage	1.4e-38	46.9
WP_160212005.1\|226910_227219_+	hypothetical protein	NA	NA	NA	NA
WP_153245427.1\|227408_227972_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	1.5e-06	27.9
WP_160212006.1\|227958_229839_+\|terminase	terminase large subunit	A8YQI8	Lactobacillus_phage	7.3e-236	63.6
WP_114668851.1\|229835_230024_+	hypothetical protein	NA	NA	NA	NA
WP_160212007.1\|230028_231171_+\|portal	phage portal protein	Q6J1Y4	Lactobacillus_phage	2.1e-97	51.2
WP_160212008.1\|231167_231857_+\|protease	Clp protease ClpP	Q6J1Y3	Lactobacillus_phage	2.6e-58	51.3
WP_160212009.1\|231867_233031_+\|capsid	phage major capsid protein	Q6J1Y2	Lactobacillus_phage	3.3e-138	66.8
WP_160212010.1\|233041_233368_+\|head,tail	phage gp6-like head-tail connector protein	Q6J1Y1	Lactobacillus_phage	2.9e-23	55.2
WP_160212011.1\|233360_233732_+\|head	phage head closure protein	NA	NA	NA	NA
WP_160212012.1\|233721_234141_+	HK97 gp10 family phage protein	A0A0M7RDL2	Lactobacillus_phage	3.5e-21	43.7
WP_160212013.1\|234137_234512_+	DUF806 family protein	NA	NA	NA	NA
WP_160212014.1\|234515_235151_+	hypothetical protein	NA	NA	NA	NA
WP_136903820.1\|235491_235902_+	molecular chaperone	NA	NA	NA	NA
WP_025268398.1\|235940_236120_+	hypothetical protein	NA	NA	NA	NA
WP_160212015.1\|236120_241334_+\|tail	phage tail tape measure protein	Q8LTK2	Lactococcus_phage	4.5e-219	47.0
WP_160212130.1\|241399_242512_+	hypothetical protein	NA	NA	NA	NA
WP_160212016.1\|242525_246818_+	hypothetical protein	A0A097BY84	Leuconostoc_phage	3.3e-66	70.8
WP_160212017.1\|246831_246981_+	hypothetical protein	NA	NA	NA	NA
WP_115231284.1\|246980_247214_+	hypothetical protein	NA	NA	NA	NA
WP_115231283.1\|247263_247689_+	hypothetical protein	Q5K5I5	Oenococcus_phage	1.6e-37	52.6
WP_115231282.1\|247685_248777_+	hypothetical protein	Q5K5I4	Oenococcus_phage	3.2e-119	57.6
WP_011680274.1\|248788_249595_+	hypothetical protein	Q5K5I3	Oenococcus_phage	1.5e-44	46.0
WP_025268392.1\|249612_249837_+	hypothetical protein	NA	NA	NA	NA
WP_115231281.1\|249840_250932_+	1,4-beta-N-acetylmuramidase	E3W8H6	Leuconostoc_phage	3.8e-176	84.6
WP_160212018.1\|250941_251415_+\|holin	holin	E3W8H7	Leuconostoc_phage	7.8e-38	72.6
WP_111303521.1\|251508_251766_+	hypothetical protein	NA	NA	NA	NA
WP_011680268.1\|252327_254010_-	ribonuclease J	NA	NA	NA	NA
WP_025268388.1\|254009_254222_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_025268387.1\|254359_254911_+	TIGR00730 family Rossman fold protein	A0A2I2L3F0	Orpheovirus	7.1e-14	28.1

DBSCAN-SWA_17

260602 : 268094

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268383.1\|260602_261307_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.5e-13	28.4
WP_002815374.1\|261299_262091_+	metal ABC transporter permease	NA	NA	NA	NA
WP_011680260.1\|262194_263028_+	pur operon repressor	NA	NA	NA	NA
WP_025268382.1\|263034_264408_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	6.4e-32	33.2
WP_011680258.1\|264522_265008_+	hypothetical protein	NA	NA	NA	NA
WP_010288725.1\|265018_265273_-	hypothetical protein	NA	NA	NA	NA
WP_014325060.1\|265692_266970_+	exodeoxyribonuclease VII large subunit	A0A1V0SIT1	Klosneuvirus	4.7e-37	26.6
WP_002815368.1\|266962_267187_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_011680256.1\|267179_268094_+	polyprenyl synthetase family protein	A0A1V0SE37	Indivirus	8.1e-15	29.1

DBSCAN-SWA_18

278053 : 282601

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325051.1\|278053_278542_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.6e-25	42.0
WP_011680248.1\|278525_279617_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_025268377.1\|279681_280317_+	transporter	NA	NA	NA	NA
WP_061515027.1\|280318_282601_+	DNA internalization-related competence protein ComEC/Rec2	Q332B9	Clostridium_botulinum_C_phage	5.3e-23	25.6

DBSCAN-SWA_19

285723 : 287088

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268373.1\|285723_287088_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-51	31.6

DBSCAN-SWA_20

291247 : 300260

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061515025.1\|291247_292234_+	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	6.5e-18	28.8
WP_061515024.1\|292314_293709_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.3e-116	47.3
WP_160212020.1\|293849_296414_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	8.9e-43	22.9
WP_025268366.1\|296418_298365_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.6e-65	30.3
WP_011680232.1\|298840_299068_+	CsbD family protein	NA	NA	NA	NA
WP_031296130.1\|299260_299782_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	6.9e-19	34.0
WP_014325038.1\|299846_300260_+	nucleoside-diphosphate kinase	A0A2K9L595	Tupanvirus	5.5e-19	35.8

DBSCAN-SWA_21

306833 : 307544

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680226.1\|306833_307544_+	ribonuclease III	M1HK80	Acanthocystis_turfacea_Chlorella_virus	3.6e-18	33.5

DBSCAN-SWA_22

325876 : 339076

Bacillus_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680216.1\|325876_326593_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	A0A2H4UVM0	Bodo_saltans_virus	1.7e-07	24.8
WP_025268352.1\|326589_327354_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
WP_002815284.1\|327350_327749_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_011680214.1\|327772_328117_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_025268351.1\|328100_329174_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	4.3e-23	27.1
WP_025268350.1\|329261_329966_-	thiaminase II	NA	NA	NA	NA
WP_025268349.1\|330486_331077_+	cobalt ABC transporter permease	NA	NA	NA	NA
WP_050895272.1\|331090_332494_+	ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	1.4e-10	28.0
WP_011680209.1\|332490_333159_+	cobalt ABC transporter permease	NA	NA	NA	NA
WP_051394933.1\|333175_333700_+	hydrolase	NA	NA	NA	NA
WP_025268345.1\|333793_334615_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	9.1e-66	49.5
WP_011680206.1\|334611_336054_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	8.9e-109	44.5
WP_025268344.1\|336348_338559_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.1e-243	59.9
WP_002815265.1\|338494_339076_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	9.0e-52	56.9

DBSCAN-SWA_23

350131 : 350950

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014325001.1\|350131_350950_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	3.1e-74	52.4

DBSCAN-SWA_24

360356 : 370002

Staphylococcus_phage(42.86%)

protease,integrase

attL 355591:355605|attR 365263:365277

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
355591:355605	attL	NA	NA	NA	NA
WP_025268333.1\|360356_361913_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.2e-173	63.0
WP_160212024.1\|361905_363135_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	5.4e-22	28.3
WP_025268331.1\|363197_364115_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	1.6e-71	44.3
WP_081365855.1\|364186_365341_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.5e-18	26.5
365263:365277	attR	NA	NA	NA	NA
WP_011680190.1\|365561_366812_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-132	57.9
WP_025268329.1\|366812_367397_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_010281611.1\|367500_367944_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_011680189.1\|368046_368814_+	nicotinamide mononucleotide transporter	U5J9C5	Bacillus_phage	4.7e-24	31.5
WP_002815228.1\|368859_370002_+	nicotinamide-nucleotide adenylyltransferase	A0A2K9VDE3	Lactobacillus_phage	2.2e-110	56.4

DBSCAN-SWA_25

376151 : 380649

Acanthamoeba_castellanii_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212025.1\|376151_378077_+	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1E1EXF7	Acanthamoeba_castellanii_mimivirus	2.1e-20	30.3
WP_011680182.1\|378128_379016_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_002815217.1\|379029_379686_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_025268322.1\|379685_380345_+	thiamine diphosphokinase	NA	NA	NA	NA
WP_025268321.1\|380334_380649_+	thioredoxin	A0A1V0SD63	Indivirus	1.6e-07	38.9

DBSCAN-SWA_26

397526 : 400319

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268311.1\|397526_400319_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	5.8e-72	25.3

DBSCAN-SWA_27

407463 : 411156

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268307.1\|407463_411156_+	helicase-exonuclease AddAB subunit AddA	S5M596	Bacillus_phage	1.9e-17	25.1

DBSCAN-SWA_28

415724 : 418257

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268303.1\|415724_417692_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.5e-69	29.7
WP_011680153.1\|417726_418257_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	41.7

DBSCAN-SWA_29

422374 : 429695

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680148.1\|422374_423037_+	uracil-DNA glycosylase	A0A0A8IL23	Epstein-Barr_virus	5.1e-35	41.7
WP_011680147.1\|423142_424123_+	phosphate acetyltransferase	NA	NA	NA	NA
WP_025268302.1\|424490_425579_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.0e-80	48.6
WP_025268301.1\|425575_426754_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	2.6e-82	39.0
WP_025268300.1\|426770_427259_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_025268299.1\|427343_428066_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_011680143.1\|428411_429695_+	adenylosuccinate synthase	A0A2P1EKE7	Megavirus	8.9e-68	35.4

