CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP028337	Lactobacillus plantarum strain SRCM101167 plasmid unnamed3, complete sequence	0 crisprs	NA	0	1
NZ_CP028335	Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP028336	Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence	0 crisprs	NA	0	1
NZ_CP028334	Lactobacillus plantarum strain SRCM101167 chromosome, complete genome	1 crisprs	cas3,DinG,csa3,csn2,cas2,cas1,cas9,WYL,DEDDh	2	224
NZ_CP028338	Lactobacillus plantarum strain SRCM101167 plasmid unnamed4, complete sequence	0 crisprs	NA	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7936 : 14778

Enterococcus_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085764182.1\|7936_10105_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	6.2e-255	60.2
WP_021729931.1\|10211_11138_+	ribonucleoside-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	1.9e-35	31.4
WP_020923860.1\|11152_12103_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	9.4e-99	54.6
WP_160248622.1\|12230_13043_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	3.0e-13	32.7
WP_016526668.1\|13156_13789_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2
WP_021356783.1\|13875_14778_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.1e-51	40.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028338

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5501

Bacillus_phage(100.0%)

integrase

attL 130:143|attR 9740:9753

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
130:143	attL	NA	NA	NA	NA
WP_020923865.1\|1145_1409_+	hypothetical protein	NA	NA	NA	NA
WP_016511518.1\|1444_1912_+	hypothetical protein	NA	NA	NA	NA
WP_020923867.1\|2134_2311_-	hypothetical protein	NA	NA	NA	NA
WP_068226441.1\|2270_3440_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_001748276.1\|4234_4504_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001748275.1\|4490_4862_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_063207285.1\|4913_5501_-\|integrase	site-specific integrase	A0A0S2GLG4	Bacillus_phage	3.2e-20	34.8
9740:9753	attR	NA	NA	NA	NA

DBSCAN-SWA_2

9315 : 14327

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248635.1\|9315_12315_-	DEAD/DEAH box helicase family protein	A0A2K5B2C2	Erysipelothrix_phage	1.2e-232	46.3
WP_160248637.1\|12323_14327_-	site-specific DNA-methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	2.5e-101	35.5

DBSCAN-SWA_3

17417 : 18005

Bacillus_phage(100.0%)

integrase

attL 9275:9298|attR 18807:18830

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
9275:9298	attL	NA	NA	NA	NA
WP_160248643.1\|17417_18005_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	6.3e-21	33.7
WP_160248643.1\|17417_18005_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	6.3e-21	33.7
18807:18830	attR	NA	NA	NA	NA

DBSCAN-SWA_4

23886 : 24339

Bacillus_phage(100.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248648.1\|23886_24339_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.1e-15	34.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP028336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3679 : 13026

Enterobacteria_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021730698.1\|3679_4486_-	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	3.9e-21	30.1
WP_160248550.1\|4845_5775_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	2.3e-25	34.8
WP_021731007.1\|5835_6672_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.2e-33	36.4
WP_027822971.1\|6704_7733_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.0e-71	45.1
WP_160248552.1\|7742_8324_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.8e-37	45.3
WP_021730701.1\|8327_9197_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.7e-99	59.7
WP_160248553.1\|9331_10507_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.1e-27	29.2
WP_160248555.1\|10594_10954_+	hypothetical protein	NA	NA	NA	NA
WP_015639693.1\|11183_11462_-	hypothetical protein	NA	NA	NA	NA
WP_160248557.1\|12240_13026_+	ParA family protein	A0A1X9I765	Streptococcus_phage	1.0e-37	37.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP028334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028334_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028334_1

1119364-1119795

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder

6 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP028334_1

>merge|NZ_CP028334|1|1119364-1119795|CRT,PILER-CR,CRISPRCasFinder
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTAAATAGGTTGTAAACGTTCAGGTCTGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTAATACGATCCATTGACTCCGCTAGTGACAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTATTCTCGTTTATCGCTTTTAGACGTGTTAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTTGGAGTTTGTGCCTTAACTTCTTCAAGGTTCTAAACCTGTTTGATATGACTACTATTCAAGACACGTCGGCAAACTGTTCCAATCCTTGACATGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028334|1|1|1119364-1119795|CRT
CGTGAAACTGTTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTTGGAGTTTGTGCCTTAACTTCTTCAAG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028334|1|1|1119430-1119795|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTTGGAGTTTGTGCCTTAACTTCTTCAAG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>NZ_CP028334|1|1|1119430-1119795|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTAAATAGGTTGTAAACGTTCAGGTCTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TAATACGATCCATTGACTCCGCTAGTGACA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TATTCTCGTTTATCGCTTTTAGACGTGTTA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CGTTGGAGTTTGTGCCTTAACTTCTTCAAG
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	ACGTCGGCAAACTGTTCCAATCCTTGACAT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028334.1\|WP_003641722.1\|1133364_1134105_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
NZ_CP028334.1\|WP_003646319.1\|1115517_1116276_-\|nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
NZ_CP028334.1\|WP_003646323.1\|1112914_1113370_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
NZ_CP028334.1\|WP_015379642.1\|1116560_1119299_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
NZ_CP028334.1\|WP_003641725.1\|1127854_1129219_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
NZ_CP028334.1\|WP_011100893.1\|1126240_1127023_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP028334.1\|WP_015379641.1\|1119819_1120497_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
NZ_CP028334.1\|WP_021357176.1\|1129451_1129922_+\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|240033
NZ_CP028334.1\|WP_160248236.1\|1121875_1125952_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
NZ_CP028334.1\|WP_003646328.1\|1106872_1107721_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381297
NZ_CP028334.1\|WP_003643663.1\|1111102_1112335_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP028334.1\|WP_003646321.1\|1114025_1114499_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP028334.1\|WP_015379640.1\|1120493_1120799_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
NZ_CP028334.1\|WP_160248234.1\|1110742_1111078_-\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP028334.1\|WP_003641733.1\|1113457_1113880_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP028334.1\|WP_003646320.1\|1114612_1115215_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP028334.1\|WP_015379639.1\|1120776_1121682_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP028334.1\|WP_021357178.1\|1127047_1127755_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028334.1\|WP_003641730.1\|1115280_1115475_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP028334.1\|WP_015379635.1\|1131528_1133121_-\|DNA-binding-protein-with-HIRAN-domain	unknown	unknown	gnl\|CDD\|214906

Protein	Function_ID	Function_description	E-value
NZ_CP028334.1\|WP_003641722.1\|1133364_1134105_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
NZ_CP028334.1\|WP_003646319.1\|1115517_1116276_-\|nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.37287e-90
NZ_CP028334.1\|WP_003646323.1\|1112914_1113370_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.07627e-26
NZ_CP028334.1\|WP_015379642.1\|1116560_1119299_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP028334.1\|WP_003641725.1\|1127854_1129219_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
NZ_CP028334.1\|WP_011100893.1\|1126240_1127023_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	8.96404e-26
NZ_CP028334.1\|WP_015379641.1\|1119819_1120497_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	4.14563e-81
NZ_CP028334.1\|WP_021357176.1\|1129451_1129922_+\|NUDIX-hydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.14377e-57
NZ_CP028334.1\|WP_160248236.1\|1121875_1125952_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	6.4441e-126
NZ_CP028334.1\|WP_003646328.1\|1106872_1107721_-\|aldo/keto-reductase	gnl\|CDD\|381297	cd19071, AKR_AKR1-5-like, AKR1/2/3/4/5 family of aldo-keto reductase (AKR) and similar proteins. Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. The family includes AKR1A/B/C/D/E/G/I, AKR2A/B/C/D/E, AKR3A/B/C/D/E/G, AKR4A/B/C, AKR5A/B/C/D/E/F/G/H, and similar proteins.	1.89369e-121
NZ_CP028334.1\|WP_003643663.1\|1111102_1112335_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
NZ_CP028334.1\|WP_003646321.1\|1114025_1114499_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
NZ_CP028334.1\|WP_015379640.1\|1120493_1120799_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
NZ_CP028334.1\|WP_160248234.1\|1110742_1111078_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.43936e-13
NZ_CP028334.1\|WP_003641733.1\|1113457_1113880_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.47416e-43
NZ_CP028334.1\|WP_003646320.1\|1114612_1115215_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	3.18179e-31
NZ_CP028334.1\|WP_015379639.1\|1120776_1121682_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.7681e-88
NZ_CP028334.1\|WP_003641730.1\|1115280_1115475_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
NZ_CP028334.1\|WP_015379635.1\|1131528_1133121_-\|DNA-binding-protein-with-HIRAN-domain	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.41904e-17

>NZ_CP028334.1|WP_015379642.1|1116560_1119299_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAIEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYDYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKSIRFRWMGKDGVID
>NZ_CP028334.1|WP_003646319.1|1115517_1116276_-|nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>NZ_CP028334.1|WP_003641730.1|1115280_1115475_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>NZ_CP028334.1|WP_003646320.1|1114612_1115215_+|NAD(P)H-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSTIHYQFLDLANYQLPLFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGMVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHALHQALTEITYYTTVLTTTPFPTD
>NZ_CP028334.1|WP_003646321.1|1114025_1114499_-|winged-helix-turn-helix-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>NZ_CP028334.1|WP_003641733.1|1113457_1113880_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSANDGQIEIQ
>NZ_CP028334.1|WP_003646323.1|1112914_1113370_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNHRS
>NZ_CP028334.1|WP_003643663.1|1111102_1112335_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>NZ_CP028334.1|WP_160248234.1|1110742_1111078_-|winged-helix-turn-helix-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATLK
>NZ_CP028334.1|WP_003646328.1|1106872_1107721_-|aldo/keto-reductase
MTVLTTMYQLANGVNIPKVAFGTWQIPGGEATYQAVRAALAAGYRHIDTALAYQNEASVGQAIRDSGIPREQIFVTTKLPAETKSYQGALNDFDRSLKNLGLDYVDLYLVHAPWPWGQVGRVYDEANLDVWQAMEAIYQSGRAKAIGVSNFAVRDLKNILNQATIPPMVNQIQYYLGFTEPKITKFSEEHAMLVEAYSPLATGGVLDNPQVQAYADKYGVSVAQLALRFVLQNGVLPLPKAVNPAHIEANTQLDFAISVADMQALNDLPDAAGSYMHNPTQG
>NZ_CP028334.1|WP_015379641.1|1119819_1120497_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>NZ_CP028334.1|WP_015379640.1|1120493_1120799_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>NZ_CP028334.1|WP_015379639.1|1120776_1121682_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALTEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>NZ_CP028334.1|WP_160248236.1|1121875_1125952_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDVSPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTFVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAREFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLLRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKIDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKIALKDL
>NZ_CP028334.1|WP_011100893.1|1126240_1127023_-|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>NZ_CP028334.1|WP_021357178.1|1127047_1127755_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPVMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLKKLTPQDFNDHVE
>NZ_CP028334.1|WP_003641725.1|1127854_1129219_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>NZ_CP028334.1|WP_021357176.1|1129451_1129922_+|NUDIX-hydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQILLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>NZ_CP028334.1|WP_015379635.1|1131528_1133121_-|DNA-binding-protein-with-HIRAN-domain
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKSRTNLGAVLTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>NZ_CP028334.1|WP_003641722.1|1133364_1134105_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028334_1	1.2\|1119466\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119466-1119495	30	JX486087	Lactobacillus phage ATCC 8014-B1, complete genome	790-819	1	0.967
NZ_CP028334_1	1.2\|1119466\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119466-1119495	30	JN051154	Pediococcus phage clP1, complete genome	6473-6502	1	0.967
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	JX486088	Lactobacillus phage ATCC 8014-B2, complete genome	12816-12845	3	0.9
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	NC_047764	Lactobacillus phage P1, complete genome	8195-8224	4	0.867
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	KY381600	Lactobacillus phage P2, complete genome	11699-11728	4	0.867
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	MG744354	Lactobacillus phage Satyr, complete genome	69206-69235	4	0.867
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	MG765274	Lactobacillus phage Maenad, complete genome	67131-67160	4	0.867
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	MK448823	Streptococcus phage Javan633, complete genome	14256-14285	9	0.7
NZ_CP028334_1	1.5\|1119664\|30\|NZ_CP028334\|CRT,PILER-CR,CRISPRCasFinder	1119664-1119693	30	MK448996	Streptococcus phage Javan628, complete genome	14256-14285	9	0.7

1. spacer 1.2|1119466|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to JX486087 (Lactobacillus phage ATCC 8014-B1, complete genome) position: , mismatch: 1, identity: 0.967

cgtaaataggttgtaaacgttcaggtctga	CRISPR spacer
cgtgaataggttgtaaacgttcaggtctga	Protospacer
***.**************************

2. spacer 1.2|1119466|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to JN051154 (Pediococcus phage clP1, complete genome) position: , mismatch: 1, identity: 0.967

cgtaaataggttgtaaacgttcaggtctga	CRISPR spacer
cgtgaataggttgtaaacgttcaggtctga	Protospacer
***.**************************

3. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to JX486088 (Lactobacillus phage ATCC 8014-B2, complete genome) position: , mismatch: 3, identity: 0.9

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
agttggggtttgtgccttgacttcttcaag	Protospacer
 *****.***********.***********

4. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to NC_047764 (Lactobacillus phage P1, complete genome) position: , mismatch: 4, identity: 0.867

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tgatggagtttgtgcttttacttcttcaag	Protospacer
.* ************.** ***********

5. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to KY381600 (Lactobacillus phage P2, complete genome) position: , mismatch: 4, identity: 0.867

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tgatggagtttgtgcttttacttcttcaag	Protospacer
.* ************.** ***********

6. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to MG744354 (Lactobacillus phage Satyr, complete genome) position: , mismatch: 4, identity: 0.867