DBSCAN-SWA_30

437107 : 447776

Sphingomonas_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324955.1\|437107_438115_+	thymidylate synthase	H9NC59	Sphingomonas_phage	7.3e-17	27.9
WP_105296146.1\|438095_438854_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_014324953.1\|438903_440598_-	fibronectin/fibrinogen-binding protein	NA	NA	NA	NA
WP_025268294.1\|440788_442498_-	FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	2.7e-43	34.8
WP_002815134.1\|442508_443078_-	peroxiredoxin	NA	NA	NA	NA
WP_002815133.1\|443290_443605_+	membrane protein	NA	NA	NA	NA
WP_025268292.1\|443669_444311_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_025268291.1\|444351_444984_-	copper resistance protein	NA	NA	NA	NA
WP_002815130.1\|445043_445217_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_048592268.1\|445313_446108_-	nicotinamide mononucleotide transporter	A0A1B1SDZ0	Weissella_phage	1.7e-69	52.4
WP_011680131.1\|446437_447088_+	DUF1361 domain-containing protein	NA	NA	NA	NA
WP_105296144.1\|447296_447776_+	translation initiation factor IF-3	A0A2I7S9Q1	Vibrio_phage	1.5e-12	37.3

DBSCAN-SWA_31

457400 : 458674

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212031.1\|457400_458240_+	LicD family protein	A0A1V0SD50	Indivirus	3.0e-08	31.7
WP_160212032.1\|458236_458674_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	5.4e-17	37.8

DBSCAN-SWA_32

464867 : 467397

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150288610.1\|464867_465743_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	4.3e-98	59.7
WP_150288609.1\|465752_466346_+	dTDP-4-keto-6-deoxy-D-glucose epimerase	A0A1D8EQH2	Escherichia_phage	9.6e-09	28.3
WP_060461438.1\|466359_467397_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.3e-74	45.7

DBSCAN-SWA_33

474200 : 475514

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680103.1\|474200_475514_+	lysozyme M1 (1,4-beta-N-acetylmuramidase)	D6PSS2	Lactobacillus_phage	5.2e-23	35.0

DBSCAN-SWA_34

489892 : 492080

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268249.1\|489892_491083_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	2.1e-135	61.8
WP_025268248.1\|491126_492080_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.8e-90	57.2

DBSCAN-SWA_35

499160 : 502668

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042250343.1\|499160_499880_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	6.6e-20	29.1
WP_061514978.1\|500055_500820_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_002815074.1\|500812_502108_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.4e-20	34.0
WP_011680081.1\|502104_502668_+	hypoxanthine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.7e-15	34.0

DBSCAN-SWA_36

506782 : 513032

Streptococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268233.1\|506782_509176_+	DNA polymerase III subunit epsilon	A0A1X9I5C8	Streptococcus_phage	2.0e-33	25.3
WP_025268232.1\|509247_509775_+	hypothetical protein	NA	NA	NA	NA
WP_025268231.1\|509789_510983_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_025268230.1\|510990_512298_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.7e-53	29.7
WP_002815059.1\|512396_513032_+	DnaD domain protein	A0A0N7AE27	Bacillus_phage	1.8e-13	37.2

DBSCAN-SWA_37

524360 : 532637

Bacillus_virus(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268223.1\|524360_526598_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	7.3e-09	35.4
WP_011680061.1\|526758_527208_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_014324894.1\|527201_527816_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_014324893.1\|527992_530056_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	4.4e-125	42.8
WP_025268222.1\|530198_532637_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	6.2e-86	31.3

DBSCAN-SWA_38

536726 : 539231

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268220.1\|536726_539231_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.5e-18	22.7

DBSCAN-SWA_39

545122 : 548561

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680047.1\|545122_546970_+	molecular chaperone DnaK	A0A1V0SAK3	Catovirus	9.0e-138	46.4
WP_011680046.1\|547033_547933_+	DnaJ domain-containing protein	M1PC06	Moumouvirus	2.0e-13	55.2
WP_025268215.1\|547982_548561_-	peptide deformylase	A0A2I7S809	Vibrio_phage	1.0e-10	35.7

DBSCAN-SWA_40

556530 : 559174

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680039.1\|556530_557064_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	2.8e-31	38.1
WP_011680038.1\|557243_557762_-	hypothetical protein	NA	NA	NA	NA
WP_080675394.1\|558442_558643_+	hypothetical protein	NA	NA	NA	NA
WP_025268209.1\|558961_559174_-	hypothetical protein	A0A097BYI6	Leuconostoc_phage	4.4e-17	62.9

DBSCAN-SWA_41

569601 : 572712

Herpes_simplex_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061514975.1\|569601_572712_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	7.4e-310	51.2

DBSCAN-SWA_42

579023 : 580325

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680020.1\|579023_580325_+\|tRNA	histidine--tRNA ligase	A0A2K9L0H9	Tupanvirus	9.4e-25	25.5

DBSCAN-SWA_43

586316 : 591996

uncultured_Mediterranean_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268196.1\|586316_587585_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.3e-44	28.1
WP_011680015.1\|587721_587907_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_014324863.1\|587989_588436_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	4.7e-16	37.4
WP_011680014.1\|588524_589388_+	S1 RNA-binding protein	NA	NA	NA	NA
WP_025268195.1\|589384_590281_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	9.0e-43	34.7
WP_010293841.1\|590286_590661_+	hypothetical protein	NA	NA	NA	NA
WP_010293839.1\|590627_591404_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.7e-11	33.6
WP_014324860.1\|591396_591996_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.1e-15	40.2

DBSCAN-SWA_44

597758 : 601295

Geobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002814789.1\|597758_598034_+	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.6e-27	70.8
WP_025268192.1\|598353_598554_-	hypothetical protein	NA	NA	NA	NA
WP_025268191.1\|598722_599217_-	serine acetyltransferase	NA	NA	NA	NA
WP_025268190.1\|599230_600370_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_025268189.1\|600380_601295_-	cysteine synthase family protein	A0A1W6JIM2	Lactococcus_phage	1.4e-59	40.7

DBSCAN-SWA_45

608050 : 613266

Thermus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680000.1\|608050_608914_-	N-acetylmuramoyl-L-alanine amidase	C8CHK8	Thermus_virus	5.9e-07	38.8
WP_025268185.1\|609070_610327_+	acetate kinase	NA	NA	NA	NA
WP_025268184.1\|610356_611295_-	dihydroorotate oxidase	A0A1V0SH91	Hokovirus	2.1e-58	42.5
WP_025268183.1\|611388_613266_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	6.5e-59	32.2

DBSCAN-SWA_46

619720 : 630181

Caulobacter_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212042.1\|619720_621583_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.7e-46	31.6
WP_011679963.1\|621632_622931_+	RNA polymerase sigma factor RpoD	M4SMP8	Cyanophage	2.6e-38	34.5
WP_011679962.1\|623004_623562_+	QueT transporter family protein	NA	NA	NA	NA
WP_011679961.1\|623558_624296_+	3-oxoacyl-ACP reductase	A0A0N9R355	Chrysochromulina_ericina_virus	5.2e-12	26.5
WP_071952144.1\|624575_625481_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025268176.1\|625802_626999_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2I2L687	Orpheovirus	1.5e-16	26.5
WP_011679958.1\|627001_627838_+	basic amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_160212043.1\|627849_628509_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_014324836.1\|628501_629224_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.6e-36	39.9
WP_025268175.1\|629242_630181_+	2-hydroxyacid dehydrogenase	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	8.9e-25	29.8

DBSCAN-SWA_47

634598 : 640084

Leuconostoc_phage(50.0%)

integrase,holin,tRNA

attL 635993:636007|attR 643007:643021

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268171.1\|634598_635339_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.8e-13	27.8
WP_025268170.1\|635328_636615_+	ABC transporter permease	NA	NA	NA	NA
635993:636007	attL	NA	NA	NA	NA
WP_025268169.1\|636627_637287_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_081107455.1\|637335_637584_-\|integrase	tyrosine-type recombinase/integrase	Q4ZCC1	Staphylococcus_virus	3.9e-12	50.0
WP_011680273.1\|638276_638501_+	hypothetical protein	NA	NA	NA	NA
WP_160212044.1\|638504_639596_+	1,4-beta-N-acetylmuramidase	E3W8H6	Leuconostoc_phage	8.9e-186	88.2
WP_061514904.1\|639610_640084_+\|holin	holin	E3W8H7	Leuconostoc_phage	4.9e-40	74.5
643007:643021	attR	NA	NA	NA	NA

DBSCAN-SWA_48

646408 : 649909

Methanothermobacter_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038534133.1\|646408_647614_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	5.6e-40	31.3
WP_010292892.1\|647668_647938_+	hypothetical protein	NA	NA	NA	NA
WP_025268164.1\|648217_649909_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.6e-72	32.7

DBSCAN-SWA_49

653859 : 657117

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679936.1\|653859_654753_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	9.0e-27	32.3
WP_025268162.1\|654757_656035_+	dihydroorotase	NA	NA	NA	NA
WP_011679934.1\|656031_657117_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.4e-58	37.4

DBSCAN-SWA_50

661701 : 662340

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679930.1\|661701_662340_-	transcriptional repressor LexA	A0A1B1P7Q3	Bacillus_phage	3.4e-12	59.3

DBSCAN-SWA_51

673625 : 675479

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268153.1\|673625_675479_+	elongation factor 4	A0A2K9L2P9	Tupanvirus	7.6e-20	43.3