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tgatggagtttgtgcttttacttcttcaag	Protospacer
.* ************.** ***********

7. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to MG765274 (Lactobacillus phage Maenad, complete genome) position: , mismatch: 4, identity: 0.867

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tgatggagtttgtgcttttacttcttcaag	Protospacer
.* ************.** ***********

8. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to MK448823 (Streptococcus phage Javan633, complete genome) position: , mismatch: 9, identity: 0.7

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tcctatcaattgtgccttaactgcttcaag	Protospacer
. .*.  . ************* *******

9. spacer 1.5|1119664|30|NZ_CP028334|CRT,PILER-CR,CRISPRCasFinder matches to MK448996 (Streptococcus phage Javan628, complete genome) position: , mismatch: 9, identity: 0.7

cgttggagtttgtgccttaacttcttcaag	CRISPR spacer
tcctatcaattgtgccttaactgcttcaag	Protospacer
. .*.  . ************* *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 41484

Lactobacillus_phage(94.74%)

integrase,portal,transposase,tail,protease,capsid,terminase

attL 25522:25535|attR 37531:37544

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380192.1\|1324_2146_-	hypothetical protein	A0A2P0ZLE2	Lactobacillus_phage	6.8e-154	100.0
WP_160248158.1\|2149_6697_-\|tail	phage tail tape measure protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	82.7
WP_003643912.1\|6715_6937_-	hypothetical protein	A0A2P0ZLD9	Lactobacillus_phage	3.9e-32	98.6
WP_015380190.1\|6960_7275_-	hypothetical protein	A0A2P0ZLF3	Lactobacillus_phage	9.5e-48	90.4
WP_015380189.1\|7366_7978_-	hypothetical protein	A0A2P0ZLF5	Lactobacillus_phage	3.3e-105	96.6
WP_015380188.1\|7992_8415_-	hypothetical protein	A0A2P0ZLE4	Lactobacillus_phage	6.3e-71	97.1
WP_015380187.1\|8411_8819_-	hypothetical protein	A0A2P0ZLD7	Lactobacillus_phage	2.0e-66	94.1
WP_015380186.1\|8815_9205_-	hypothetical protein	A0A2P0ZLD1	Lactobacillus_phage	3.8e-62	87.6
WP_015380185.1\|9185_9491_-	hypothetical protein	A0A2P0ZLD5	Lactobacillus_phage	6.6e-46	94.1
WP_015380184.1\|9629_10808_-\|capsid	phage major capsid protein	A0A2P0ZLD6	Lactobacillus_phage	2.3e-219	99.7
WP_015380183.1\|10828_11581_-\|protease	Clp protease ClpP	A0A2P0ZLE3	Lactobacillus_phage	7.1e-134	99.6
WP_015380182.1\|11567_12710_-\|portal	phage portal protein	A0A2P0ZLC9	Lactobacillus_phage	5.3e-213	97.4
WP_015380181.1\|12728_14408_-\|terminase	terminase large subunit	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	98.8
WP_015380180.1\|14404_14692_-	hypothetical protein	A0A2P0ZLC8	Lactobacillus_phage	2.2e-43	96.8
WP_015380179.1\|14800_15052_-	hypothetical protein	A0A2P0ZLD2	Lactobacillus_phage	3.9e-36	91.6
WP_144063628.1\|15196_15436_-	hypothetical protein	A0A2P0ZLD3	Lactobacillus_phage	6.1e-31	81.0
WP_102115504.1\|15438_15777_-	HNH endonuclease	A0A2P0ZLC6	Lactobacillus_phage	3.4e-59	92.0
WP_015380177.1\|15760_15976_-	hypothetical protein	A0A2P0ZLC2	Lactobacillus_phage	1.4e-29	87.3
WP_015380176.1\|16181_16751_-	hypothetical protein	NA	NA	NA	NA
WP_160248159.1\|16935_18111_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_015380175.1\|18290_18980_-	hypothetical protein	NA	NA	NA	NA
WP_015380174.1\|19055_19469_-	hypothetical protein	A0A2P0ZLC0	Lactobacillus_phage	1.4e-70	99.3
WP_015380173.1\|19480_19792_-	hypothetical protein	A0A2P0ZLD0	Lactobacillus_phage	2.1e-47	91.3
WP_015380172.1\|19928_20408_-	hypothetical protein	A0A2P0ZL79	Lactobacillus_phage	2.7e-78	93.2
WP_015380170.1\|20585_20918_-	VRR-NUC domain-containing protein	A0A2P0ZLB6	Lactobacillus_phage	3.7e-58	95.5
WP_015380169.1\|21175_22450_-	helicase	A0A2P0ZLC4	Lactobacillus_phage	4.8e-239	97.4
WP_015380168.1\|22446_23241_-	hypothetical protein	A0A2P0ZLB0	Lactobacillus_phage	7.1e-124	85.6
WP_015380167.1\|23678_24233_-	hypothetical protein	NA	NA	NA	NA
WP_015380166.1\|24246_24870_-	hypothetical protein	A0A2P0ZLB9	Lactobacillus_phage	2.0e-102	98.4
WP_015380165.1\|24872_25589_-	AAA family ATPase	A0A2P0ZLB2	Lactobacillus_phage	7.8e-114	98.6
25522:25535	attL	NA	NA	NA	NA
WP_043992724.1\|25585_26962_-	DEAD/DEAH box helicase	A0A2P0ZLA5	Lactobacillus_phage	3.1e-236	96.5
WP_160248160.1\|26961_27441_-	siphovirus Gp157 family protein	A0A2P0ZLB3	Lactobacillus_phage	3.2e-79	93.1
WP_021730257.1\|27543_27714_-	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	5.5e-26	98.2
WP_015380160.1\|27685_27871_-	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	7.0e-27	88.5
WP_015380158.1\|28020_28302_-	hypothetical protein	NA	NA	NA	NA
WP_043993003.1\|28416_28689_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.5e-30	66.7
WP_015380156.1\|28754_28958_-	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	5.5e-25	85.1
WP_015380155.1\|28961_29171_-	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	1.6e-30	98.6
WP_015380154.1\|29477_29867_+	helix-turn-helix transcriptional regulator	A0A2P0ZLA1	Lactobacillus_phage	1.5e-66	97.6
WP_003643876.1\|29876_30308_+	hypothetical protein	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
WP_015380153.1\|30331_30772_+	hypothetical protein	NA	NA	NA	NA
WP_015380152.1\|30859_31483_+	hypothetical protein	NA	NA	NA	NA
WP_015380151.1\|31605_34398_+	N-6 DNA methylase	Q6NE04	Leptospira_phage	9.4e-147	35.4
WP_015380150.1\|34568_35699_+\|integrase	site-specific integrase	A0A0M9JJ77	Lactobacillus_phage	1.2e-92	48.2
WP_080125236.1\|36286_38557_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.6e-118	31.4
37531:37544	attR	NA	NA	NA	NA
WP_003643147.1\|38618_38906_-	hypothetical protein	NA	NA	NA	NA
WP_003643148.1\|39020_39533_+	hypothetical protein	NA	NA	NA	NA
WP_080125234.1\|39646_40126_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_013355445.1\|40818_41484_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

51726 : 52584

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248163.1\|51726_52584_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	2.1e-17	33.0

DBSCAN-SWA_3

57844 : 59360

Lactobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248164.1\|57844_58492_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	5.3e-45	47.5
WP_011101356.1\|58673_59360_-	glycerophosphoryl diester phosphodiesterase	M1ICP4	Paramecium_bursaria_Chlorella_virus	6.3e-12	27.5

DBSCAN-SWA_4

62511 : 63612

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101354.1\|62511_63612_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-28	36.4

DBSCAN-SWA_5

69931 : 74100

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643180.1\|69931_72358_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.1
WP_021357522.1\|72853_73504_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_075060691.1\|73503_74100_+	SAM-dependent methyltransferase	A0A2H4PQV0	Staphylococcus_phage	2.1e-35	45.5

DBSCAN-SWA_6

89087 : 90275

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644222.1\|89087_90275_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.2e-144	67.2

DBSCAN-SWA_7

100480 : 101368

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380118.1\|100480_101368_-	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	1.6e-12	34.2

DBSCAN-SWA_8

114056 : 119332

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644210.1\|114056_116162_-	LTA synthase family protein	W6LM83	Streptococcus_phage	2.0e-157	48.1
WP_003643297.1\|116317_116554_-	YkuJ family protein	NA	NA	NA	NA
WP_003644209.1\|116745_117933_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_015380113.1\|118093_119332_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.4e-16	27.9

DBSCAN-SWA_9

126096 : 132157

Agrobacterium_phage(25.0%)

integrase,protease

attL 121190:121203|attR 130781:130794

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
121190:121203	attL	NA	NA	NA	NA
WP_003644206.1\|126096_128316_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	7.3e-126	40.4
WP_015380112.1\|128430_128982_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	2.4e-30	42.8
WP_003643287.1\|129175_129565_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_015380111.1\|130105_131071_-	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	1.3e-10	36.4
130781:130794	attR	NA	NA	NA	NA
WP_003643240.1\|131077_132157_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-18	29.4

DBSCAN-SWA_10

142131 : 146396

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248167.1\|142131_143709_-	peptide chain release factor 3	D0R0F5	Streptococcus_phage	7.7e-29	25.1
WP_003643226.1\|144006_145329_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-25	26.9
WP_015380105.1\|145499_146396_+	decarboxylating 6-phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	5.5e-48	35.4

DBSCAN-SWA_11

149457 : 149856

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643222.1\|149457_149856_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	9.3e-16	39.9

DBSCAN-SWA_12

153176 : 153908

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356761.1\|153176_153908_+	gamma-D-glutamate-meso-diaminopimelate muropeptidase	A0A0A8WF62	Clostridium_phage	1.0e-15	43.7

DBSCAN-SWA_13

172543 : 173677

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064523011.1\|172543_173677_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	5.5e-170	77.3

DBSCAN-SWA_14

195305 : 202373

Catovirus(33.33%)

integrase

attL 194119:194132|attR 202855:202868

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
194119:194132	attL	NA	NA	NA	NA
WP_013355388.1\|195305_196253_-	SDR family NAD(P)-dependent oxidoreductase	A0A1V0SAI6	Catovirus	4.4e-40	33.9
WP_015380066.1\|196270_197044_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_013355386.1\|197030_197759_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_015380065.1\|197770_198541_-	Polysaccharide biosynthesis protein, chain length regulator	NA	NA	NA	NA
WP_072533917.1\|198896_199499_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	4.8e-32	41.3
WP_015380061.1\|200645_201875_-	hypothetical protein	NA	NA	NA	NA
WP_015380060.1\|201977_202373_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	1.7e-17	42.2
202855:202868	attR	NA	NA	NA	NA

DBSCAN-SWA_15

211603 : 216211

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043992692.1\|211603_212722_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.5e-172	79.5
WP_003643315.1\|212871_213588_-	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_003643314.1\|213777_214707_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_160248177.1\|215092_216211_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	6.0e-20	28.4

DBSCAN-SWA_16

225773 : 230156

Diachasmimorpha_longicaudata_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120787326.1\|225773_227108_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.6e-38	30.9
WP_015380046.1\|227120_228128_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_015380044.1\|228314_228515_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641352.1\|228858_229224_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_015380043.1\|229379_230156_-	lysozyme	A0A141HSE6	Bacillus_phage	7.6e-06	30.1

DBSCAN-SWA_17

233625 : 239993

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248179.1\|233625_235965_-	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	5.4e-39	24.2
WP_043992687.1\|236231_236807_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011101269.1\|237263_238637_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	3.2e-124	50.0
WP_015380038.1\|238970_239993_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	3.3e-17	26.5

DBSCAN-SWA_18

244517 : 252414

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641339.1\|244517_246557_-	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	7.9e-95	33.3
WP_003644128.1\|246573_248841_-	DNA helicase PcrA	A7KV33	Bacillus_phage	4.8e-133	42.7
WP_003641337.1\|249281_250451_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_160248180.1\|250563_251112_-	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_015380034.1\|251134_251722_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_015380033.1\|251772_252414_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	6.7e-24	42.0

DBSCAN-SWA_19

257456 : 260950

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641327.1\|257456_259217_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	2.2e-24	24.3
WP_015380030.1\|259216_260950_-	thiol reductant ABC exporter subunit CydD	A0A076FI99	Aureococcus_anophage	1.0e-10	22.6

DBSCAN-SWA_20

275043 : 276432

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101260.1\|275043_276432_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	9.0e-58	35.0

DBSCAN-SWA_21

283957 : 284956

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248181.1\|283957_284956_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.4e-51	37.3

DBSCAN-SWA_22

296225 : 296963

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645514.1\|296225_296963_-	metal ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.4e-11	26.1

DBSCAN-SWA_23

315945 : 317654

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379998.1\|315945_316833_-	energy-coupling factor ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-13	31.6
WP_003644096.1\|316808_317654_-	energy-coupling factor ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.0e-21	31.3

DBSCAN-SWA_24

339771 : 359538

uncultured_Mediterranean_phage(33.33%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641250.1\|339771_341868_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.4e-67	27.5
WP_003638057.1\|342009_342480_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003641249.1\|342496_342910_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_011101245.1\|343172_343853_+	prepilin peptidase	NA	NA	NA	NA
WP_003641247.1\|344506_348148_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.3e-63	24.3
WP_016511247.1\|348165_351771_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.5e-51	25.1
WP_003644087.1\|352028_352631_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003641244.1\|352809_355314_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	2.9e-123	38.3
WP_003644086.1\|355332_355800_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_003644085.1\|357342_358620_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.4e-94	49.5
WP_003641239.1\|358902_359538_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	8.9e-53	47.5