DBSCAN-SWA_52

679584 : 690874

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212046.1\|679584_681207_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	8.7e-44	25.9
WP_025268148.1\|681342_682500_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_011679915.1\|682527_683163_-	hypothetical protein	NA	NA	NA	NA
WP_011679914.1\|683429_683873_+	nucleoside 2-deoxyribosyltransferase	A0A1G5S9Z4	Enterococcus_phage	1.3e-21	40.1
WP_014324802.1\|684104_684377_+	ACT domain-containing protein	NA	NA	NA	NA
WP_002814654.1\|684430_685774_+	PFL family protein	NA	NA	NA	NA
WP_011679913.1\|685807_686248_-	hypothetical protein	NA	NA	NA	NA
WP_014324800.1\|686389_687292_+	tyrosine recombinase XerC	A0A1I9SC88	Mycobacterium_phage	3.6e-15	30.5
WP_011679911.1\|687356_688235_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_011679910.1\|688668_689856_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_025268147.1\|689848_690874_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.1e-55	36.3

DBSCAN-SWA_53

694351 : 694924

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679904.1\|694351_694924_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	5.4e-33	39.5

DBSCAN-SWA_54

700108 : 701287

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679899.1\|700108_701287_+	chorismate synthase	A0A291AU41	Pandoravirus	2.7e-31	31.2

DBSCAN-SWA_55

704848 : 705730

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268138.1\|704848_705730_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	6.0e-23	37.1

DBSCAN-SWA_56

714137 : 715508

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268134.1\|714137_715508_+	FAD-dependent oxidoreductase	A0A0B5JBT9	Pandoravirus	6.7e-21	29.9

DBSCAN-SWA_57

725814 : 787497

Staphylococcus_phage(20.0%)

protease,integrase,transposase

attL 772091:772150|attR 784553:784658

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049639980.1\|725814_726618_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160212049.1\|728486_729512_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.9e-39	33.7
WP_160212050.1\|731973_734103_-	hypothetical protein	NA	NA	NA	NA
WP_014324760.1\|734118_734508_-	hypothetical protein	NA	NA	NA	NA
WP_160212051.1\|734646_735294_-	type 1 glutamine amidotransferase-like domain-containing protein	NA	NA	NA	NA
WP_014324758.1\|735430_735949_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021210355.1\|736035_736551_+	2-deoxyribosyltransferase	K4I206	Lactobacillus_phage	7.0e-24	38.8
WP_106810520.1\|736629_737265_-	membrane protein	NA	NA	NA	NA
WP_106810519.1\|737397_737994_-	hypothetical protein	NA	NA	NA	NA
WP_036068461.1\|737996_738554_-	hypothetical protein	NA	NA	NA	NA
WP_160212052.1\|738556_738982_-	glutaredoxin	NA	NA	NA	NA
WP_160212053.1\|738994_740245_-	M23 family metallopeptidase	A0A191KBX1	Streptococcus_virus	1.7e-07	35.0
WP_004915944.1\|740248_740443_-	hypothetical protein	NA	NA	NA	NA
WP_160212054.1\|740444_742400_-	type IV secretion system protein VirB4	NA	NA	NA	NA
WP_160212055.1\|742402_743056_-	hypothetical protein	NA	NA	NA	NA
WP_004915939.1\|743055_743385_-	hypothetical protein	NA	NA	NA	NA
WP_160212056.1\|743753_744521_+	ParA family protein	Q7M293	Enterobacteria_phage	2.5e-09	27.1
WP_004901759.1\|744520_744802_+	hypothetical protein	NA	NA	NA	NA
WP_160212057.1\|744854_745370_-	hypothetical protein	NA	NA	NA	NA
WP_160212058.1\|745432_747544_-	hypothetical protein	NA	NA	NA	NA
WP_160212059.1\|747540_750561_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_160212060.1\|750547_752446_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A1S6UBG5	Serratia_phage	4.5e-60	31.1
WP_160212061.1\|752442_752925_-	hypothetical protein	NA	NA	NA	NA
WP_160212062.1\|752938_755206_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_048593017.1\|755192_755459_-	hypothetical protein	NA	NA	NA	NA
WP_048593016.1\|755915_756284_+	hypothetical protein	NA	NA	NA	NA
WP_048593015.1\|756287_756632_+	hypothetical protein	NA	NA	NA	NA
WP_048593014.1\|756642_757014_+	hypothetical protein	NA	NA	NA	NA
WP_160212063.1\|757000_757213_+	hypothetical protein	NA	NA	NA	NA
WP_160212131.1\|757569_757791_+	hypothetical protein	NA	NA	NA	NA
WP_061514929.1\|757790_758234_+	hypothetical protein	NA	NA	NA	NA
WP_080519433.1\|758226_758439_+	hypothetical protein	NA	NA	NA	NA
WP_105302106.1\|758449_758668_+	hypothetical protein	NA	NA	NA	NA
WP_080519432.1\|758888_759098_-	hypothetical protein	NA	NA	NA	NA
WP_014324732.1\|759115_759346_+	hypothetical protein	NA	NA	NA	NA
WP_072613644.1\|759326_759650_+	hypothetical protein	NA	NA	NA	NA
WP_078126274.1\|759662_759926_+	hypothetical protein	NA	NA	NA	NA
WP_150289221.1\|760101_761460_-	MFS transporter	NA	NA	NA	NA
WP_160212064.1\|761582_762068_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_160212065.1\|762111_764487_-	YhgE/Pip domain-containing protein	NA	NA	NA	NA
WP_004915909.1\|764814_765171_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_105302100.1\|765197_766142_-	NADP-dependent oxidoreductase	K7Z7U2	Megavirus	6.9e-09	25.1
WP_160212066.1\|766152_767496_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	8.8e-34	27.5
WP_105302098.1\|767482_767965_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_160212067.1\|768099_768261_+	hypothetical protein	NA	NA	NA	NA
WP_036067261.1\|768273_768537_+	hypothetical protein	NA	NA	NA	NA
WP_042252243.1\|768657_768978_-	hypothetical protein	NA	NA	NA	NA
WP_011679840.1\|768994_769249_-	hypothetical protein	NA	NA	NA	NA
WP_042252246.1\|769245_769614_-	hypothetical protein	E3W8I0	Leuconostoc_phage	3.6e-14	39.4
WP_160212068.1\|769606_770929_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	1.4e-84	39.5
772091:772150	attL	NA	NA	NA	NA
WP_160212069.1\|772291_773242_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_160212070.1\|773469_775221_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_160212071.1\|775277_776456_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.7e-25	26.5
WP_160212072.1\|776472_777408_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	5.3e-54	39.5
WP_160212073.1\|777482_779024_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	6.6e-110	45.9
WP_160212074.1\|779049_782022_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_160212075.1\|782133_783399_-	hypothetical protein	NA	NA	NA	NA
WP_160212076.1\|783573_783915_-	hypothetical protein	NA	NA	NA	NA
WP_160212077.1\|784547_785351_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.4e-31	36.4
784553:784658	attR	NA	NA	NA	NA
WP_011679759.1\|785396_785639_-\|transposase	transposase	Q6J1X3	Lactobacillus_phage	3.1e-06	36.1
WP_042253143.1\|785915_786518_-	hypothetical protein	NA	NA	NA	NA
WP_160212078.1\|786579_787497_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	7.8e-42	39.1

DBSCAN-SWA_58

793655 : 797573

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324716.1\|793655_795059_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.1e-31	27.7
WP_014324715.1\|795119_796472_+	fructotransferase	NA	NA	NA	NA
WP_049639984.1\|796595_797573_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.3e-22	28.0

DBSCAN-SWA_59

804031 : 805000

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212090.1\|804031_805000_-	replication initiator protein A	Q9MCM7	Streptococcus_virus	1.1e-17	46.9

DBSCAN-SWA_60

815991 : 816192

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268109.1\|815991_816192_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	1.7e-05	42.4

DBSCAN-SWA_61

819212 : 824290

Clostridioides_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268105.1\|819212_819437_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	1.2e-07	41.9
WP_025268104.1\|819541_820705_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.1e-28	28.8
WP_025268102.1\|821419_821890_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_025268101.1\|821873_822308_-	hypothetical protein	NA	NA	NA	NA
WP_051394927.1\|822844_824290_+	cardiolipin synthase	A0A223FML6	Murmansk_poxvirus	4.1e-05	27.4

DBSCAN-SWA_62

835537 : 837233

Leuconostoc_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324710.1\|835537_835918_-	hypothetical protein	E3W8I0	Leuconostoc_phage	4.9e-14	35.7
WP_025268088.1\|835910_837233_-	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	5.2e-87	39.9

DBSCAN-SWA_63

847383 : 849505

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268082.1\|847383_848247_-	SDR family NAD(P)-dependent oxidoreductase	A0A2P0VP75	Tetraselmis_virus	1.9e-05	26.0
WP_025268081.1\|848545_849505_+	D-2-hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	1.4e-30	31.3

DBSCAN-SWA_64

852896 : 855587

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268077.1\|852896_855587_-	HAD-IC family P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.1e-64	28.3

DBSCAN-SWA_65

862242 : 862914

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268071.1\|862242_862914_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.1e-40	38.2

DBSCAN-SWA_66

867243 : 867987

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268068.1\|867243_867987_-	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-13	23.5

DBSCAN-SWA_67

892354 : 902754

Prochlorococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268054.1\|892354_893782_-	NADP-dependent phosphogluconate dehydrogenase	E3SPS4	Prochlorococcus_phage	8.2e-30	29.8
WP_025268053.1\|893838_895173_-	gluconate permease	NA	NA	NA	NA
WP_025268052.1\|895200_895971_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.7e-13	29.7
WP_051394937.1\|896049_897255_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_025268050.1\|897268_897667_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_025268049.1\|897965_898472_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_025268048.1\|898591_899800_+	MFS transporter	A0A2K5B2B5	Erysipelothrix_phage	4.5e-13	22.9
WP_038534126.1\|899816_900587_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011679677.1\|900948_901455_-	ECF transporter S component	NA	NA	NA	NA
WP_025268045.1\|901520_902096_-	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_160212097.1\|902166_902754_-	ATP-binding cassette domain-containing protein	A0A1V0SJ29	Klosneuvirus	2.0e-06	25.0