DBSCAN-SWA_25

370534 : 371735

Lactococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641227.1\|370534_370735_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.0e-23	78.8
WP_086989537.1\|370959_371735_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_26

381283 : 383185

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379980.1\|381283_383185_+	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	1.3e-35	33.0

DBSCAN-SWA_27

388955 : 465905

Lactobacillus_phage(22.22%)

integrase,bacteriocin,transposase,tRNA,protease

attL 428507:428528|attR 431341:431362

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357097.1\|388955_389285_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_160248188.1\|389420_390749_-	glucarate dehydratase	NA	NA	NA	NA
WP_015379974.1\|390897_391791_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_043992670.1\|391939_392917_+	hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	2.1e-32	32.3
WP_015379972.1\|392931_394329_+	hypothetical protein	NA	NA	NA	NA
WP_086989537.1\|394631_395407_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_015379971.1\|395740_397075_-	gluconate transporter	NA	NA	NA	NA
WP_015379970.1\|397324_398539_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.5e-48	33.8
WP_015379969.1\|398554_399697_+	lactonase family protein	NA	NA	NA	NA
WP_160248189.1\|399789_400458_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_016526995.1\|400589_401159_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003641207.1\|401209_401974_-	YibE/F family protein	NA	NA	NA	NA
WP_080125228.1\|401970_403221_-	YibE/F family protein	NA	NA	NA	NA
WP_015379965.1\|403184_404186_-	hypothetical protein	NA	NA	NA	NA
WP_011101231.1\|404605_405370_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641203.1\|405722_406049_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015379963.1\|406240_407122_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_015379962.1\|407164_408973_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_003641200.1\|409230_409428_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644064.1\|409647_409914_+	hypothetical protein	NA	NA	NA	NA
WP_015379961.1\|409964_411197_+	hypothetical protein	NA	NA	NA	NA
WP_015379960.1\|411232_412639_+	C69 family dipeptidase	NA	NA	NA	NA
WP_015379959.1\|413090_414098_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_015379958.1\|414136_415432_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	1.1e-57	31.4
WP_160248465.1\|416971_417601_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_015379956.1\|417709_418183_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_015379953.1\|418458_420348_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	5.2e-16	26.2
WP_003645746.1\|420534_421461_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
WP_015379952.1\|421531_422083_-	helix-turn-helix domain-containing protein	X2CXD8	Lactobacillus_phage	8.4e-07	48.4
WP_015379951.1\|422182_422935_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003644054.1\|423584_423707_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_015379946.1\|427596_428127_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_080125226.1\|428440_428674_-	hypothetical protein	NA	NA	NA	NA
428507:428528	attL	NA	NA	NA	NA
WP_120787327.1\|428640_429045_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_080125224.1\|429049_429631_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_160248190.1\|429641_430559_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	7.7e-74	44.3
WP_043992664.1\|431897_433484_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	3.5e-175	62.7
431341:431362	attR	NA	NA	NA	NA
WP_160248191.1\|433497_436371_-	type I restriction endonuclease subunit R	NA	NA	NA	NA
WP_003645758.1\|436598_439133_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4
WP_003644050.1\|439314_439887_-	hypothetical protein	NA	NA	NA	NA
WP_003644049.1\|439992_440325_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_003645760.1\|440686_441697_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_013355307.1\|441828_442659_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_003641176.1\|442832_443273_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003644046.1\|443333_443756_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_003641174.1\|443770_443953_-	hypothetical protein	NA	NA	NA	NA
WP_160248192.1\|443965_444511_-	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
WP_003641172.1\|444522_444777_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003645763.1\|445017_446865_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7
WP_003645764.1\|446854_447238_-	hypothetical protein	NA	NA	NA	NA
WP_015379937.1\|447722_450230_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_043992660.1\|450503_451802_+	MFS transporter	NA	NA	NA	NA
WP_015640093.1\|451878_452754_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_003645768.1\|452762_453470_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003645769.1\|453625_453970_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_080125222.1\|454189_454876_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160248467.1\|455438_455807_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	1.3e-16	42.7
WP_015379932.1\|456040_456409_+	hypothetical protein	NA	NA	NA	NA
WP_004271307.1\|458231_459155_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_003641157.1\|461206_461725_-	hypothetical protein	NA	NA	NA	NA
WP_003641156.1\|461748_463680_-	AAA family ATPase	G3MAX6	Bacillus_virus	2.5e-42	38.1
WP_003645774.1\|464348_465905_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.5e-16	29.8

DBSCAN-SWA_28

477166 : 480506

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644029.1\|477166_477604_-	NUDIX domain-containing protein	A0A1V0SJK7	Klosneuvirus	3.6e-05	40.6
WP_015379922.1\|477692_478988_+	GTPase HflX	NA	NA	NA	NA
WP_003641140.1\|479099_479660_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011101192.1\|479744_480506_+	sulfite exporter TauE/SafE family protein	Q6EVM7	Oenoccocus_phage	1.7e-42	39.6

DBSCAN-SWA_29

491735 : 494486

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641125.1\|491735_492476_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-35	40.5
WP_003641122.1\|493008_493260_+	hypothetical protein	NA	NA	NA	NA
WP_013355278.1\|493493_494486_-	D-2-hydroxyacid dehydrogenase	M1HI29	Paramecium_bursaria_Chlorella_virus	3.8e-42	34.3

DBSCAN-SWA_30

498893 : 501980

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645788.1\|498893_499475_-	guanylate kinase	A0A218KC48	Bacillus_phage	8.5e-10	27.3
WP_003641114.1\|499625_499775_+	hypothetical protein	NA	NA	NA	NA
WP_015379915.1\|499851_500271_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003645789.1\|500324_501143_-	pyridoxal kinase	NA	NA	NA	NA
WP_003641111.1\|501506_501980_-	alcohol dehydrogenase	A0A218KDM1	Bacillus_phage	2.4e-10	51.7

DBSCAN-SWA_31

507598 : 509581

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645793.1\|507598_509581_-	acetyltransferase	W6MVL2	Pseudomonas_phage	3.3e-29	29.1

DBSCAN-SWA_32

517914 : 521329

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644001.1\|517914_519222_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.7e-45	30.5
WP_003641099.1\|519501_519663_+	hypothetical protein	NA	NA	NA	NA
WP_003644000.1\|519877_520351_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003645798.1\|520519_521329_+	LicD family protein	A0A1V0SD50	Indivirus	7.2e-07	32.4

DBSCAN-SWA_33

541463 : 543281

Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641075.1\|541463_543281_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.4e-90	36.5

DBSCAN-SWA_34

553046 : 559999

Cafeteria_roenbergensis_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248469.1\|553046_553811_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	2.3e-55	45.8
WP_003645814.1\|553873_554410_+	exonuclease	A0A2I6PEZ7	Staphylococcus_phage	5.2e-22	32.5
WP_003641062.1\|554633_555149_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643982.1\|555154_555616_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003641060.1\|555725_556703_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003643980.1\|556726_557419_-	uracil-DNA glycosylase	A0A1R3T3N6	Sphenicid_alphaherpesvirus	4.5e-42	40.6
WP_003641058.1\|557534_558404_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_015379900.1\|558427_558991_+	hypothetical protein	NA	NA	NA	NA
WP_003641056.1\|559264_559999_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-32	39.7

DBSCAN-SWA_35

569776 : 572687

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641053.1\|569776_570247_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	8.6e-45	61.0
WP_064523191.1\|570272_572687_-	ribonuclease R	Q0GXV6	Lactococcus_phage	2.7e-86	39.4

DBSCAN-SWA_36

576422 : 577751

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643976.1\|576422_577751_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	7.3e-174	71.1

DBSCAN-SWA_37

584588 : 591427

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641041.1\|584588_585179_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.0e-55	56.0
WP_003645820.1\|585337_586312_+	phosphoglycerate dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	4.4e-19	28.6
WP_015379894.1\|586522_588175_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003641038.1\|588599_589532_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.7e-49	36.8
WP_003645822.1\|589544_590546_-	YvcK family protein	A1IMD5	Streptococcus_phage	3.2e-97	55.0
WP_003641036.1\|590542_591427_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.2e-08	30.5

DBSCAN-SWA_38

595873 : 602865

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379892.1\|595873_598729_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.2e-299	54.4
WP_015379891.1\|598763_600767_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_015379890.1\|600915_601563_-	HD domain-containing protein	NA	NA	NA	NA
WP_064523214.1\|601668_602865_-	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	1.2e-05	19.5

DBSCAN-SWA_39

606383 : 614153

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646085.1\|606383_608111_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	7.7e-192	56.9
WP_003646084.1\|608329_608782_+	DUF3290 domain-containing protein	NA	NA	NA	NA
WP_015379885.1\|608782_609415_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_015379884.1\|609520_610459_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.0e-85	52.6
WP_011101153.1\|610651_612064_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_160248197.1\|612454_613135_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003641010.1\|613232_614153_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.5e-72	48.8

DBSCAN-SWA_40

618675 : 620252

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641003.1\|618675_619431_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-15	29.1
WP_015379880.1\|619442_620252_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.3e-11	27.8

DBSCAN-SWA_41

623299 : 625424

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379877.1\|623299_624703_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.1e-25	34.1
WP_003640997.1\|624695_625424_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.5e-35	34.9

DBSCAN-SWA_42

632085 : 635245

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248199.1\|632085_633438_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	2.5e-68	40.4
WP_003640991.1\|633504_634152_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.5e-36	40.4
WP_003643949.1\|634342_635245_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	9.2e-11	28.7

DBSCAN-SWA_43

638967 : 646639

uncultured_virus(50.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379874.1\|638967_640593_-	chaperonin GroEL	A0A240F766	uncultured_virus	1.9e-155	54.3
WP_003640985.1\|640648_640933_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	3.5e-09	40.2
WP_015379873.1\|641125_641770_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003640983.1\|641934_642612_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003643947.1\|642780_644763_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.0e-50	28.7
WP_003640980.1\|645592_646639_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.5e-62	41.7

DBSCAN-SWA_44

649748 : 650519

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640975.1\|649748_650519_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8

DBSCAN-SWA_45

654240 : 668959

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379869.1\|654240_655236_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	7.7e-51	37.9
WP_003640969.1\|655374_656160_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_015379868.1\|656163_657060_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.9e-80	55.3
WP_015379867.1\|657158_657506_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_160248200.1\|657530_658550_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-31	33.2
WP_003640965.1\|658566_658896_-	hypothetical protein	NA	NA	NA	NA
WP_016510978.1\|658892_659558_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|659955_660207_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|660221_660821_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|660836_661145_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|661166_662864_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_003640954.1\|663389_663896_-	nucleoside deaminase	NA	NA	NA	NA
WP_160248201.1\|663898_664507_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_015379864.1\|664729_664960_+	redoxin NrdH	X2KRY7	Enterococcus_phage	1.7e-09	40.0
WP_160248202.1\|665098_667264_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	9.8e-269	63.3
WP_003640950.1\|667291_668302_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003643936.1\|668383_668959_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.9e-26	41.7

DBSCAN-SWA_46

682384 : 683797

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379855.1\|682384_683797_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.1e-45	30.0

DBSCAN-SWA_47

689588 : 694334

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248203.1\|689588_690125_-	dUTP diphosphatase	J9PV85	Bacillus_phage	1.4e-35	45.8
WP_160248204.1\|690263_690560_+	N-acetyltransferase	NA	NA	NA	NA
WP_015379853.1\|690568_691252_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003643927.1\|691327_692659_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
WP_160248205.1\|692564_694334_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	2.7e-91	41.0

DBSCAN-SWA_48

719586 : 725002

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031263668.1\|719586_722241_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	6.8e-70	28.9
WP_003640900.1\|722696_723524_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.5e-72	54.0
WP_003640899.1\|723523_725002_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-106	44.1

DBSCAN-SWA_49

728005 : 729979

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640895.1\|728005_728797_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.5e-30	36.1
WP_003640894.1\|729157_729979_+	nicotinamide mononucleotide transporter	A0A2K9VCL6	Lactobacillus_phage	3.3e-52	42.2

DBSCAN-SWA_50

744177 : 752049

Tupanvirus(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642090.1\|744177_745677_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.6e-89	37.5
WP_015379834.1\|745780_746788_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003642088.1\|746787_747675_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003643854.1\|747823_750061_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	6.0e-104	47.8
WP_003642086.1\|750140_750683_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.5e-08	26.0
WP_003642085.1\|750702_752049_-\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	2.6e-09	23.8

DBSCAN-SWA_51

763665 : 766465

Pneumococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248210.1\|763665_764172_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	1.9e-05	32.1
WP_015379829.1\|764280_765303_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003646529.1\|765295_766465_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.9e-17	26.6

DBSCAN-SWA_52

774025 : 784766

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379823.1\|774025_774796_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-30	34.9
WP_003643845.1\|774811_775825_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_015379822.1\|775845_776898_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_015379821.1\|777593_779573_-	potassium transport system protein kup 1	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.1e-68	35.6
WP_003637688.1\|779864_780257_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	5.7e-10	36.0
WP_003642062.1\|780665_781793_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	2.5e-29	28.6
WP_003642061.1\|781792_782155_-	holo-ACP synthase	NA	NA	NA	NA
WP_015379820.1\|783179_784766_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-73	40.4