DBSCAN-SWA_68

929704 : 930712

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268028.1\|929704_930712_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.8e-22	27.5

DBSCAN-SWA_69

939895 : 942148

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268023.1\|939895_942148_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.2e-130	32.9

DBSCAN-SWA_70

958406 : 959249

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268013.1\|958406_959249_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	3.7e-46	36.0

DBSCAN-SWA_71

962819 : 963689

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002827666.1\|962819_963689_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	3.2e-61	44.6

DBSCAN-SWA_72

989329 : 991182

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267994.1\|989329_990085_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-27	37.4
WP_025267993.1\|990186_991182_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.5e-06	26.4

DBSCAN-SWA_73

998495 : 1004887

Staphylococcus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267985.1\|998495_1001135_-	cation-translocating P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	1.5e-77	28.7
WP_011679599.1\|1001571_1002042_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-31	43.9
WP_014324575.1\|1002066_1003260_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.5e-90	44.9
WP_011679597.1\|1003262_1003853_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.4e-23	34.9
WP_150288605.1\|1003852_1004887_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2I2L4R9	Orpheovirus	2.6e-33	33.2

DBSCAN-SWA_74

1019586 : 1022772

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267977.1\|1019586_1020282_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-29	36.4
WP_025267976.1\|1020286_1021333_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_025267975.1\|1021359_1022772_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	4.9e-67	35.2

DBSCAN-SWA_75

1027723 : 1034261

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061514808.1\|1027723_1029055_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.1e-33	27.3
WP_014324559.1\|1029150_1029951_-	metal ABC transporter permease	NA	NA	NA	NA
WP_025267970.1\|1029943_1030630_-	ATP-binding cassette domain-containing protein	A0A1V0SBM3	Catovirus	4.4e-05	31.5
WP_061514807.1\|1030637_1031528_-	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_025267969.1\|1031763_1032213_-	transcriptional repressor	NA	NA	NA	NA
WP_011679578.1\|1032469_1033321_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	7.2e-50	42.0
WP_160212102.1\|1033298_1034261_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.6e-19	30.1

DBSCAN-SWA_76

1043742 : 1046844

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267960.1\|1043742_1044939_-	class I SAM-dependent methyltransferase	A0A2K9L0U7	Tupanvirus	7.5e-53	37.5
WP_014324547.1\|1045037_1045574_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_011679566.1\|1045611_1046844_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.4e-94	51.5

DBSCAN-SWA_77

1056348 : 1063660

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324541.1\|1056348_1057341_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	9.6e-46	45.8
WP_160212103.1\|1057444_1058641_-	ammonium transporter	NA	NA	NA	NA
WP_011679557.1\|1058804_1060226_-	pyruvate kinase	NA	NA	NA	NA
WP_160212104.1\|1060321_1063660_-	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	9.5e-138	29.5

DBSCAN-SWA_78

1068378 : 1071135

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267950.1\|1068378_1069752_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.8e-13	28.7
WP_025267949.1\|1069748_1070390_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_061514806.1\|1070373_1071135_-	ribonuclease HII	D2TEQ2	Emiliania_huxleyi_virus	5.5e-25	40.3

DBSCAN-SWA_79

1075545 : 1078099

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004164228.1\|1075545_1076400_-	DegV family protein	A0A0N9SI50	Staphylococcus_phage	2.4e-13	38.5
WP_025267946.1\|1076409_1076907_-	dihydrofolate reductase	A0A1I9S5V6	Bacillus_phage	4.4e-23	36.5
WP_011679543.1\|1076893_1078099_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	6.6e-49	33.9

DBSCAN-SWA_80

1081301 : 1088568

Ostreococcus_lucimarinus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267943.1\|1081301_1082927_-	2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.3e-09	20.0
WP_038534121.1\|1082904_1084059_-	isochorismate synthase	NA	NA	NA	NA
WP_014324521.1\|1084163_1084967_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_011679536.1\|1084966_1085470_-	hypothetical protein	NA	NA	NA	NA
WP_025267940.1\|1085570_1086458_+	YitT family protein	M1Q1P6	Streptococcus_phage	5.1e-46	33.5
WP_025267939.1\|1086483_1088568_-	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	7.3e-96	37.2

DBSCAN-SWA_81

1094270 : 1095680

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267935.1\|1094270_1095680_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.7e-43	29.3

DBSCAN-SWA_82

1104317 : 1105607

Turkeypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267932.1\|1104317_1105607_-	alkaline phosphatase family protein	A0A0M3PB47	Turkeypox_virus	1.5e-11	23.6

DBSCAN-SWA_83

1110632 : 1120844

Prochlorococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267928.1\|1110632_1112159_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-66	45.9
WP_025267927.1\|1112155_1112746_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-27	40.3
WP_025267926.1\|1112739_1113777_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3HPW9	Synechococcus_phage	1.8e-58	39.6
WP_160212105.1\|1113773_1115384_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.0e-46	31.3
WP_025267924.1\|1115362_1117579_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.7e-143	38.9
WP_011679512.1\|1117583_1118252_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_004164272.1\|1118248_1118518_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_038534119.1\|1118519_1119269_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	1.2e-35	35.5
WP_025267922.1\|1119252_1120362_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_025267921.1\|1120358_1120844_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.2e-22	45.6

DBSCAN-SWA_84

1125307 : 1129772

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267918.1\|1125307_1127989_-	DNA polymerase I	A0A142F1Q9	Bacillus_phage	1.2e-61	31.4
WP_025267917.1\|1128194_1129772_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	4.8e-39	29.0

DBSCAN-SWA_85

1135214 : 1135439

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004164295.1\|1135214_1135439_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-09	44.8

DBSCAN-SWA_86

1141544 : 1147261

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324485.1\|1141544_1142516_-	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	3.5e-40	35.1
WP_025267909.1\|1142565_1144953_-	ATP-dependent RecD-like DNA helicase	A0A1W6JK95	Lactococcus_phage	8.8e-45	26.9
WP_014324483.1\|1144952_1145606_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_010289985.1\|1145650_1145995_-	DUF1831 domain-containing protein	NA	NA	NA	NA
WP_014324482.1\|1146145_1147261_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	1.6e-44	35.8

DBSCAN-SWA_87

1150351 : 1154665

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267906.1\|1150351_1154665_-	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	1.3e-22	36.9

DBSCAN-SWA_88

1158590 : 1161293

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267903.1\|1158590_1159370_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.9e-21	46.0
WP_011679482.1\|1159487_1161293_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	1.1e-84	35.5

DBSCAN-SWA_89

1180915 : 1185768

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267894.1\|1180915_1182874_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.5e-103	33.0
WP_014324462.1\|1183401_1185768_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	6.2e-83	46.6

DBSCAN-SWA_90

1194322 : 1204364

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679457.1\|1194322_1194937_-	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	1.2e-22	34.3
WP_004164379.1\|1195089_1195317_-	CsbD family protein	NA	NA	NA	NA
WP_025267889.1\|1196527_1198072_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.1e-14	28.4
WP_025267888.1\|1198075_1199062_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	4.4e-06	39.3
WP_025267887.1\|1199104_1200247_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	7.7e-39	27.7
WP_011679453.1\|1200750_1200981_-	CsbD family protein	NA	NA	NA	NA
WP_025267885.1\|1201514_1202972_-	peptidoglycan endopeptidase	A0A1S5SEZ8	Streptococcus_phage	2.8e-09	43.5
WP_004164395.1\|1203173_1203359_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_011679451.1\|1203386_1204364_-	YitT family protein	M1Q1P6	Streptococcus_phage	8.4e-26	30.0

DBSCAN-SWA_91

1209890 : 1218058

Staphylococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324452.1\|1209890_1212317_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.5
WP_025267883.1\|1212657_1213311_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_025267882.1\|1213294_1213816_+	hypothetical protein	NA	NA	NA	NA
WP_111303349.1\|1213815_1214568_+	peptidylprolyl isomerase	A0A076FI46	Aureococcus_anophage	3.5e-16	34.6
WP_011679442.1\|1214604_1215045_-	universal stress protein	NA	NA	NA	NA
WP_025267880.1\|1215119_1215809_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_014324448.1\|1215818_1216553_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-31	37.8
WP_014324446.1\|1216870_1218058_-	elongation factor Tu	A0A1V0SGC3	Hokovirus	6.8e-30	27.9

DBSCAN-SWA_92

1223605 : 1237683

Organic_Lake_phycodnavirus(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679434.1\|1223605_1224268_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	8.8e-11	27.0
WP_014324441.1\|1224328_1225804_-	ABC transporter permease	NA	NA	NA	NA
WP_011679432.1\|1225975_1226359_+	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_004164424.1\|1226393_1227026_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	3.4e-44	45.0
WP_011679431.1\|1227266_1227857_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_025267877.1\|1227932_1228958_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	6.7e-26	33.1
WP_025267876.1\|1229160_1230222_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_014324437.1\|1230331_1231189_-	phosphoesterase	A0A076G7D9	Bacillus_phage	1.6e-20	32.8
WP_011679427.1\|1231185_1232241_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	8.5e-08	33.3
WP_014324436.1\|1232376_1232913_-	YfcE family phosphodiesterase	NA	NA	NA	NA
WP_025267875.1\|1232912_1233518_-	XTP/dITP diphosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	1.6e-11	32.4
WP_011679424.1\|1233514_1234390_-	glutamate racemase	NA	NA	NA	NA
WP_011679423.1\|1234438_1235152_+	YslB family protein	NA	NA	NA	NA
WP_004164446.1\|1235499_1235859_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_014324435.1\|1235982_1237683_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	4.8e-170	52.4