DBSCAN-SWA_53

799976 : 903192

uncultured_Mediterranean_phage(15.38%)

transposase,bacteriocin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248212.1\|799976_801308_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.0e-96	52.5
WP_003642042.1\|801774_803388_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|803560_804169_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|804213_804654_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_160248159.1\|805012_806188_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_024971479.1\|806376_807309_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_160248213.1\|807323_808676_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_015379810.1\|808695_809505_+	sugar-phosphatase	NA	NA	NA	NA
WP_043992605.1\|809674_810661_-	hypothetical protein	NA	NA	NA	NA
WP_015379808.1\|810743_811766_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|812054_813035_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_015379807.1\|813400_814225_-	serine hydrolase	NA	NA	NA	NA
WP_003646504.1\|814460_815843_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|815911_816748_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|817240_817504_-	hypothetical protein	NA	NA	NA	NA
WP_160248214.1\|817518_818061_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_015379806.1\|818610_818886_-	hypothetical protein	NA	NA	NA	NA
WP_003642024.1\|819242_820046_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|820032_820731_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_015379805.1\|820998_821943_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_015379804.1\|822252_823119_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|823251_823503_-	Veg protein	NA	NA	NA	NA
WP_003642019.1\|823607_824498_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_003643826.1\|824494_825058_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|825044_825821_-	TatD family hydrolase	NA	NA	NA	NA
WP_015379801.1\|826072_826561_-	hypothetical protein	NA	NA	NA	NA
WP_043992601.1\|827123_828014_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_015379798.1\|828047_829232_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_015379797.1\|829561_829888_-	hypothetical protein	NA	NA	NA	NA
WP_015379796.1\|830366_832418_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	4.5e-90	35.8
WP_015379795.1\|832739_833129_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_015379793.1\|833723_834566_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003642011.1\|834565_835270_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|835291_836251_-	hypothetical protein	NA	NA	NA	NA
WP_003642009.1\|836243_837518_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|837563_838481_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_043992598.1\|838880_839894_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_015379789.1\|840006_840753_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_015379788.1\|840902_841799_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|841919_843356_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_043992963.1\|843373_844729_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|844951_845374_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|845363_845552_-	hypothetical protein	NA	NA	NA	NA
WP_015379786.1\|845558_846920_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|846992_847703_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_043992597.1\|848108_849125_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_015379784.1\|849558_850335_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_015379783.1\|850593_852903_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_027821496.1\|852997_853201_-	hypothetical protein	NA	NA	NA	NA
WP_015379782.1\|853338_854025_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379781.1\|854118_854799_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160248215.1\|854885_855554_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_160248216.1\|855621_856311_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379778.1\|856397_857777_-	HlyD family secretion protein	NA	NA	NA	NA
WP_004271307.1\|860229_861153_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_160248217.1\|861352_862528_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_003643807.1\|863124_863274_-	hypothetical protein	NA	NA	NA	NA
WP_015379772.1\|863405_864152_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379769.1\|865258_865426_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|865456_865630_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003643805.1\|865626_866295_+	hypothetical protein	NA	NA	NA	NA
WP_003643803.1\|866319_866472_+	hypothetical protein	NA	NA	NA	NA
WP_003641969.1\|866706_866910_-	hypothetical protein	NA	NA	NA	NA
WP_015379767.1\|867114_867630_-	Na+/H+ antiporter	NA	NA	NA	NA
WP_120787350.1\|867785_867989_+	hypothetical protein	NA	NA	NA	NA
WP_080125207.1\|868095_868407_+	hypothetical protein	NA	NA	NA	NA
WP_050495850.1\|868868_869057_-	hypothetical protein	NA	NA	NA	NA
WP_003643800.1\|869068_869212_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|869873_871058_-	cation:proton antiporter	NA	NA	NA	NA
WP_015379763.1\|871102_872479_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|873006_873822_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_015379762.1\|873981_874854_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_015379761.1\|874924_875716_+	HAD family hydrolase	NA	NA	NA	NA
WP_003646460.1\|875719_876874_+	MFS transporter	NA	NA	NA	NA
WP_015379760.1\|876877_877495_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641945.1\|877690_878413_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003643774.1\|878427_880257_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_160248218.1\|880271_881789_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_043992584.1\|882254_883586_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|883663_884635_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003643770.1\|884635_886162_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_015379757.1\|886399_886846_+	ribonuclease H-like protein	NA	NA	NA	NA
WP_015379756.1\|887017_887569_-	hypothetical protein	NA	NA	NA	NA
WP_004271307.1\|887586_888510_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015379753.1\|890395_891295_-	oxidoreductase	NA	NA	NA	NA
WP_003646441.1\|891431_892352_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003641936.1\|892517_893090_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_015379751.1\|893193_893649_-	hypothetical protein	NA	NA	NA	NA
WP_003641934.1\|893667_894138_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100975.1\|894247_895444_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|895474_895984_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|896096_896465_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_015379750.1\|896729_898235_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_015379749.1\|898392_899061_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_015379748.1\|899254_899818_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_003641927.1\|900047_900317_-	hypothetical protein	NA	NA	NA	NA
WP_015379746.1\|900419_901379_-	L-lactate dehydrogenase	NA	NA	NA	NA
WP_016511449.1\|901875_903192_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	6.6e-34	29.6

DBSCAN-SWA_54

906385 : 907477

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641921.1\|906385_907477_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7

DBSCAN-SWA_55

928617 : 930560

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379732.1\|928617_929715_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.3e-37	42.0
WP_003643740.1\|929726_930560_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	3.8e-11	22.5

DBSCAN-SWA_56

939998 : 947391

Bacillus_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379729.1\|939998_940715_+	hypothetical protein	A0A1I9S5V4	Bacillus_phage	1.1e-19	38.2
WP_021356464.1\|940711_941629_+	sce7725 family protein	NA	NA	NA	NA
WP_080125206.1\|941638_942013_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_027821531.1\|942417_943050_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.5e-15	59.2
WP_015379725.1\|944101_944905_+	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	8.7e-13	49.6
WP_015379724.1\|945026_945746_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379723.1\|945841_946603_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_015379722.1\|946731_947391_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.4e-13	30.4

DBSCAN-SWA_57

965036 : 967104

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379715.1\|965036_965741_+	response regulator transcription factor	W8CYM9	Bacillus_phage	6.2e-31	32.1
WP_003643713.1\|965727_967104_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.8e-25	30.8

DBSCAN-SWA_58

973920 : 974696

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|973920_974696_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_59

979052 : 979457

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646390.1\|979052_979457_-	glycerol-3-phosphate cytidylyltransferase	E3SJ88	Synechococcus_phage	1.1e-16	42.1

DBSCAN-SWA_60

988316 : 991782

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641839.1\|988316_989105_-	nicotinamide mononucleotide transporter	A0A2H4PB74	Lactobacillus_phage	4.3e-97	75.4
WP_003641837.1\|989466_990258_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_015379705.1\|990870_991782_+	cysteine synthase family protein	A0A1X9I5K7	Streptococcus_phage	1.1e-56	41.3

DBSCAN-SWA_61

1001843 : 1007043

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011100931.1\|1001843_1002392_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.1e-10	29.3
WP_003641832.1\|1002692_1004039_-	DUF2252 domain-containing protein	NA	NA	NA	NA
WP_011100930.1\|1004273_1004738_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	5.0e-21	41.9
WP_003641830.1\|1004979_1005381_+	hypothetical protein	NA	NA	NA	NA
WP_015379694.1\|1005445_1006000_-	hypothetical protein	NA	NA	NA	NA
WP_003646379.1\|1006289_1006616_+	hypothetical protein	NA	NA	NA	NA
WP_003641827.1\|1006710_1007043_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.9e-15	36.8

DBSCAN-SWA_62

1020428 : 1028181

Clostridioides_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641816.1\|1020428_1020632_+	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	9.8e-06	39.7
WP_003641815.1\|1020644_1021058_+	hypothetical protein	NA	NA	NA	NA
WP_013355131.1\|1021143_1021614_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_003646372.1\|1022205_1023036_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.0e-53	41.2
WP_021356729.1\|1023055_1023538_-	glutathione peroxidase	NA	NA	NA	NA
WP_003643692.1\|1023878_1024448_+	ABC transporter permease	NA	NA	NA	NA
WP_015379685.1\|1024477_1025884_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-15	26.4
WP_015379684.1\|1025880_1026540_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_015379683.1\|1026660_1028181_-	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	1.6e-44	30.9

DBSCAN-SWA_63

1035143 : 1037851

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641796.1\|1035143_1036217_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	6.4e-96	50.3
WP_015379677.1\|1036232_1037411_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.1e-83	41.1
WP_015379676.1\|1037407_1037851_+	GNAT family N-acetyltransferase	A0A1X9I6I8	Streptococcus_phage	7.6e-19	37.1

DBSCAN-SWA_64

1062560 : 1063336

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_139588855.1\|1062560_1063336_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.3e-26	52.3

DBSCAN-SWA_65

1069379 : 1070486

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641775.1\|1069379_1070486_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.6e-27	33.2

DBSCAN-SWA_66

1089716 : 1092351

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646339.1\|1089716_1090634_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-21	29.2
WP_003646338.1\|1090896_1091691_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-09	30.3
WP_003641754.1\|1091859_1092351_-	hypothetical protein	A8ATW6	Listeria_phage	1.9e-18	36.1

DBSCAN-SWA_67

1096695 : 1098396

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646334.1\|1096695_1098396_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-18	34.4

DBSCAN-SWA_68

1106872 : 1107721

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646328.1\|1106872_1107721_-	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	1.3e-27	30.1

DBSCAN-SWA_69

1113457 : 1119299

Wolbachia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641733.1\|1113457_1113880_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.4e-06	33.3
WP_003646321.1\|1114025_1114499_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003646320.1\|1114612_1115215_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641730.1\|1115280_1115475_+	PspC domain-containing protein	NA	NA	NA	NA
WP_003646319.1\|1115517_1116276_-	nucleoside phosphorylase	F5CA76	Streptococcus_phi-m46.1-like_phage	2.0e-35	46.8
WP_015379642.1\|1116560_1119299_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	3.1e-62	29.4

DBSCAN-SWA_70

1129451 : 1129922

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357176.1\|1129451_1129922_+	NUDIX hydrolase	D0R7J3	Paenibacillus_phage	4.9e-16	33.8

DBSCAN-SWA_71

1140057 : 1142811

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643656.1\|1140057_1140774_-	aquaporin family protein	M1H4F4	Acanthocystis_turfacea_Chlorella_virus	4.1e-22	33.6
WP_071540923.1\|1140778_1141270_-	DUF111 family protein	NA	NA	NA	NA
WP_003641713.1\|1141248_1142040_-	LarC family nickel insertion protein	NA	NA	NA	NA
WP_003641712.1\|1142070_1142811_-	nickel pincer cofactor biosynthesis protein LarB	A0A288TYA6	Enterococcus_phage	4.7e-21	47.2

DBSCAN-SWA_72

1146809 : 1147535

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526846.1\|1146809_1147535_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-11	27.3

DBSCAN-SWA_73

1157819 : 1158824

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379621.1\|1157819_1158824_+	NADP-dependent oxidoreductase	K7Z7U2	Megavirus	7.6e-06	31.1

DBSCAN-SWA_74

1161829 : 1163848

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248239.1\|1161829_1163848_-	TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein	D0R0F5	Streptococcus_phage	7.9e-71	30.7

DBSCAN-SWA_75

1171246 : 1172263

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357210.1\|1171246_1172263_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	7.6e-30	36.0

DBSCAN-SWA_76

1177792 : 1178218

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641672.1\|1177792_1178218_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.1e-29	51.6

DBSCAN-SWA_77

1191970 : 1200375

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641660.1\|1191970_1193233_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.3e-15	28.8
WP_003641659.1\|1193343_1194159_-	MBL fold metallo-hydrolase	A0A0D3MKU5	Leuconostoc_phage	2.8e-11	28.0
WP_003646175.1\|1194517_1195372_-	hypothetical protein	NA	NA	NA	NA
WP_003646176.1\|1195383_1196709_-	hypothetical protein	NA	NA	NA	NA
WP_015379607.1\|1196689_1198564_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.2e-34	33.6
WP_003637294.1\|1198577_1199285_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-44	40.1
WP_003641655.1\|1199858_1200083_-	hypothetical protein	NA	NA	NA	NA
WP_003643615.1\|1200174_1200375_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.6

DBSCAN-SWA_78

1207905 : 1210302

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643612.1\|1207905_1210302_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.6e-09	42.9

DBSCAN-SWA_79

1218364 : 1235489

Streptococcus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379599.1\|1218364_1219603_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.1e-110	52.6
WP_003643611.1\|1219621_1220419_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-45	39.2
WP_003641639.1\|1220440_1221664_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	2.4e-54	33.6
WP_003641638.1\|1221885_1223310_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	9.7e-124	53.1
WP_003641637.1\|1223325_1223778_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_003643610.1\|1223790_1225803_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_003641635.1\|1225983_1226220_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003646183.1\|1226258_1226840_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.7e-40	72.1
WP_003637271.1\|1226876_1227176_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_015379597.1\|1227797_1230359_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.1e-113	37.4
WP_003641632.1\|1230523_1232470_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	5.5e-146	46.7
WP_003641631.1\|1232466_1233591_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003641630.1\|1233591_1233825_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_160248246.1\|1234349_1235489_-	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	4.3e-13	29.9

DBSCAN-SWA_80

1254190 : 1254613

Staphylococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641613.1\|1254190_1254613_+	helix-turn-helix domain-containing protein	Q9G039	Staphylococcus_virus	1.2e-10	53.1

DBSCAN-SWA_81

1266615 : 1267419

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646226.1\|1266615_1267419_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.0e-08	28.1

DBSCAN-SWA_82

1278823 : 1280938

Cronobacter_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642931.1\|1278823_1280938_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.1e-118	38.7

DBSCAN-SWA_83

1295163 : 1296846

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248257.1\|1295163_1296846_+	sodium:solute symporter	A0A219Y9P9	Aeromonas_phage	3.2e-17	25.7