DBSCAN-SWA_93

1241801 : 1243744

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679416.1\|1241801_1242755_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	8.9e-81	48.4
WP_010285820.1\|1242868_1243744_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.3e-74	53.1

DBSCAN-SWA_94

1248395 : 1264586

Synechococcus_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679413.1\|1248395_1249166_-	phosphate ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	3.7e-13	26.0
WP_011679412.1\|1249162_1250005_-	phosphate ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.0e-11	28.4
WP_010291776.1\|1250012_1250897_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_011679411.1\|1250896_1251820_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_014324427.1\|1251872_1252754_-	phosphate ABC transporter substrate-binding protein PstS family protein	M1U9L0	Synechococcus_phage	1.7e-09	32.0
WP_025267871.1\|1252895_1254236_-	two-component sensor histidine kinase	A0A1V0SGX0	Hokovirus	6.1e-19	27.4
WP_025267870.1\|1254319_1255228_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	9.2e-11	28.2
WP_011679406.1\|1255467_1256160_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-36	34.5
WP_011679405.1\|1256242_1257400_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.1e-117	65.1
WP_010285285.1\|1257539_1258121_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_014324424.1\|1258131_1259007_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_014324423.1\|1259021_1260293_-	insulinase family protein	NA	NA	NA	NA
WP_011679402.1\|1260294_1261560_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.8e-47	30.8
WP_014324422.1\|1261556_1263011_-	cardiolipin synthase	NA	NA	NA	NA
WP_025267869.1\|1263093_1263948_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_061514794.1\|1263947_1264586_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-25	36.0

DBSCAN-SWA_95

1268726 : 1282301

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267867.1\|1268726_1270781_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.5e-122	41.3
WP_025267866.1\|1270859_1271552_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_025267865.1\|1271579_1272722_-	CamS family sex pheromone protein	NA	NA	NA	NA
WP_014324416.1\|1272721_1274764_-	NAD-dependent DNA ligase LigA	A0A1W6DX16	Sphingobium_phage	8.0e-87	31.6
WP_025267864.1\|1274772_1275261_-	kinase	NA	NA	NA	NA
WP_025267863.1\|1275257_1277507_-	DNA helicase PcrA	A7KV33	Bacillus_phage	1.4e-132	41.6
WP_011679390.1\|1277693_1278191_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025267862.1\|1278214_1278853_-	glycoside hydrolase family 73 protein	A0A0K2CP65	Brevibacillus_phage	4.6e-25	42.6
WP_025267861.1\|1278852_1280577_-	thiol reductant ABC exporter subunit CydC	A0A1V0SE00	Indivirus	1.3e-24	32.4
WP_025267860.1\|1280573_1282301_-	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.0e-18	24.4

DBSCAN-SWA_96

1286260 : 1290533

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324407.1\|1286260_1288942_-\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	5.1e-65	35.4
WP_025267859.1\|1289198_1290533_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.1e-23	26.5

DBSCAN-SWA_97

1295378 : 1296287

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679377.1\|1295378_1296287_-	decarboxylating 6-phosphogluconate dehydrogenase	A0A1D8KGX1	Synechococcus_phage	3.1e-51	35.8

DBSCAN-SWA_98

1301757 : 1303614

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212134.1\|1301757_1303614_-	acetyltransferase	C6ZR20	Salmonella_phage	4.9e-27	29.2

DBSCAN-SWA_99

1308525 : 1308774

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010284595.1\|1308525_1308774_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	9.2e-06	31.6

DBSCAN-SWA_100

1314715 : 1320623

Brevibacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004164550.1\|1314715_1315663_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	3.3e-27	38.5
WP_025267845.1\|1315670_1316960_-	helicase DnaB	NA	NA	NA	NA
WP_025267844.1\|1316946_1317567_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_014324389.1\|1317567_1318302_-	DUF975 family protein	NA	NA	NA	NA
WP_025267843.1\|1318303_1319137_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	3.7e-22	28.7
WP_025267842.1\|1319327_1320623_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.1e-28	29.2

DBSCAN-SWA_101

1329518 : 1331132

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324381.1\|1329518_1331132_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.4e-139	49.2

DBSCAN-SWA_102

1336548 : 1337895

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324376.1\|1336548_1337895_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	6.5e-29	33.2

DBSCAN-SWA_103

1346796 : 1350357

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267829.1\|1346796_1349331_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	2.8e-65	26.2
WP_025267828.1\|1349412_1350357_-	phosphoglycerate dehydrogenase	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.8e-26	29.5

DBSCAN-SWA_104

1368249 : 1369745

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324355.1\|1368249_1368963_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-15	26.8
WP_011679323.1\|1368959_1369745_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-12	25.5

DBSCAN-SWA_105

1373942 : 1376248

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212110.1\|1373942_1375100_-	peptidase	A0A223LDP1	Bacillus_phage	7.3e-21	25.3
WP_025267806.1\|1375096_1376248_-	ATP-binding protein	A0A141HRX4	Bacillus_phage	1.2e-26	31.5

DBSCAN-SWA_106

1381656 : 1382958

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061514773.1\|1381656_1382958_-	aminodeoxychorismate lyase	A0A0A7RUS8	Clostridium_phage	5.9e-19	39.3

DBSCAN-SWA_107

1388973 : 1391536

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004164635.1\|1388973_1389819_-	bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.3e-30	38.0
WP_014324339.1\|1389890_1390367_+	competence protein ComE	A7KUY9	Bacillus_phage	7.7e-33	50.8
WP_025267797.1\|1390567_1391536_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	6.2e-98	54.4

DBSCAN-SWA_108

1394906 : 1420537

Streptococcus_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679300.1\|1394906_1396493_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.0e-69	38.2
WP_025267794.1\|1396528_1397671_-	serine hydrolase	A0A0B5A438	Mycobacterium_phage	2.3e-06	30.7
WP_025267793.1\|1397694_1399023_-	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_036089955.1\|1399024_1400416_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A1X9I6F4	Streptococcus_phage	9.6e-92	41.8
WP_004164650.1\|1400455_1400722_-	type B 50S ribosomal protein L31	NA	NA	NA	NA
WP_011679296.1\|1400814_1402101_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_025267791.1\|1402181_1404638_-\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	1.2e-07	30.5
WP_025267790.1\|1404640_1405690_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.8e-27	38.0
WP_011679293.1\|1405993_1406362_-	HxlR family transcriptional regulator	NA	NA	NA	NA
WP_025267789.1\|1406381_1407311_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	8.2e-31	32.3
WP_025267788.1\|1407310_1407751_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	8.4e-26	40.4
WP_011679291.1\|1407767_1408157_-	cytidine deaminase	NA	NA	NA	NA
WP_025267786.1\|1408267_1410061_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	3.0e-53	27.3
WP_025267785.1\|1410118_1411141_-	competence protein	NA	NA	NA	NA
WP_011679289.1\|1411182_1412628_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_025267784.1\|1412694_1413447_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.4e-34	38.4
WP_011679287.1\|1413443_1414886_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_011679286.1\|1415143_1416199_-	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	7.6e-65	41.4
WP_160212111.1\|1416372_1417350_+	sugar transferase	NA	NA	NA	NA
WP_014324321.1\|1417420_1417867_-	hypothetical protein	NA	NA	NA	NA
WP_025267782.1\|1417873_1420537_-	calcium-translocating P-type ATPase, PMCA-type	M1HX51	Paramecium_bursaria_Chlorella_virus	3.6e-79	30.0

DBSCAN-SWA_109

1426948 : 1431264

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679278.1\|1426948_1428028_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-28	34.3
WP_004164688.1\|1428030_1428726_+	ABC transporter permease	NA	NA	NA	NA
WP_011679277.1\|1428759_1429458_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_160212112.1\|1429462_1430599_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
WP_004164692.1\|1430739_1431264_-	hypothetical protein	C1KFH5	Lactobacillus_virus	9.3e-32	54.2

DBSCAN-SWA_110

1435342 : 1441502

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267775.1\|1435342_1437433_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	4.3e-11	22.0
WP_014324309.1\|1437566_1437977_-	DUF3021 domain-containing protein	NA	NA	NA	NA
WP_014324308.1\|1437963_1438431_-	LytTR family transcriptional regulator	NA	NA	NA	NA
WP_011679269.1\|1438408_1439137_-	membrane protein	NA	NA	NA	NA
WP_014324306.1\|1439133_1439934_-	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	8.1e-11	28.4
WP_011679267.1\|1440053_1441502_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.7e-38	28.4

DBSCAN-SWA_111

1445099 : 1451639

Klosneuvirus(25.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267771.1\|1445099_1446587_-\|tRNA	lysine--tRNA ligase	A0A1V0SIS0	Klosneuvirus	8.7e-91	37.1
WP_061514762.1\|1446674_1447568_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_011679262.1\|1447676_1449779_-\|protease	ATP-dependent zinc metalloprotease FtsH	H8ZJI5	Ostreococcus_tauri_virus	1.8e-94	45.8
WP_010277907.1\|1449806_1450346_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	2.1e-07	26.0
WP_025267769.1\|1450346_1451639_-\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	1.0e-07	23.7

DBSCAN-SWA_112

1457394 : 1467250

Streptococcus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324297.1\|1457394_1457997_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.3e-48	52.8
WP_011679257.1\|1458084_1459029_-	DNA-binding protein WhiA	NA	NA	NA	NA
WP_011679256.1\|1459029_1459998_-	YvcK family protein	A1IMD5	Streptococcus_phage	6.2e-82	49.4
WP_025267767.1\|1460095_1462954_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.8e-286	53.2
WP_014324295.1\|1462985_1464995_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_025267766.1\|1465111_1467250_-	LTA synthase family protein	W6LM83	Streptococcus_phage	6.3e-135	43.3