DBSCAN-SWA_84

1312368 : 1313022

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511066.1\|1312368_1313022_+	fructose-6-phosphate aldolase	R9TM64	Synechococcus_phage	8.6e-51	49.8

DBSCAN-SWA_85

1316144 : 1317119

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379561.1\|1316144_1317119_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	5.8e-27	33.5

DBSCAN-SWA_86

1329707 : 1331156

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013356042.1\|1329707_1331156_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	4.5e-36	26.5

DBSCAN-SWA_87

1352094 : 1356127

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643072.1\|1352094_1352853_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	2.6e-22	31.4
WP_003643071.1\|1352886_1353843_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_003643070.1\|1353835_1356127_+	FAD-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.7e-42	51.7

DBSCAN-SWA_88

1365886 : 1370282

Herpes_simplex_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379541.1\|1365886_1367767_-	beta-galactosidase large subunit	L0N6M2	Herpes_simplex_virus	6.4e-99	35.4
WP_003643061.1\|1368049_1369213_+	galactokinase	NA	NA	NA	NA
WP_015379540.1\|1369277_1370282_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	9.1e-52	37.3

DBSCAN-SWA_89

1381824 : 1382859

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822204.1\|1381824_1382859_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.3e-12	24.2

DBSCAN-SWA_90

1393262 : 1393913

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643044.1\|1393262_1393913_-	aquaporin	A0A1V0SCL5	Indivirus	1.9e-05	41.6

DBSCAN-SWA_91

1406740 : 1419496

Cafeteria_roenbergensis_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248274.1\|1406740_1408657_-	M13 family peptidase	E3T4I7	Cafeteria_roenbergensis_virus	4.7e-73	29.6
WP_003643545.1\|1408965_1409631_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003643544.1\|1409828_1410053_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_015379519.1\|1410065_1410620_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_003643025.1\|1410747_1410951_+	hypothetical protein	NA	NA	NA	NA
WP_003643024.1\|1411050_1411320_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_015379518.1\|1411343_1411664_-	thioredoxin family protein	A0A2K9L3H4	Tupanvirus	5.2e-09	39.1
WP_015379517.1\|1412048_1412789_+	aquaporin family protein	M1HQW3	Paramecium_bursaria_Chlorella_virus	2.2e-26	31.7
WP_003645579.1\|1412942_1414847_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.3e-94	34.2
WP_015379515.1\|1415796_1416768_+	SGNH/GDSL hydrolase family protein	A0A2H4PRU1	Lactococcus_phage	1.7e-34	31.4
WP_015379514.1\|1416865_1417561_-	YdcF family protein	NA	NA	NA	NA
WP_015379513.1\|1417561_1418275_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_015379512.1\|1418542_1419496_-	Dyp-type peroxidase	S4VXK8	Pandoravirus	1.9e-19	29.1

DBSCAN-SWA_92

1438127 : 1438646

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645538.1\|1438127_1438646_+	RNase III inhibitor	A0A0K1L687	Scale_drop_disease_virus	5.4e-32	58.0

DBSCAN-SWA_93

1441954 : 1442815

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643521.1\|1441954_1442815_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.9e-58	42.3

DBSCAN-SWA_94

1446003 : 1448616

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645544.1\|1446003_1448616_+	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	2.2e-73	30.0

DBSCAN-SWA_95

1459512 : 1462635

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645551.1\|1459512_1461552_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.3e-56	27.1
WP_003643511.1\|1461648_1462635_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	2.8e-29	33.2

DBSCAN-SWA_96

1474269 : 1474770

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645558.1\|1474269_1474770_-	hypothetical protein	A0A291I9Q0	Lactobacillus_phage	1.3e-43	58.0

DBSCAN-SWA_97

1486055 : 1490337

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015381041.1\|1486055_1487900_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.7e-64	28.8
WP_160248281.1\|1488669_1490337_+	glycine/betaine ABC transporter	A0A2I7QNT1	Vibrio_phage	1.5e-06	21.1

DBSCAN-SWA_98

1493731 : 1499365

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015381038.1\|1493731_1494652_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.6e-10	28.4
WP_003643490.1\|1495712_1496024_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_003642837.1\|1496248_1497070_-	pyruvate formate lyase-activating protein	NA	NA	NA	NA
WP_160248283.1\|1497106_1499365_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	4.0e-164	41.3

DBSCAN-SWA_99

1512352 : 1512922

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015381032.1\|1512352_1512922_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	8.3e-34	43.5

DBSCAN-SWA_100

1517893 : 1518532

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357430.1\|1517893_1518532_+	helix-turn-helix transcriptional regulator	A0A0S2MVM8	Bacillus_phage	5.7e-07	50.8

DBSCAN-SWA_101

1522147 : 1530110

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015381025.1\|1522147_1523266_-	vitamin B12 independent methionine synthase	A0A218MNE0	uncultured_virus	2.4e-69	43.5
WP_003643477.1\|1523727_1524774_+	AI-2E family transporter	NA	NA	NA	NA
WP_003642499.1\|1525102_1526047_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_086989537.1\|1526098_1526874_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
WP_003643475.1\|1526974_1529017_-	potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	8.0e-63	33.7
WP_086989537.1\|1529335_1530110_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_102

1542868 : 1550122

Staphylococcus_virus(20.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015381013.1\|1542868_1543846_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.4e-137	71.2
WP_015381012.1\|1543888_1545178_-	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_003645480.1\|1545494_1546793_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
WP_015381011.1\|1547015_1547345_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_015381010.1\|1547539_1548874_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-27	27.1
WP_015381009.1\|1549009_1550122_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-35	35.3

DBSCAN-SWA_103

1580588 : 1582833

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380988.1\|1580588_1582034_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.9e-83	37.7
WP_015380987.1\|1582182_1582833_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-22	31.5

DBSCAN-SWA_104

1591961 : 1597928

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645325.1\|1591961_1592537_+	zinc ribbon domain-containing protein	D6PSS6	Lactobacillus_phage	2.1e-21	31.1
WP_015380981.1\|1592705_1593521_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003642441.1\|1593992_1594754_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-27	36.0
WP_003642440.1\|1594765_1595473_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003642439.1\|1595541_1596345_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003642438.1\|1596701_1597928_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.0e-21	28.6

DBSCAN-SWA_105

1606853 : 1624882

Bacillus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645330.1\|1606853_1607705_+	nucleoid occlusion protein	A0A1C9EHY8	Gordonia_phage	1.0e-11	30.1
WP_003642431.1\|1607707_1608475_+	ParA family protein	Q8JL10	Natrialba_phage	3.7e-29	32.3
WP_003645331.1\|1608464_1609355_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.5e-16	32.2
WP_003639829.1\|1609379_1609571_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_003642429.1\|1609601_1610702_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_003642428.1\|1610723_1611449_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_003642427.1\|1611734_1612886_+	guanosine monophosphate reductase	A0A1V0SHK8	Klosneuvirus	8.0e-52	39.6
WP_003645333.1\|1613154_1614084_+	foldase	NA	NA	NA	NA
WP_015380977.1\|1614259_1614949_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_003642424.1\|1615039_1615729_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-36	35.8
WP_003642423.1\|1615745_1616906_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.2e-28	30.8
WP_003645334.1\|1616975_1618310_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.4e-09	25.9
WP_015380976.1\|1618883_1619381_+	N-acetyltransferase	NA	NA	NA	NA
WP_003642420.1\|1619517_1620303_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_003642419.1\|1620323_1620674_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_160248290.1\|1620745_1621669_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_003642418.1\|1621791_1622514_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_003642413.1\|1623956_1624511_-	DUF4352 domain-containing protein	D7RWL3	Brochothrix_phage	1.5e-11	26.8
WP_003642412.1\|1624519_1624882_-	DUF4064 domain-containing protein	D7RWL4	Brochothrix_phage	4.5e-09	45.1

DBSCAN-SWA_106

1634964 : 1641486

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380966.1\|1634964_1635855_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-31	37.3
WP_015380964.1\|1636617_1637382_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_015380963.1\|1637409_1637775_+	helix-turn-helix transcriptional regulator	A0A0S2MVM8	Bacillus_phage	1.5e-07	51.7
WP_015380962.1\|1638250_1639339_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_003643427.1\|1640222_1640789_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015380960.1\|1640772_1641486_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	9.8e-16	26.4

DBSCAN-SWA_107

1645111 : 1646383

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645352.1\|1645111_1646383_-	DUF805 domain-containing protein	Q9AZW5	Lactococcus_phage	4.7e-21	41.7

DBSCAN-SWA_108

1654493 : 1654961

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003587210.1\|1654493_1654961_-	DNA starvation/stationary phase protection protein	A0A222Z0F3	Streptomyces_phage	1.6e-06	29.2

DBSCAN-SWA_109

1659254 : 1660715

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380955.1\|1659254_1660715_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.1e-29	27.7

DBSCAN-SWA_110

1665209 : 1670702

Tupanvirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380952.1\|1665209_1666997_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	1.6e-19	30.5
WP_015380951.1\|1666993_1667656_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015380949.1\|1668599_1669934_+	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_086989537.1\|1669926_1670702_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_111

1682114 : 1687567

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642355.1\|1682114_1682861_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	8.1e-05	27.2
WP_015380942.1\|1683154_1684048_+	SDR family oxidoreductase	M1HZA6	Acanthocystis_turfacea_Chlorella_virus	7.9e-07	25.0
WP_003643401.1\|1684028_1684541_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_160248295.1\|1684785_1685781_-	iron ABC transporter permease	NA	NA	NA	NA
WP_003643400.1\|1685777_1686776_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-18	26.8
WP_003642350.1\|1686772_1687567_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.8e-17	28.6

DBSCAN-SWA_112

1706284 : 1707208

unidentified_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248290.1\|1706284_1707208_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9

DBSCAN-SWA_113

1712060 : 1712714

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643386.1\|1712060_1712714_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	2.9e-14	29.0

DBSCAN-SWA_114

1735612 : 1741958

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380915.1\|1735612_1737538_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.0e-83	34.7
WP_003642307.1\|1737903_1739025_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.2e-13	27.8
WP_003644879.1\|1740094_1741267_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_003642303.1\|1741562_1741958_-	transglycosylase	A0A249XZV3	Enterococcus_phage	2.1e-15	60.0

DBSCAN-SWA_115

1745522 : 1751569

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644885.1\|1745522_1746413_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.6e-55	46.4
WP_015380911.1\|1746504_1747704_-	amidohydrolase	NA	NA	NA	NA
WP_160248304.1\|1748070_1749795_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.4e-31	25.8
WP_064523657.1\|1749787_1751569_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.2e-43	26.8

DBSCAN-SWA_116

1757543 : 1758318

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|1757543_1758318_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_117

1764217 : 1765774

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248308.1\|1764217_1765774_+\|transposase	transposase	A0A146ICT8	Staphylococcus_phage	1.6e-79	39.9

DBSCAN-SWA_118

1772744 : 1774265

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380885.1\|1772744_1774265_+	Y-family DNA polymerase	D0R0A3	Streptococcus_phage	7.6e-26	28.2

DBSCAN-SWA_119

1781133 : 1782850

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356995.1\|1781133_1781796_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	8.5e-14	48.4
WP_160248311.1\|1782235_1782850_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	3.3e-12	61.5

DBSCAN-SWA_120

1792173 : 1792949

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|1792173_1792949_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_121

1796829 : 1798830

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380873.1\|1796829_1798830_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-33	39.2

DBSCAN-SWA_122

1810689 : 1812174

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646065.1\|1810689_1811469_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.2e-12	24.0
WP_003646064.1\|1811469_1812174_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.0e-14	26.8

DBSCAN-SWA_123

1819657 : 1820431

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033617702.1\|1819657_1820431_+	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	1.6e-08	25.8

DBSCAN-SWA_124

1826652 : 1828410

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248316.1\|1826652_1828410_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-107	41.6

DBSCAN-SWA_125

1856446 : 1862695

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021357074.1\|1856446_1856857_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	1.3e-12	42.9
WP_003644789.1\|1856999_1857473_-	lipoprotein	NA	NA	NA	NA
WP_003644788.1\|1857921_1860144_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.6e-250	59.0
WP_043992898.1\|1860076_1860658_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	2.3e-55	60.2
WP_160248318.1\|1860868_1861549_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003642201.1\|1861564_1862695_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.7e-18	34.0

DBSCAN-SWA_126

1869554 : 1870850

Shearwaterpox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821778.1\|1869554_1870850_+	alkaline phosphatase family protein	A0A1V0QG10	Shearwaterpox_virus	1.4e-07	21.3

DBSCAN-SWA_127

1875023 : 1877531

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380833.1\|1875023_1877531_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.3e-135	32.3

DBSCAN-SWA_128

1880708 : 1882331

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380830.1\|1880708_1882331_+	ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	8.4e-47	26.9

DBSCAN-SWA_129

1898460 : 1900248

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644847.1\|1898460_1900248_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.5e-44	25.0

DBSCAN-SWA_130

1919253 : 1919955

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644830.1\|1919253_1919955_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-32	35.7

DBSCAN-SWA_131

1927538 : 1931309

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380802.1\|1927538_1928438_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.5e-18	27.4
WP_016511814.1\|1928793_1929858_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	1.8e-18	70.8
WP_015380800.1\|1930325_1931309_-	LysM peptidoglycan-binding domain-containing protein	A0A1S5RCR7	Lactobacillus_phage	2.9e-10	56.4

DBSCAN-SWA_132

1950411 : 1951092

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642105.1\|1950411_1951092_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-31	37.7