DBSCAN-SWA_113

1471017 : 1474517

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267765.1\|1471017_1472799_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.6e-53	28.9
WP_025267764.1\|1472798_1474517_-	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	2.1e-16	29.6

DBSCAN-SWA_114

1483209 : 1489585

Planktothrix_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679239.1\|1483209_1484430_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.1e-78	42.4
WP_042250992.1\|1484580_1485816_-	MFS transporter	NA	NA	NA	NA
WP_011679237.1\|1485812_1486586_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-32	39.8
WP_014324281.1\|1486596_1487568_-	2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	4.4e-35	32.1
WP_014324280.1\|1487579_1488815_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_011679234.1\|1488847_1489585_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-33	40.0

DBSCAN-SWA_115

1495169 : 1496063

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679226.1\|1495169_1496063_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-18	28.8

DBSCAN-SWA_116

1499516 : 1500710

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679223.1\|1499516_1500710_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-29	37.1

DBSCAN-SWA_117

1505238 : 1510754

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679219.1\|1505238_1506324_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.9e-26	26.2
WP_004164761.1\|1506320_1507013_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.8e-38	38.0
WP_004164763.1\|1507049_1507748_-	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_011679218.1\|1507792_1508893_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_011679217.1\|1508894_1509104_-	DUF951 domain-containing protein	NA	NA	NA	NA
WP_025267746.1\|1509103_1510003_-	ParB/RepB/Spo0J family partition protein	S5VSZ7	Leptospira_phage	1.6e-15	31.0
WP_004164768.1\|1509992_1510754_-	ParA family protein	Q8JL10	Natrialba_phage	1.1e-22	31.3

DBSCAN-SWA_118

1524156 : 1526145

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679205.1\|1524156_1526145_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.1e-32	42.5

DBSCAN-SWA_119

1530816 : 1537927

Lactobacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267737.1\|1530816_1531935_-	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	1.4e-05	46.5
WP_025267736.1\|1532126_1532480_-	hydrolase	NA	NA	NA	NA
WP_025267735.1\|1532481_1533777_-	LysM peptidoglycan-binding domain-containing protein	V5UTJ0	Oenococcus_phage	1.5e-09	44.3
WP_025267734.1\|1534094_1535063_-	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_025267733.1\|1535242_1537927_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	1.8e-155	41.5

DBSCAN-SWA_120

1544679 : 1545411

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267729.1\|1544679_1545411_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.7e-07	40.8

DBSCAN-SWA_121

1554952 : 1563901

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267722.1\|1554952_1557061_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.4e-94	39.1
WP_025267721.1\|1557319_1557973_+	HD domain-containing protein	S4W232	Pandoravirus	2.9e-06	27.0
WP_025267720.1\|1558048_1558918_+	DNA-entry nuclease	NA	NA	NA	NA
WP_025267719.1\|1558964_1559975_-	NAD(P)/FAD-dependent oxidoreductase	Q9JRK7	Streptococcus_phage	5.8e-14	38.1
WP_025267718.1\|1560113_1561070_+	nucleoside hydrolase	NA	NA	NA	NA
WP_025267717.1\|1561149_1562391_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.3e-92	46.8
WP_002815906.1\|1562395_1563184_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.7e-43	38.7
WP_002815908.1\|1563253_1563901_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	2.4e-53	45.1

DBSCAN-SWA_122

1574029 : 1581199

Streptococcus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267711.1\|1574029_1575022_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.6e-53	37.4
WP_025267710.1\|1575050_1575782_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_011679172.1\|1575783_1576653_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	7.8e-76	53.7
WP_014324230.1\|1576654_1577557_-	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	4.9e-12	35.9
WP_002815926.1\|1577556_1577886_-	hypothetical protein	NA	NA	NA	NA
WP_025267709.1\|1577882_1578524_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.9e-50	48.4
WP_011679170.1\|1578554_1578815_-	YaaL family protein	NA	NA	NA	NA
WP_010280652.1\|1578811_1579417_-	recombination protein RecR	NA	NA	NA	NA
WP_051394924.1\|1579471_1581199_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	5.0e-58	45.5

DBSCAN-SWA_123

1595075 : 1599102

Enterococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010290839.1\|1595075_1596053_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.5e-115	63.9
WP_002815955.1\|1596055_1596496_-	ribonucleotide reductase	NA	NA	NA	NA
WP_038534115.1\|1596532_1598704_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.8e-231	57.1
WP_002815957.1\|1598871_1599102_-	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	4.4e-10	46.8

DBSCAN-SWA_124

1604793 : 1606727

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679154.1\|1604793_1606074_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	1.8e-68	40.3
WP_002815968.1\|1606091_1606727_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	6.8e-45	47.1

DBSCAN-SWA_125

1612204 : 1613530

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679148.1\|1612204_1613530_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.7e-167	70.9

DBSCAN-SWA_126

1619259 : 1620911

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679141.1\|1619259_1620117_-	energy-coupling factor transporter ATPase	A0A2R8FG22	Brazilian_cedratvirus	5.5e-13	26.9
WP_010282672.1\|1620092_1620911_-	energy-coupling factor transporter ATPase	G3M9Y6	Bacillus_virus	1.3e-19	30.2

DBSCAN-SWA_127

1639987 : 1649835

Mycoplasma_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267684.1\|1639987_1640809_-	ABC transporter permease	Q6GZ02	Mycoplasma_phage	4.0e-13	24.8
WP_050799357.1\|1640795_1641932_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	8.5e-38	42.5
WP_160212118.1\|1641982_1643176_-	MFS transporter	NA	NA	NA	NA
WP_011679127.1\|1643266_1645378_-	elongation factor G	E4ZFJ7	Streptococcus_phage	7.8e-61	27.6
WP_011679126.1\|1645538_1646009_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_004911305.1\|1646024_1646438_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_011679125.1\|1646690_1647350_+	type 4 prepilin peptidase 1	NA	NA	NA	NA
WP_025267683.1\|1647354_1649835_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A0A8J958	Klebsiella_phage	1.1e-119	38.0

DBSCAN-SWA_128

1653696 : 1655004

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212119.1\|1653696_1655004_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.2e-88	51.3

DBSCAN-SWA_129

1662407 : 1663814

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324200.1\|1662407_1663814_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	9.5e-47	29.3

DBSCAN-SWA_130

1669137 : 1669677

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679115.1\|1669137_1669677_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	J9PV85	Bacillus_phage	3.0e-41	50.3

DBSCAN-SWA_131

1674504 : 1735417

Erysipelothrix_phage(25.0%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679111.1\|1674504_1676655_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	6.4e-119	39.3
WP_011679110.1\|1676711_1676936_-	hypothetical protein	NA	NA	NA	NA
WP_011679109.1\|1677209_1678373_+	DUF998 domain-containing protein	NA	NA	NA	NA
WP_025267677.1\|1678444_1679935_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.6e-87	36.7
WP_014324188.1\|1679967_1682670_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_010290041.1\|1682896_1683673_-	(S)-acetoin forming diacetyl reductase	NA	NA	NA	NA
WP_011679106.1\|1683799_1684483_+	hypothetical protein	NA	NA	NA	NA
WP_061514754.1\|1684499_1685327_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_011679104.1\|1685365_1685923_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_014324186.1\|1686210_1686753_-	hypothetical protein	NA	NA	NA	NA
WP_011679102.1\|1686842_1688354_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	1.5e-13	32.6
WP_011679101.1\|1688472_1689255_-	amino acid ABC transporter ATP-binding protein	W5SAS9	Pithovirus	9.1e-15	27.7
WP_011679099.1\|1689971_1690694_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011679098.1\|1690717_1691578_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_025267675.1\|1691593_1692595_-	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_025267674.1\|1692587_1693619_-	uroporphyrinogen III decarboxylase	NA	NA	NA	NA
WP_025267673.1\|1694166_1695012_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_061514753.1\|1695322_1696834_-	xylulokinase	NA	NA	NA	NA
WP_050895129.1\|1696980_1698327_-	xylose isomerase	NA	NA	NA	NA
WP_025267671.1\|1698501_1699671_-	ROK family protein	NA	NA	NA	NA
WP_002815718.1\|1701473_1702112_-	hemolysin III	NA	NA	NA	NA
WP_011679091.1\|1702195_1703077_-	DegV family protein	NA	NA	NA	NA
WP_014324176.1\|1703120_1703459_-	CrcB family protein	NA	NA	NA	NA
WP_011679089.1\|1703455_1703854_-	CrcB family protein	NA	NA	NA	NA
WP_038534113.1\|1704002_1705130_-	N-methyl-L-tryptophan oxidase	NA	NA	NA	NA
WP_010284863.1\|1705165_1706029_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014324174.1\|1706076_1706853_-	acetoin reductase	NA	NA	NA	NA
WP_025267666.1\|1706903_1708235_-	APC family permease	NA	NA	NA	NA
WP_011679084.1\|1708236_1708983_-	cyclase family protein	NA	NA	NA	NA
WP_010291094.1\|1709378_1709693_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.8e-15	39.8
WP_014324172.1\|1709707_1710874_-	amidohydrolase	NA	NA	NA	NA
WP_011679082.1\|1710899_1711715_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_011679081.1\|1711749_1712502_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.9e-26	36.2
WP_010285713.1\|1712516_1713185_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011679080.1\|1713199_1713757_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025267665.1\|1713778_1715113_-	propanediol utilization protein	NA	NA	NA	NA
WP_011679077.1\|1717273_1717813_+	DUF1440 domain-containing protein	NA	NA	NA	NA
WP_025267664.1\|1717900_1719271_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-12	25.9
WP_010291478.1\|1719451_1719934_-	membrane protein	NA	NA	NA	NA
WP_025267663.1\|1720016_1721021_-	glycosyltransferase family 2 protein	U5P087	Shigella_phage	1.8e-44	35.9
WP_111303335.1\|1721041_1723144_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
WP_048592600.1\|1723353_1724082_-	hypothetical protein	NA	NA	NA	NA
WP_025267660.1\|1724088_1724979_-	XRE family transcriptional regulator	A0A2I4R674	Erysipelothrix_phage	1.9e-16	31.5
WP_025267659.1\|1725159_1726557_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.5e-57	31.6
WP_011679072.1\|1726752_1727319_-	pyridoxine transporter	NA	NA	NA	NA
WP_014324160.1\|1727302_1728106_-	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_061514751.1\|1728577_1729888_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_011679068.1\|1729893_1730619_+	response regulator transcription factor	A0A1V0E029	Clostridioides_phage	3.0e-12	23.0
WP_025267657.1\|1730891_1731104_-	hypothetical protein	NA	NA	NA	NA
WP_010287275.1\|1731542_1731719_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_010287277.1\|1731880_1732060_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_071951754.1\|1732074_1732212_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_025267656.1\|1732368_1732674_-	hypothetical protein	NA	NA	NA	NA
WP_010287029.1\|1732670_1732832_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_010287032.1\|1732862_1733039_-\|bacteriocin	class IIb bacteriocin, lactobin A/cerein 7B family	NA	NA	NA	NA
WP_038534111.1\|1733269_1735417_+	peptide cleavage/export ABC transporter	F2Y352	Organic_Lake_phycodnavirus	2.9e-23	30.9