DBSCAN-SWA_133

1959607 : 1963301

Lactobacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080125268.1\|1959607_1960855_+	glycosyl hydrolase	Q5ULM6	Lactobacillus_virus	2.4e-33	43.8
WP_015380778.1\|1960954_1961620_+	hypothetical protein	NA	NA	NA	NA
WP_015380777.1\|1962044_1963301_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	2.7e-85	43.1

DBSCAN-SWA_134

1970894 : 1972646

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024521812.1\|1970894_1971761_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	6.7e-51	39.8
WP_015380773.1\|1971779_1972646_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.4e-50	38.6

DBSCAN-SWA_135

1992369 : 1993044

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645837.1\|1992369_1993044_-	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	4.2e-08	27.0

DBSCAN-SWA_136

2000991 : 2005171

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003581836.1\|2000991_2001735_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-27	33.5
WP_015474704.1\|2001712_2002960_+	ABC transporter permease	NA	NA	NA	NA
WP_015380759.1\|2002964_2003636_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_015380758.1\|2003737_2005171_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-95	44.0

DBSCAN-SWA_137

2010787 : 2012139

Listeria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642553.1\|2010787_2011009_+	DUF2829 domain-containing protein	A8AT88	Listeria_phage	6.7e-08	35.2
WP_003642554.1\|2011008_2011755_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_003642555.1\|2011770_2012139_+	HIT family protein	D7NW73	Streptomyces_phage	6.8e-13	40.6

DBSCAN-SWA_138

2027344 : 2031487

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380745.1\|2027344_2028223_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-15	29.7
WP_003642574.1\|2028219_2028591_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_015380744.1\|2028618_2028894_-	hypothetical protein	NA	NA	NA	NA
WP_015380743.1\|2028916_2030698_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_003642577.1\|2030728_2031487_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-32	36.6

DBSCAN-SWA_139

2036937 : 2049470

Lactobacillus_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642583.1\|2036937_2037546_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	7.9e-59	54.5
WP_003644728.1\|2037560_2038856_+	NADPH-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.5e-56	59.8
WP_003642585.1\|2039422_2039908_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_015380738.1\|2039891_2041022_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_015380737.1\|2041024_2041756_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.2e-37	38.6
WP_003642588.1\|2041757_2042012_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_015380736.1\|2042011_2042692_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_064522672.1\|2042684_2044904_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-143	38.9
WP_027822324.1\|2044888_2046343_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.3e-50	33.8
WP_015380733.1\|2046339_2047365_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.2e-59	41.0
WP_003645867.1\|2047357_2047936_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_011101892.1\|2047937_2049470_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	E3SNU8	Prochlorococcus_phage	6.7e-46	52.9

DBSCAN-SWA_140

2055755 : 2058748

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645873.1\|2055755_2057039_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.1e-45	30.7
WP_003645874.1\|2057407_2058748_-	purine permease	Q9KX94	Enterobacteria_phage	1.4e-34	28.6

DBSCAN-SWA_141

2062236 : 2065547

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101888.1\|2062236_2063172_+	aspartate carbamoyltransferase	M1HGA5	Paramecium_bursaria_Chlorella_virus	6.5e-28	32.7
WP_160248336.1\|2063175_2064468_+	dihydroorotase	NA	NA	NA	NA
WP_160248338.1\|2064464_2065547_+	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	8.0e-54	34.9

DBSCAN-SWA_142

2076149 : 2079899

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825811.1\|2076149_2079899_+	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	1.3e-13	22.6

DBSCAN-SWA_143

2087407 : 2092667

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380714.1\|2087407_2088892_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	1.4e-77	37.5
WP_003642623.1\|2089009_2089357_-	SdpI family protein	NA	NA	NA	NA
WP_015380713.1\|2089764_2090709_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_013355818.1\|2090794_2091172_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003645896.1\|2091503_2092667_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	1.1e-56	33.7

DBSCAN-SWA_144

2099956 : 2100613

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380711.1\|2099956_2100613_+	HD domain-containing protein	S4W232	Pandoravirus	4.6e-12	31.2

DBSCAN-SWA_145

2118573 : 2120931

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064522690.1\|2118573_2120931_+	cell wall hydrolase	A0A249Y0X5	Enterococcus_phage	2.2e-40	51.9

DBSCAN-SWA_146

2138414 : 2140503

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642672.1\|2138414_2139125_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-10	27.3
WP_003642673.1\|2139114_2139888_+	ABC transporter permease	NA	NA	NA	NA
WP_003642674.1\|2139948_2140503_-	cysteine hydrolase	G3MA16	Bacillus_virus	4.1e-30	40.5

DBSCAN-SWA_147

2151855 : 2152752

Lactobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642684.1\|2151855_2152752_-	ribonuclease	C1KFJ1	Lactobacillus_virus	5.5e-32	36.3

DBSCAN-SWA_148

2160527 : 2164857

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642695.1\|2160527_2162321_-	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	4.2e-07	26.4
WP_003646579.1\|2162703_2164857_-	LTA synthase family protein	W6LM83	Streptococcus_phage	2.7e-170	49.1

DBSCAN-SWA_149

2174444 : 2175269

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060417561.1\|2174444_2175269_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	3.6e-06	25.7

DBSCAN-SWA_150

2184368 : 2185088

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642716.1\|2184368_2185088_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	A0A1V0SIZ6	Klosneuvirus	3.5e-05	25.1

DBSCAN-SWA_151

2188126 : 2190887

Pacmanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380674.1\|2188126_2189197_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	4.1e-18	23.7
WP_015380673.1\|2189383_2189938_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_015380672.1\|2190113_2190887_+	TerC family protein	A0A068EP98	Bacillus_phage	1.0e-42	43.1

DBSCAN-SWA_152

2194561 : 2195344

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642726.1\|2194561_2195344_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	4.1e-07	27.2

DBSCAN-SWA_153

2199535 : 2200822

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248353.1\|2199535_2200822_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A0B5JD48	Pandoravirus	2.7e-08	24.0

DBSCAN-SWA_154

2209764 : 2212220

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380661.1\|2209764_2211318_+	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	9.5e-40	27.0
WP_086989537.1\|2211444_2212220_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_155

2224802 : 2228528

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646617.1\|2224802_2225531_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	37.1
WP_015380651.1\|2225527_2227051_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_011101808.1\|2227346_2228528_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	3.9e-46	29.9

DBSCAN-SWA_156

2235775 : 2237539

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380648.1\|2235775_2237539_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.8e-96	40.9

DBSCAN-SWA_157

2246741 : 2281851

Lactobacillus_phage(47.37%)

integrase,portal,tail,capsid,terminase

attL 2239446:2239460|attR 2263149:2263163

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2239446:2239460	attL	NA	NA	NA	NA
WP_064522727.1\|2246741_2247863_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	9.9e-47	32.4
WP_015380643.1\|2249530_2250196_-	hypothetical protein	NA	NA	NA	NA
WP_015380642.1\|2250192_2250555_-	hypothetical protein	NA	NA	NA	NA
WP_015380641.1\|2250558_2251422_-	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	3.2e-29	34.8
WP_043992873.1\|2252057_2252777_-	hypothetical protein	NA	NA	NA	NA
WP_043992872.1\|2252880_2253729_-	hypothetical protein	NA	NA	NA	NA
WP_043992871.1\|2253752_2254166_-	hypothetical protein	NA	NA	NA	NA
WP_015380637.1\|2254231_2254654_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.0e-12	35.1
WP_015380636.1\|2254668_2255172_-	helix-turn-helix transcriptional regulator	S6C481	Thermus_phage	2.2e-22	43.2
WP_043992870.1\|2255317_2255572_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_015380634.1\|2255750_2256056_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_015380633.1\|2256122_2256635_+	transcriptional regulator	D6PST4	Lactobacillus_phage	2.5e-29	44.7
WP_024272298.1\|2256702_2256873_+	hypothetical protein	NA	NA	NA	NA
WP_080125261.1\|2257023_2257410_+	hypothetical protein	NA	NA	NA	NA
WP_015380630.1\|2257406_2258306_+	recombinase RecT	E9LUM3	Lactobacillus_phage	7.9e-63	47.7
WP_080125258.1\|2258217_2259090_+	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	1.8e-72	49.2
WP_015380628.1\|2259170_2260079_+	DnaD domain protein	NA	NA	NA	NA
WP_003642800.1\|2260075_2260363_+	hypothetical protein	NA	NA	NA	NA
WP_015380627.1\|2260359_2260878_+	hypothetical protein	O03915	Lactobacillus_phage	3.5e-55	68.4
WP_013355743.1\|2260874_2261255_+	endodeoxyribonuclease	NA	NA	NA	NA
WP_003642805.1\|2261465_2261927_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_015380625.1\|2262191_2262809_-	hypothetical protein	NA	NA	NA	NA
WP_015380624.1\|2263705_2263903_+	hypothetical protein	NA	NA	NA	NA
2263149:2263163	attR	NA	NA	NA	NA
WP_080125256.1\|2263880_2264057_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.4e-08	57.1
WP_160248359.1\|2264214_2264724_+	helix-turn-helix domain-containing protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8
WP_015380621.1\|2264704_2266030_+\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	1.7e-138	55.9
WP_144063632.1\|2266032_2267628_+\|portal	phage portal protein	B5LPR1	Bacillus_virus	3.8e-84	37.8
WP_015380619.1\|2267620_2268706_+\|capsid	Putative minor capsid protein	A0A059T7W2	Listeria_phage	6.2e-38	30.5
WP_015380618.1\|2268769_2269381_+	hypothetical protein	NA	NA	NA	NA
WP_015380617.1\|2269394_2270342_+\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.0e-89	59.5
WP_015380615.1\|2270701_2271106_+	hypothetical protein	A5GYM1	Lactococcus_phage	2.6e-05	27.5
WP_015380614.1\|2271106_2271496_+	hypothetical protein	NA	NA	NA	NA
WP_015380613.1\|2271492_2271894_+	hypothetical protein	NA	NA	NA	NA
WP_015380612.1\|2271893_2272319_+	hypothetical protein	NA	NA	NA	NA
WP_015380611.1\|2272336_2272954_+	hypothetical protein	NA	NA	NA	NA
WP_015380610.1\|2273072_2273591_+	hypothetical protein	NA	NA	NA	NA
WP_043992865.1\|2273587_2274229_+	hypothetical protein	O03936	Lactobacillus_phage	9.7e-07	26.7
WP_160248361.1\|2274244_2279893_+\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	2.2e-22	25.8
WP_015380607.1\|2279893_2280712_+\|tail	phage tail family protein	NA	NA	NA	NA
WP_015380606.1\|2280723_2281851_+	hypothetical protein	O03938	Lactobacillus_phage	6.8e-72	42.0

DBSCAN-SWA_158

2285001 : 2294690

Lactobacillus_phage(71.43%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380600.1\|2285001_2286369_+	hypothetical protein	A0A2K9VCK7	Lactobacillus_phage	2.6e-33	47.1
WP_015380599.1\|2286365_2286611_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.4e-17	84.2
WP_015380598.1\|2286622_2287795_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	2.0e-199	89.0
WP_015380597.1\|2287795_2288092_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.2e-39	77.6
WP_015380596.1\|2288078_2288456_+\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	3.2e-18	71.2
WP_043992864.1\|2289376_2290228_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_011101730.1\|2290450_2290843_+	YxeA family protein	NA	NA	NA	NA
WP_003644665.1\|2291070_2292801_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_003641422.1\|2292800_2294690_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1

DBSCAN-SWA_159

2298021 : 2299041

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021356211.1\|2298021_2299041_+	serine hydrolase	A0A249XPW4	Mycobacterium_phage	4.1e-07	24.2

DBSCAN-SWA_160

2302677 : 2310960

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644660.1\|2302677_2303256_+	thymidine kinase	A0A249XZX5	Enterococcus_phage	7.3e-46	49.7
WP_003641433.1\|2303269_2304352_+	peptide chain release factor 1	NA	NA	NA	NA
WP_160248365.1\|2304344_2305211_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_015380590.1\|2305501_2306521_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	7.1e-52	41.5
WP_003641436.1\|2306579_2307818_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.4e-94	50.6
WP_003639227.1\|2307897_2308527_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003645418.1\|2308844_2309018_-	hypothetical protein	NA	NA	NA	NA
WP_015825748.1\|2309679_2310960_+	uracil transporter	Q9KX94	Enterobacteria_phage	9.2e-65	37.1

DBSCAN-SWA_161

2321772 : 2325335

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644657.1\|2321772_2322045_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	9.8e-17	47.7
WP_003641449.1\|2322028_2322256_+	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_003644656.1\|2322403_2323609_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_043992860.1\|2323639_2323936_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_003641452.1\|2324303_2325335_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-28	36.4

DBSCAN-SWA_162

2337248 : 2338529

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641463.1\|2337248_2338529_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	9.7e-99	47.8

DBSCAN-SWA_163

2351669 : 2354339

Catovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380573.1\|2351669_2354339_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.1e-163	43.2

DBSCAN-SWA_164

2361961 : 2362603

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641493.1\|2361961_2362603_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-30	39.6

DBSCAN-SWA_165

2366050 : 2367316

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380569.1\|2366050_2367316_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	5.5e-54	32.5

DBSCAN-SWA_166

2371822 : 2383267

Bacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248376.1\|2371822_2372965_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	8.6e-123	65.6
WP_003644638.1\|2373195_2374755_+	ribonuclease Y	NA	NA	NA	NA
WP_003641506.1\|2374879_2375686_+	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_003641507.1\|2375713_2378404_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	6.9e-38	23.1
WP_043992855.1\|2378571_2380608_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.1e-56	29.4
WP_071542669.1\|2381091_2381271_-	hypothetical protein	NA	NA	NA	NA
WP_071542858.1\|2381261_2381477_-	hypothetical protein	NA	NA	NA	NA
WP_160248378.1\|2381581_2383267_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	1.1e-89	40.6

DBSCAN-SWA_167

2388648 : 2406232

Bacillus_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641514.1\|2388648_2389659_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	9.6e-09	29.6
WP_003641515.1\|2389676_2390711_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003641516.1\|2391020_2392163_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.0e-83	42.9
WP_003645451.1\|2392240_2392624_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_003641518.1\|2392753_2393887_+	DNA polymerase IV	NA	NA	NA	NA
WP_160248382.1\|2393979_2394936_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003645450.1\|2394938_2396282_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-46	31.6
WP_003645449.1\|2396609_2399252_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	1.5e-61	32.0
WP_003641523.1\|2399638_2399908_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_003641524.1\|2399904_2400339_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003641525.1\|2400351_2400648_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_003645448.1\|2400779_2401031_+	cell division protein ZapA	NA	NA	NA	NA
WP_016511478.1\|2401090_2403454_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	8.5e-24	53.1
WP_003641528.1\|2403609_2403921_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.2e-16	45.8
WP_003641529.1\|2404088_2404772_-	YslB family protein	NA	NA	NA	NA
WP_003645446.1\|2404809_2405631_+	glutamate racemase	NA	NA	NA	NA
WP_003641531.1\|2405623_2406232_+	XTP/dITP diphosphatase	X5LRP0	Ugandan_cassava_brown_streak_virus	6.8e-10	28.6

DBSCAN-SWA_168

2426043 : 2426652

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822798.1\|2426043_2426652_+	metallophosphatase	H6W7Z4	Escherichia_phage	4.4e-09	37.5

DBSCAN-SWA_169

2431103 : 2431688

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641564.1\|2431103_2431688_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	8.5e-26	44.2

DBSCAN-SWA_170

2458755 : 2461143

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645941.1\|2458755_2461143_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	2.4e-82	47.9

DBSCAN-SWA_171

2477228 : 2480027

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380541.1\|2477228_2480027_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	6.2e-90	27.8

DBSCAN-SWA_172

2493556 : 2503966

Virus_Rctr197k(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_120787341.1\|2493556_2496106_+	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	2.8e-49	29.1
WP_003645927.1\|2496260_2497226_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.5e-38	33.0
WP_003645926.1\|2497585_2499076_+	peptidoglycan endopeptidase	D2KRB9	Lactobacillus_phage	2.5e-13	42.6
WP_003645925.1\|2499249_2499453_+	hypothetical protein	NA	NA	NA	NA
WP_003645924.1\|2499674_2500634_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	3.8e-15	29.7
WP_003640828.1\|2500696_2502373_-	ribonuclease J	NA	NA	NA	NA
WP_003640827.1\|2502369_2502588_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_003640826.1\|2502869_2503376_+	hypothetical protein	NA	NA	NA	NA
WP_003645922.1\|2503405_2503966_-	peptide deformylase	A0A2I7S809	Vibrio_phage	1.0e-12	36.5

DBSCAN-SWA_173

2507723 : 2509136

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640822.1\|2507723_2509136_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.8e-46	28.3

DBSCAN-SWA_174

2525839 : 2528738

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640809.1\|2525839_2526331_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.3e-23	37.6
WP_015380528.1\|2526323_2527370_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_015380527.1\|2527472_2528198_+	ComE operon protein 1, DNA receptor	NA	NA	NA	NA
WP_003645663.1\|2528252_2528738_+	ComE operon protein 2	A7KUY9	Bacillus_phage	1.2e-33	55.3

DBSCAN-SWA_175

2538234 : 2546852

Hokovirus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640798.1\|2538234_2539422_+	elongation factor Tu	A0A1V0SGC3	Hokovirus	2.5e-32	29.7
WP_003645655.1\|2539625_2540948_+	trigger factor	NA	NA	NA	NA
WP_003640796.1\|2541242_2542508_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.6e-141	58.9
WP_003640795.1\|2542666_2543260_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003640794.1\|2543261_2543558_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1S7FYY8	Listeria_phage	2.9e-22	51.6
WP_003644577.1\|2543804_2544212_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_003640792.1\|2544267_2544438_-	hypothetical protein	NA	NA	NA	NA
WP_003640791.1\|2544643_2546119_+	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_003640790.1\|2546111_2546852_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-31	36.1

DBSCAN-SWA_176

2551530 : 2552472

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640785.1\|2551530_2552472_+	SDR family NAD(P)-dependent oxidoreductase	A0A1V0SAI6	Catovirus	7.0e-38	35.2

DBSCAN-SWA_177

2563486 : 2564242

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248397.1\|2563486_2564242_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.4e-22	31.8

DBSCAN-SWA_178

2568769 : 2571643

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380514.1\|2568769_2571106_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	3.0e-74	31.4
WP_003640768.1\|2571124_2571643_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	9.5e-29	42.1

DBSCAN-SWA_179

2578280 : 2613269

Lactobacillus_phage(91.89%)

portal,tail,protease,head,capsid,holin,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043992828.1\|2578280_2578481_-	hypothetical protein	E9LUS6	Lactobacillus_phage	5.5e-25	97.0
WP_015380507.1\|2578662_2579361_-	hypothetical protein	Q9AZW5	Lactococcus_phage	2.1e-18	36.8
WP_027822123.1\|2579369_2579756_-	hypothetical protein	NA	NA	NA	NA
WP_015380505.1\|2579813_2580092_-	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
WP_043992826.1\|2580101_2580440_-	helix-turn-helix transcriptional regulator	Q8W5Y0	Listeria_phage	1.0e-15	42.2
WP_015380504.1\|2580687_2580909_+	hypothetical protein	NA	NA	NA	NA
WP_120787352.1\|2580914_2581622_+	phage regulatory protein	D2IYT0	Enterococcus_phage	6.8e-70	62.2
WP_003641364.1\|2581633_2581843_+	hypothetical protein	NA	NA	NA	NA
WP_015380501.1\|2581958_2582285_-	hypothetical protein	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
WP_015380500.1\|2582342_2582603_+	hypothetical protein	NA	NA	NA	NA
WP_015380499.1\|2582745_2582994_+	hypothetical protein	E9LUT6	Lactobacillus_phage	1.9e-35	84.1
WP_015380498.1\|2582996_2583197_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.7e-26	89.4
WP_043992823.1\|2583208_2583433_+	hypothetical protein	E9LUT8	Lactobacillus_phage	1.2e-28	86.3
WP_043992822.1\|2583651_2583909_+	hypothetical protein	NA	NA	NA	NA
WP_015380497.1\|2584015_2584819_+	hypothetical protein	E9LUM6	Lactobacillus_phage	6.4e-40	56.9
WP_043992819.1\|2584812_2585688_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	2.2e-49	41.6
WP_015380494.1\|2586150_2586462_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	6.1e-47	88.3
WP_015380493.1\|2586572_2587178_+	hypothetical protein	E9LUN9	Lactobacillus_phage	3.1e-111	95.0
WP_160248399.1\|2587251_2587401_+	hypothetical protein	NA	NA	NA	NA
WP_043992815.1\|2587424_2587826_+	hypothetical protein	K4I239	Lactobacillus_phage	5.5e-32	54.5
WP_160248401.1\|2587898_2588324_+	DUF1642 domain-containing protein	E9LUP3	Lactobacillus_phage	2.2e-39	61.7
WP_015380489.1\|2588826_2589255_+	phage transcriptional activator RinA	E9LUP5	Lactobacillus_phage	1.1e-65	86.5
WP_015380487.1\|2589588_2589768_+	hypothetical protein	E9LUP6	Lactobacillus_phage	3.1e-19	86.4
WP_043992814.1\|2589736_2590246_+	HNH endonuclease	E9LUP7	Lactobacillus_phage	2.2e-78	91.5
WP_064522844.1\|2590443_2590899_+\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	9.4e-81	97.4
WP_160248403.1\|2590908_2592807_+\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	93.8
WP_015380483.1\|2592796_2592991_+	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	3.7e-26	93.8
WP_015380482.1\|2592993_2594187_+\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	3.1e-224	98.7
WP_015380481.1\|2594164_2594920_+\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	3.9e-124	93.2
WP_015380480.1\|2594919_2596152_+\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.3e-213	94.1
WP_015380479.1\|2596224_2596563_+\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	5.8e-51	91.1
WP_015380478.1\|2596546_2596909_+\|head	phage head closure protein	E9LUQ5	Lactobacillus_phage	6.4e-64	97.5
WP_015380473.1\|2597220_2597412_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	98.4
WP_160248405.1\|2597424_2602647_+\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	71.5
WP_015380471.1\|2602718_2604491_+	hypothetical protein	E9LUR2	Lactobacillus_phage	0.0e+00	96.6
WP_064522848.1\|2604557_2606927_+	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	92.9
WP_015380469.1\|2606943_2609742_+	hypothetical protein	E9LUR4	Lactobacillus_phage	2.1e-223	73.3
WP_015380468.1\|2609734_2609977_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	6.2e-31	92.5
WP_015380466.1\|2610125_2611223_+	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	8.1e-62	87.1
WP_015380465.1\|2611219_2611432_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.0e-17	80.3
WP_015380464.1\|2611443_2612622_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.9e-200	89.0
WP_003644510.1\|2612621_2612885_+\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
WP_015380463.1\|2612894_2613269_+	nitrate/sulfonate/bicarbonate ABC transporter permease	A0A2K9VCG4	Lactobacillus_phage	2.6e-20	76.2

DBSCAN-SWA_180

2617506 : 2621828

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645638.1\|2617506_2618298_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_003644505.1\|2618278_2619463_+	LCP family protein	NA	NA	NA	NA
WP_003645636.1\|2619614_2620187_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_160248407.1\|2620886_2621828_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	1.8e-78	48.7

DBSCAN-SWA_181

2625729 : 2630021

Phage_Wrath(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640747.1\|2625729_2626362_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|2626513_2626753_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640745.1\|2626850_2627087_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|2627143_2627779_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003645629.1\|2627890_2628649_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_015380454.1\|2628632_2628938_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|2629022_2630021_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9

DBSCAN-SWA_182

2634648 : 2635428

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640735.1\|2634648_2635428_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1

DBSCAN-SWA_183

2639786 : 2649340

Bradyrhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380449.1\|2639786_2644100_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|2644395_2644872_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640727.1\|2644892_2646110_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|2646154_2646454_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|2646443_2646749_+	hypothetical protein	NA	NA	NA	NA
WP_003645962.1\|2646763_2649340_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3

DBSCAN-SWA_184

2661684 : 2674177

Tupanvirus(33.33%)

integrase

attL 2661646:2661661|attR 2675650:2675665

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2661646:2661661	attL	NA	NA	NA	NA
WP_003640711.1\|2661684_2663553_+	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	7.7e-137	47.2
WP_003640710.1\|2663654_2664797_+	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
WP_003645971.1\|2665230_2666406_+	serine hydrolase	NA	NA	NA	NA
WP_003640708.1\|2666437_2666587_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_003640707.1\|2666629_2668156_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	7.6e-42	27.6
WP_015380443.1\|2668152_2669367_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	5.5e-27	30.5
WP_003640705.1\|2669390_2669633_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003640704.1\|2669629_2670907_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003640703.1\|2671070_2672906_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-23	26.1
WP_015380442.1\|2673022_2674177_-\|integrase	site-specific integrase	A0A0A8WIE1	Clostridium_phage	2.5e-98	44.7
2675650:2675665	attR	NA	NA	NA	NA

DBSCAN-SWA_185

2679663 : 2696851

Salmonella_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640696.1\|2679663_2681931_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	2.4e-07	43.6
WP_003640695.1\|2681940_2682387_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003645975.1\|2682459_2683083_+	HAD family hydrolase	NA	NA	NA	NA
WP_015380437.1\|2683190_2684033_-	phosphotransferase	NA	NA	NA	NA
WP_003645977.1\|2684301_2685150_-	SH3 domain-containing protein	C8CHK8	Thermus_virus	3.0e-11	38.9
WP_003640691.1\|2685540_2686821_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_015380436.1\|2686862_2688659_+\|tRNA	aspartate--tRNA ligase	A0A1V0SFI4	Hokovirus	3.0e-05	30.2
WP_003644477.1\|2688739_2689270_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003640688.1\|2689472_2690348_+	YitT family protein	M1Q1P6	Streptococcus_phage	5.9e-23	29.7
WP_015380435.1\|2690721_2691882_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_160248415.1\|2691994_2692891_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	7.4e-21	30.3
WP_015380433.1\|2692948_2693674_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003640684.1\|2693816_2694635_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_003638914.1\|2694867_2695056_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_003640683.1\|2695097_2695541_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.5e-17	35.6
WP_003644473.1\|2695873_2696851_+	PhoH family protein	L7TP00	Rhizobium_phage	2.2e-50	49.3

DBSCAN-SWA_186

2703058 : 2706127

Helicobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248416.1\|2703058_2704939_+	DNA primase	A0A1S5RH72	Helicobacter_phage	9.4e-50	30.1
WP_003640674.1\|2705020_2706127_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.7e-38	37.4

DBSCAN-SWA_187

2711116 : 2712016

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380426.1\|2711116_2712016_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	8.8e-30	35.6

DBSCAN-SWA_188

2715999 : 2716887

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645994.1\|2715999_2716887_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-21	31.0

DBSCAN-SWA_189

2728886 : 2729661

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|2728886_2729661_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_190

2748735 : 2752369

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646019.1\|2748735_2750025_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	8.3e-106	51.2
WP_015380403.1\|2750092_2752369_+	HAD-IC family P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.8e-32	23.9