DBSCAN-SWA_132

1745485 : 1747042

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011679055.1\|1745485_1747042_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.6e-21	32.5

DBSCAN-SWA_133

1758594 : 1773308

Staphylococcus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014324139.1\|1758594_1759713_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	A0A1V0SKB7	Klosneuvirus	4.2e-13	26.5
WP_011679046.1\|1760205_1761066_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.0e-47	38.2
WP_011679045.1\|1761117_1761885_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_011679044.1\|1761888_1762794_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-42	42.9
WP_025267643.1\|1762819_1763653_-	hypothetical protein	NA	NA	NA	NA
WP_014324137.1\|1763649_1764555_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-20	31.2
WP_010289471.1\|1764551_1764917_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011679041.1\|1765118_1765544_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
WP_025267642.1\|1765540_1767592_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.1e-59	31.1
WP_025267641.1\|1767684_1768437_+	glycerol transporter	A0A1V0SCL5	Indivirus	5.7e-06	40.7
WP_025267640.1\|1768510_1769404_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_025267639.1\|1769486_1769927_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_014324133.1\|1769994_1771056_-	glycosyltransferase	NA	NA	NA	NA
WP_014324132.1\|1771109_1773308_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.8e-164	47.4

DBSCAN-SWA_134

1784820 : 1786005

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025267636.1\|1784820_1786005_-	pyridoxal phosphate-dependent aminotransferase	A0A1X7QHI1	Faustovirus	4.0e-06	26.3

DBSCAN-SWA_135

1797115 : 1805318

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002816095.1\|1797115_1797589_-	glutathione peroxidase	A0A1S7DM81	Molluscum_contagiosum_virus	1.2e-06	30.2
WP_025267628.1\|1797734_1800281_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.1e-109	36.7
WP_011679026.1\|1800356_1802375_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.7e-143	46.3
WP_025267627.1\|1802436_1803561_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_011679024.1\|1803542_1803989_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_025267626.1\|1804181_1805318_-	DNA polymerase III subunit beta	A0A0A8IL17	Aurantimonas_phage	4.5e-31	27.6

DBSCAN-SWA_136

1820418 : 1821246

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268593.1\|1820418_1821246_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	6.9e-05	49.1

DBSCAN-SWA_137

1826521 : 1835625

Planktothrix_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002815509.1\|1826521_1827211_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-31	37.3
WP_014325263.1\|1827197_1828379_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_025268590.1\|1828414_1829869_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_025268589.1\|1829997_1830891_+	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	3.6e-07	28.7
WP_011680558.1\|1830973_1831237_-	PspC domain-containing protein	NA	NA	NA	NA
WP_025268588.1\|1831292_1832627_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_010293234.1\|1832613_1832964_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011680557.1\|1833357_1834605_+\|tRNA	tyrosine--tRNA ligase	A0A2C9CX69	Yersinia_phage	4.0e-73	38.8
WP_011680556.1\|1834635_1835625_+	D-2-hydroxyacid dehydrogenase	Q89388	Paramecium_bursaria_Chlorella_virus	7.2e-33	30.3

DBSCAN-SWA_138

1840110 : 1843310

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268586.1\|1840110_1840911_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	3.2e-07	25.8
WP_025268585.1\|1840912_1842097_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_014325255.1\|1842083_1843310_+	cysteine desulfurase	Q2XUY6	environmental_halophage	9.9e-109	45.5

DBSCAN-SWA_139

1856484 : 1866236

Staphylococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268575.1\|1856484_1857924_+	o-succinylbenzoate--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.2e-59	31.4
WP_025268574.1\|1857920_1858631_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	A0A1X9I6N4	Streptococcus_phage	9.1e-06	32.4
WP_010285772.1\|1858735_1859617_-	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_002815572.1\|1859613_1860054_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_025268573.1\|1860149_1861046_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.6e-07	24.6
WP_002815576.1\|1861092_1862553_-	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	3.2e-61	30.7
WP_011680533.1\|1862968_1864201_+	MFS transporter	NA	NA	NA	NA
WP_014325241.1\|1864202_1864715_-	hypothetical protein	NA	NA	NA	NA
WP_014325240.1\|1865258_1866236_+	aldo/keto reductase	A0A2I2L334	Orpheovirus	4.6e-08	24.7

DBSCAN-SWA_140

1895330 : 1908507

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268554.1\|1895330_1897139_+	DNA helicase RecQ	A0A2K9L3P7	Tupanvirus	1.1e-74	35.2
WP_002815488.1\|1897473_1898352_+	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_002815489.1\|1898377_1898941_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_011680506.1\|1898972_1900649_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.8e-13	30.3
WP_011680505.1\|1900650_1901478_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_025268553.1\|1901474_1902905_+	dipeptidase PepV	NA	NA	NA	NA
WP_011680503.1\|1903162_1903459_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_002815494.1\|1903492_1904059_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	4.2e-38	69.6
WP_004911134.1\|1904091_1904376_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_014325206.1\|1904545_1906573_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_011680501.1\|1906589_1907042_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_002815498.1\|1907043_1908507_+	replicative DNA helicase	I6S783	Marinomonas_phage	7.8e-68	36.2

DBSCAN-SWA_141

1913526 : 1916349

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212127.1\|1913526_1914318_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.4e-15	27.6
WP_025268549.1\|1914636_1916349_+	biosynthetic-type acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	3.1e-52	29.3

DBSCAN-SWA_142

1922090 : 1929162

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680491.1\|1922090_1923071_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	1.5e-46	35.2
WP_010281559.1\|1923179_1923887_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-39	38.6
WP_025268546.1\|1923954_1925820_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.2e-33	33.1
WP_025268545.1\|1925809_1927102_+	hypothetical protein	NA	NA	NA	NA
WP_160212128.1\|1927158_1927962_+	hypothetical protein	NA	NA	NA	NA
WP_160212129.1\|1928022_1929162_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-21	30.1

DBSCAN-SWA_143

1937578 : 1942064

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268540.1\|1937578_1939360_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.1e-51	30.0
WP_011680480.1\|1939343_1941143_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.3e-20	29.8
WP_002815685.1\|1941326_1942064_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-36	41.3

DBSCAN-SWA_144

1948373 : 1952359

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268538.1\|1948373_1949423_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-15	29.8
WP_025268537.1\|1949425_1950361_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.2e-10	34.1
WP_025268536.1\|1950466_1952359_+	endopeptidase	E3T4I7	Cafeteria_roenbergensis_virus	1.1e-74	30.2

DBSCAN-SWA_145

1962647 : 1964204

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011680464.1\|1962647_1964204_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.6e-42	26.4

DBSCAN-SWA_146

1968768 : 1969344

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025268526.1\|1968768_1969344_-	DUF4352 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	3.2e-17	46.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028257

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028257_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028257_1

25955-26057

Orphan

Consensus_repeat	Method
GTGTGATTTTCACATTTCCGCTTGTATCAACATTTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028257_1

>merge|NZ_CP028257|1|25955-26057|CRISPRCasFinder
GTGTGATTTTCACATTTCCGCTTGTATCAACATTTTCAGAACTTGTATTCGTTGCCGTTTCTGGAAGTGTGATTTTCACATTTCCGCTTGTATCAACGTTTTC

>NZ_CP028257|1|1|25955-26057|CRISPRCasFinder
GTGTGATTTTCACATTTCCGCTTGTATCAACATTTTC	AGAACTTGTATTCGTTGCCGTTTCTGGAA
GTGTGATTTTCACATTTCCGCTTGTATCAACGTTTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028257.1\|WP_129870400.1\|19121_19775_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|273346
NZ_CP028257.1\|WP_129870385.1\|24154_24421_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_129870398.1\|19755_20106_-\|conjugal-transfer-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_160212142.1\|21145_21466_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_129870414.1\|27591_28383_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP028257.1\|WP_129870396.1\|20138_20483_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|374896
NZ_CP028257.1\|WP_129870387.1\|23848_24133_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_129870383.1\|25103_25289_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_129870377.1\|27328_27532_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_160212145.1\|24423_25104_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226648
NZ_CP028257.1\|WP_129870393.1\|20489_21113_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028257.1\|WP_160212143.1\|21548_23576_-\|MobA/MobL-family-protein	unknown	unknown	gnl\|CDD\|367473