DBSCAN-SWA_191

2757932 : 2762106

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380400.1\|2757932_2760329_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	7.9e-118	31.5
WP_003644447.1\|2760483_2760990_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003646029.1\|2761164_2762106_+	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-26	33.9

DBSCAN-SWA_192

2767865 : 2775038

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646034.1\|2767865_2770469_+	ATP-dependent chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.9e-125	34.0
WP_003640606.1\|2771126_2771327_-	YjzD family protein	NA	NA	NA	NA
WP_003646035.1\|2771687_2775038_+	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	6.4e-150	32.8

DBSCAN-SWA_193

2780341 : 2787378

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644441.1\|2780341_2781232_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	4.6e-39	33.3
WP_160248420.1\|2781270_2781654_+	N-acetyltransferase	NA	NA	NA	NA
WP_003640597.1\|2781619_2782387_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-09	23.3
WP_015380396.1\|2782373_2782973_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.2e-11	31.7
WP_003640595.1\|2782972_2783689_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_003644438.1\|2783988_2784573_+	ECF transporter S component	NA	NA	NA	NA
WP_015380395.1\|2784908_2785952_+	hypothetical protein	NA	NA	NA	NA
WP_015380394.1\|2785938_2787378_+	ATP-dependent DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	5.1e-56	38.9

DBSCAN-SWA_194

2791867 : 2792143

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640587.1\|2791867_2792143_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	6.8e-26	69.7

DBSCAN-SWA_195

2795626 : 2805354

unidentified_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380389.1\|2795626_2796850_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.3e-44	50.0
WP_003640581.1\|2796906_2797359_+	hypothetical protein	NA	NA	NA	NA
WP_015380388.1\|2797540_2799439_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	8.6e-51	28.4
WP_003640579.1\|2799451_2800402_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.8e-116	61.5
WP_003640578.1\|2800411_2800903_+	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	9.4e-18	37.9
WP_003640577.1\|2801009_2801861_+	DegV family protein	NA	NA	NA	NA
WP_043993018.1\|2802011_2802956_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003640575.1\|2802968_2803613_+	YpmS family protein	NA	NA	NA	NA
WP_015380386.1\|2803624_2803846_+	YozE family protein	NA	NA	NA	NA
WP_003640573.1\|2803875_2805354_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.8e-19	29.9

DBSCAN-SWA_196

2810595 : 2829483

Bacillus_virus(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355560.1\|2810595_2811525_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.5e-05	33.8
WP_003640567.1\|2811714_2812863_+	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	1.6e-47	33.2
WP_015380382.1\|2813415_2814270_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_015380381.1\|2814262_2815030_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	7.5e-22	35.6
WP_160248422.1\|2815108_2815975_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_003645027.1\|2816063_2818211_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.1e-102	37.3
WP_015380379.1\|2818489_2819815_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_003640561.1\|2819894_2820839_+	tyrosine recombinase XerC	S5M872	Bacillus_phage	4.2e-14	26.5
WP_003638820.1\|2820822_2821365_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_003640560.1\|2821382_2822801_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IDZ7	Erwinia_phage	2.1e-30	27.9
WP_003640559.1\|2822827_2823706_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_003644419.1\|2823901_2824528_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640557.1\|2825012_2827019_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.6e-124	42.7
WP_015380376.1\|2827032_2829483_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	8.1e-94	31.9

DBSCAN-SWA_197

2839661 : 2840993

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248482.1\|2839661_2840993_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-27	26.1

DBSCAN-SWA_198

2865724 : 2866624

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511704.1\|2865724_2866624_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-37	40.9

DBSCAN-SWA_199

2869843 : 2872228

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004271307.1\|2869843_2870767_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9
WP_015380351.1\|2871107_2871518_+	hypothetical protein	NA	NA	NA	NA
WP_160248424.1\|2871628_2872228_-	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	2.5e-33	39.3

DBSCAN-SWA_200

2876764 : 2877688

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101547.1\|2876764_2877688_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.2e-10	29.1

DBSCAN-SWA_201

2884591 : 2891959

Aureococcus_anophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248425.1\|2884591_2885269_-	ATP-binding cassette domain-containing protein	A0A076FI99	Aureococcus_anophage	2.1e-07	28.9
WP_003645067.1\|2885268_2886021_-	hypothetical protein	NA	NA	NA	NA
WP_015640385.1\|2886168_2887227_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_003645069.1\|2887308_2888652_-	glycosyl hydrolase family 25	A0A2P0ZKX1	Lactobacillus_phage	2.9e-37	32.2
WP_015640382.1\|2889385_2890465_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_015380342.1\|2890618_2891959_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.7e-05	31.9

DBSCAN-SWA_202

2897586 : 2902335

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640485.1\|2897586_2898156_-	DUF1273 domain-containing protein	U5J9F7	Bacillus_phage	8.6e-07	25.9
WP_003644374.1\|2898270_2898894_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	3.2e-23	38.7
WP_015380338.1\|2898905_2901197_+	penicillin-binding protein	NA	NA	NA	NA
WP_003645078.1\|2901381_2902335_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-21	34.0

DBSCAN-SWA_203

2907298 : 2915713

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380332.1\|2907298_2908366_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.6e-30	37.5
WP_011101531.1\|2908739_2908946_-	hypothetical protein	NA	NA	NA	NA
WP_015380331.1\|2909001_2909727_-	DnaD domain protein	A0A0N7AE27	Bacillus_phage	7.4e-11	40.4
WP_003640473.1\|2909804_2911103_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	3.0e-55	29.1
WP_003640472.1\|2911120_2912326_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_080125243.1\|2912342_2912843_-	hypothetical protein	NA	NA	NA	NA
WP_003645087.1\|2912908_2915713_-	ATP-dependent helicase DinG	A0A127AW80	Bacillus_phage	5.2e-36	24.1

DBSCAN-SWA_204

2931106 : 2934475

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644352.1\|2931106_2932456_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-18	24.0
WP_015380323.1\|2932893_2933166_-	hypothetical protein	NA	NA	NA	NA
WP_003640454.1\|2933305_2933605_-	hypothetical protein	NA	NA	NA	NA
WP_003640453.1\|2933698_2934475_-	potassium channel family protein	A0A1B0Y2S3	Lactobacillus_phage	1.4e-23	35.0

DBSCAN-SWA_205

2941060 : 2941836

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086989537.1\|2941060_2941836_-\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

DBSCAN-SWA_206

2945922 : 2948728

Apis_mellifera_filamentous_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640437.1\|2945922_2946528_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.0e-15	32.1
WP_160248427.1\|2947555_2948728_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	1.9e-40	37.8

DBSCAN-SWA_207

2979217 : 2985861

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825530.1\|2979217_2980000_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	7.6e-30	34.3
WP_003640394.1\|2979996_2981016_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	2.9e-53	38.8
WP_003640393.1\|2981040_2981616_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.6e-35	39.1
WP_015380291.1\|2981599_2983036_-	anthranilate synthase component I family protein	S4VT78	Pandoravirus	8.3e-22	32.8
WP_015380290.1\|2983508_2985104_-	hypothetical protein	NA	NA	NA	NA
WP_015380289.1\|2985096_2985861_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.7e-21	27.7

DBSCAN-SWA_208

2996295 : 2996766

Pseudoalteromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380280.1\|2996295_2996766_-	alcohol dehydrogenase	M4SQJ2	Pseudoalteromonas_phage	4.2e-07	46.3

DBSCAN-SWA_209

3014560 : 3015256

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640377.1\|3014560_3015256_-	ribonuclease III	A0A1V0SDK0	Indivirus	2.7e-18	33.0

DBSCAN-SWA_210

3024412 : 3038331

Noumeavirus(20.0%)

holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645152.1\|3024412_3026437_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1Q1PNS5	Noumeavirus	2.9e-20	30.5
WP_003640367.1\|3026433_3027180_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_015380274.1\|3027197_3028541_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_003645154.1\|3028537_3029491_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.7e-10	31.4
WP_016511359.1\|3029514_3031932_-	primosomal protein N'	NA	NA	NA	NA
WP_043993016.1\|3031954_3033181_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.6e-40	33.1
WP_003640362.1\|3033344_3033557_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003640361.1\|3033553_3034174_-	guanylate kinase	A0A0M5KCK5	Mollivirus	1.4e-10	33.6
WP_003645156.1\|3034366_3034702_+	hypothetical protein	NA	NA	NA	NA
WP_003640359.1\|3034907_3035561_-	ABC transporter permease	NA	NA	NA	NA
WP_160248434.1\|3035560_3036496_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003644316.1\|3036508_3037138_-	ABC transporter permease	NA	NA	NA	NA
WP_043992759.1\|3037134_3038331_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.0e-17	46.2

DBSCAN-SWA_211

3042981 : 3045178

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380268.1\|3042981_3044325_-	exodeoxyribonuclease VII large subunit	A0A160DEV2	Gordonia_phage	6.7e-26	30.8
WP_003645162.1\|3044317_3045178_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.1e-32	40.1

DBSCAN-SWA_212

3057680 : 3058415

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640330.1\|3057680_3058415_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	4.5e-16	44.3

DBSCAN-SWA_213

3071053 : 3071683

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640313.1\|3071053_3071683_-	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	39.6

DBSCAN-SWA_214

3075479 : 3076526

Bodo_saltans_virus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644299.1\|3075479_3076526_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.0e-26	37.9

DBSCAN-SWA_215

3082392 : 3092526

Bacillus_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380255.1\|3082392_3085578_+	SMC family ATPase	G3MAB6	Bacillus_virus	6.3e-06	20.9
WP_160248442.1\|3085712_3086681_-	1,4-dihydroxy-2-naphthoate prenyltransferase	NA	NA	NA	NA
WP_015380253.1\|3087051_3088695_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.2e-22	28.7
WP_003638551.1\|3088694_3089381_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-30	32.4
WP_003640299.1\|3089571_3090921_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.3e-85	42.8
WP_003645183.1\|3091089_3092526_-	NADP-dependent phosphogluconate dehydrogenase	M4SJX8	Cyanophage	2.6e-28	29.3

DBSCAN-SWA_216

3107148 : 3120773

Bacillus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380242.1\|3107148_3108411_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.0e-68	38.6
WP_015380241.1\|3108582_3108894_-	hypothetical protein	NA	NA	NA	NA
WP_003640279.1\|3109136_3109493_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003638526.1\|3109529_3109724_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_003644288.1\|3109745_3110267_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.9e-16	38.0
WP_003644287.1\|3110488_3112453_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	3.4e-103	34.4
WP_003644286.1\|3112785_3113721_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	2.8e-26	30.3
WP_043992744.1\|3113724_3115128_-	helicase DnaB	NA	NA	NA	NA
WP_003640274.1\|3115149_3115665_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_003645195.1\|3115706_3116300_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_015380239.1\|3116309_3117134_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	8.9e-29	33.0
WP_043992742.1\|3117145_3119794_-	DNA polymerase I	F8WQ35	Bacillus_phage	8.9e-46	35.1
WP_003640270.1\|3120056_3120773_-	Bax inhibitor-1/YccA family protein	A2VCJ8	Vaccinia_virus	2.9e-07	25.2

DBSCAN-SWA_217

3124712 : 3128046

environmental_halophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380235.1\|3124712_3125951_-	cysteine desulfurase	Q2XUY6	environmental_halophage	3.6e-106	46.4
WP_160248451.1\|3125934_3127236_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_003640263.1\|3127248_3128046_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.8e-10	25.5

DBSCAN-SWA_218

3132358 : 3135253

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248453.1\|3132358_3135253_-	cell division protein FtsK	A0A218M9A2	Mycobacterium_phage	2.3e-87	49.7

DBSCAN-SWA_219

3139394 : 3140132

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644277.1\|3139394_3140132_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-20	27.8

DBSCAN-SWA_220

3150194 : 3157850

Staphylococcus_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380228.1\|3150194_3151511_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-08	25.0
WP_003640242.1\|3151664_3152291_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011101408.1\|3152426_3153068_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_015380227.1\|3153156_3153720_+	hypothetical protein	NA	NA	NA	NA
WP_003640239.1\|3153896_3154457_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003640238.1\|3154487_3154967_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.1e-34	47.3
WP_015380226.1\|3154963_3156178_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.8e-84	46.4
WP_003640236.1\|3156179_3156782_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.8e-23	38.9
WP_003644273.1\|3156782_3157850_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-38	32.8

DBSCAN-SWA_221

3163560 : 3173398

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|3163560_3164556_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|3165182_3165320_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003643094.1\|3165415_3165856_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643095.1\|3165926_3166487_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_015380220.1\|3166574_3169013_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_160248458.1\|3169015_3169630_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	3.1e-111	99.5
WP_003643099.1\|3169973_3170921_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_015640259.1\|3171106_3172078_+	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_015640258.1\|3172168_3173398_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.7e-215	97.7

DBSCAN-SWA_222

3196555 : 3201190

Planktothrix_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043992731.1\|3196555_3198550_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.3e-35	40.4
WP_003645237.1\|3198819_3199296_+	hypothetical protein	NA	NA	NA	NA
WP_003645238.1\|3199501_3201190_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9

DBSCAN-SWA_223

3209450 : 3211252

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_160248463.1\|3209450_3210074_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	2.2e-27	41.2
WP_003645244.1\|3210076_3211252_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	1.4e-48	31.7

DBSCAN-SWA_224

3222138 : 3223962

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380198.1\|3222138_3222423_-	hypothetical protein	A0A2P0ZLE8	Lactobacillus_phage	2.0e-41	96.8
WP_015380197.1\|3222422_3222632_-	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.3e-08	58.0
WP_015380196.1\|3222637_3223018_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	7.2e-50	75.2