>NZ_CP028257.1|WP_129870383.1|25103_25289_-|hypothetical-protein
MNKQNIFEKLFLEAEKTNLQVLMDNALNEKDPDKKKVLHAIYTYALDKKQDELLKNKKFVI
>NZ_CP028257.1|WP_160212145.1|24423_25104_-|AAA-family-ATPase
MMEKLKYVIIAGINGAGKSTLYRLQPELFHSTERINADEILQKMGGDWRKEIDNFRAMREEVKQLHDALNNFKSIHVETTLAGSGKAQLNLIDEAHKNGFEVTLLYVTVNSAEMAINRVKERVKNGGHGIPPETIKKRYSQSYNNLPAVAFKSDNVFIYDNSKRFINVYTRKNDQVEINNLKQYPWINQGVTFSKKVQNQLDKFAENNPTVTENLNKTIEKDNPKI
>NZ_CP028257.1|WP_129870385.1|24154_24421_+|hypothetical-protein
MSKKLNQLVSSKEILQKKIDQEEFTLRQSKYFENSKARKERTRLLIQKGALLDKYFETESLSVDDTENLLKIFSNYVNSNKPDKYKKG
>NZ_CP028257.1|WP_129870387.1|23848_24133_+|hypothetical-protein
MALSNLEKQQEKLNKLNEKIKNEKEKIDKKLGHEIIKLSNFDYSNLDQGKIKDISKKIADFFNSSIVSDNEKNFTNKDDSNSPENVSDKNNGIS
>NZ_CP028257.1|WP_160212143.1|21548_23576_-|MobA/MobL-family-protein
MAIFHMNFTNISAGNGRSAIASASYRSGEKLHSEMEGKNYFYARDVMPETFILLPENAPDWVKDREKLWNEVEKKDRFSHSRYAKEFNVALPVELNEEEQKKLLKDYVQKNFVDSGMVADVSIHRDHPENPHAHVMLTNRPFNEDGTWGIKSKKEYILDENGNKTYTKSGYARNRKIWLTDWDRKGKVEQWRKEWAKSVNHIFEQKNMPDRISEKTLDEQGIDGVATQHVGVNGQRPEREKFNQLALENRKHKAQLKNVDEKIHNERRMQTLQNHLSFSEKRSVSQLSKELQTFVSLENLDDKKRMLFNWKNSLLIKQAVGEDISKQMFTINQQEQSLEKANDLLDKVVDRTINSIYPDVDIEQTTIAERRELIKETDSEKTIFTGQELKDRLAMIRTDILNKEILSFTKRPYVSWLVLEHQEERTKNNMTEILSQKGYKFADIERSKGSIIRNFSDEEQDILKRGIKDLQATNEIKNVVQIQYAGVLKKTFPDMDIDNVTMVDREKIYTAIVYFNPELKQLSKQEFNELKDNPPIKFSTREHQQGLAYLSGTIKLDDIKNPNLIRVLANEGTKQLFIGESSQDPNITKEQIEQVKQVMTQNNGAYEDYRKANISDYQSVNYRETTPAEYLNNVFSSVIMKLLYVDEARRKKGLKETEWEMEKKKRQHEKHGRQM
>NZ_CP028257.1|WP_160212142.1|21145_21466_-|hypothetical-protein
MAENQEWYSLTKASEKLGYGRTYVSVWLRRHKDDFPSSMLMESGNSKMISEQGIKWIKENIKKAGVLVSNSSANEDKYLILRVLGKALNIHFTGWARGRLGNLLTP
>NZ_CP028257.1|WP_129870393.1|20489_21113_-|hypothetical-protein
MKKESWQGIKGSLVYEDDKAIIVDEADDIKDTEKLSKQLAEKGQPIKEARYQLLKNSIKKNIKTDPLKLSSWFNRKYDSDNAKKTEKLESNKPTRQYKQIKNELKFFGESFLEGFLGFYGLEVDNALARYENNLQIIETQDLGLSNEKKYYLGQSKKGELKIATSELPSQQIAKEELNKFYSRQQEQVQQQGNSIKSPDEDTDNGKE
>NZ_CP028257.1|WP_129870396.1|20138_20483_-|conjugal-transfer-protein
MKVLNKTKITSILASVSTAGYLMLTNAQIVLAADGGEVQSKITNAANTIKGILTGIVVLVGVCVALFIIIKRLPDADDPREKSEVYKAVGRVAGLVALAAAIVWILPWVYSLFT
>NZ_CP028257.1|WP_129870398.1|19755_20106_-|conjugal-transfer-protein
MKKGKEFIFPENVDKDYGIWKDYTLKDFGYGILTLLIGLIFIAIPPYGFILVLVKIVIVVLAMTVVMAILTVRPISSRKNIKVRDNLRLKQKYTHSQKLYYLKPQKRDEPNEIEKY
>NZ_CP028257.1|WP_129870400.1|19121_19775_-|conjugal-transfer-protein
MKLKNTKAKKSQLEWDYEPPKVNGGKQTIDDMSLVAGMYENYEVTKTGNLVGILDVSGINLDLLNDNEQQDVFSDYGAFLMSTLGEGVDDSLQFIEPTIPVNMTEWLNGLKRKYLDLKNNHPEEEFKIQLIASYLDHFTTVQNSKNMTTKQHLLIVKVSIKDKTMESLDLAVNNLDEKINQVKRDLENALTDFDLTAKVLSSQEVQEILKNLINFKG
>NZ_CP028257.1|WP_129870377.1|27328_27532_-|hypothetical-protein
MAFEDKMDQLKTSMNSKPVTNETTAPRISKSYTLKQDIANELARRAKEKELTASRYLEQLLKKEFNL
>NZ_CP028257.1|WP_129870414.1|27591_28383_-|ParA-family-protein
MKIITFSAIKGGVGKTTLTFNYGEWLSSKGYNVLLIDSDHQCSLTQTYDIYKDHGTLANIFTKDSEKVEIIELHENLSIIPASMKLDTINNDLQTRANKELLMYMWFSDNYDELKKFDYVLIDTHPDFSTITQNMIVISDFVFSPIEPSEYGFISKSNLELRMEQLKQDVINVESRQSFVTAELKFIGNRIKHNTKSSHEFVEQMEKDTRTIALIPEREIFNKTTLNHEPLINMEKENNSTQKAREFFDNIDNIFDTFTNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP028257	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence	25992-26020	0	1.0
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP035749	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence	1513-1541	0	1.0
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016938	Yersinia enterocolitica strain YE6 plasmid unnamed1, complete sequence	61410-61438	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016934	Yersinia enterocolitica strain YE7 plasmid unnamed1, complete sequence	8689-8717	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016941	Yersinia enterocolitica strain YE5 plasmid unnamed2, complete sequence	21621-21649	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016932	Yersinia enterocolitica strain YE165 plasmid unnamed1, complete sequence	15146-15174	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016932	Yersinia enterocolitica strain YE165 plasmid unnamed1, complete sequence	125277-125305	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	CP016947	Yersinia enterocolitica strain YE1 plasmid unnamed2, complete sequence	73663-73691	7	0.759
NZ_CP028257_1	1.1\|25992\|29\|NZ_CP028257\|CRISPRCasFinder	25992-26020	29	NZ_CP016942	Yersinia enterocolitica strain YE3 plasmid unnamed1, complete sequence	9705-9733	7	0.759

1. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP028257 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
agaacttgtattcgttgccgtttctggaa	Protospacer
*****************************

2. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP035749 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
agaacttgtattcgttgccgtttctggaa	Protospacer
*****************************

3. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016938 (Yersinia enterocolitica strain YE6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

4. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016934 (Yersinia enterocolitica strain YE7 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

5. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016941 (Yersinia enterocolitica strain YE5 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

6. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016932 (Yersinia enterocolitica strain YE165 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

7. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016932 (Yersinia enterocolitica strain YE165 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

8. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to CP016947 (Yersinia enterocolitica strain YE1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

9. spacer 1.1|25992|29|NZ_CP028257|CRISPRCasFinder matches to NZ_CP016942 (Yersinia enterocolitica strain YE3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agaacttgtattcgttgccgtttctggaa	CRISPR spacer
gcaacttgtatttgttgccgtctctttga	Protospacer
. **********.********.***  .*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 10268

uncultured_virus(20.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013102081.1\|457_838_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_012304815.1\|962_1283_-	thiol reductase thioredoxin	A0A218MMB7	uncultured_virus	3.5e-05	30.1
WP_012304814.1\|1322_1979_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_012304813.1\|2125_3463_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	5.7e-25	25.5
WP_012304812.1\|3639_4299_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_012304811.1\|4308_5238_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.8e-79	48.1
WP_012304810.1\|5245_5572_-	thioredoxin family protein	NA	NA	NA	NA
WP_013102092.1\|5596_5908_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	6.1e-15	35.7
WP_160212136.1\|6180_6318_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_129870412.1\|6444_6747_-	hypothetical protein	NA	NA	NA	NA
WP_160212137.1\|6842_7982_-	DUF3990 domain-containing protein	NA	NA	NA	NA
WP_129870410.1\|8099_10268_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	7.1e-118	48.8

DBSCAN-SWA_2

14520 : 15675

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160212140.1\|14520_15675_-	CHAP domain-containing protein	Q4Z9E1	Staphylococcus_phage	4.6e-15	34.1

DBSCAN-SWA_3

25442 : 28383

Streptococcus_pyogenes_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_129870381.1\|25442_26480_-	replication initiator protein A	A0A097PBE7	Streptococcus_pyogenes_phage	8.9e-18	44.3
WP_129870377.1\|27328_27532_-	hypothetical protein	NA	NA	NA	NA
WP_129870414.1\|27591_28383_-	ParA family protein	E2ELL2	Clostridium_phage	9.5e-20	29.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028255

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028257

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection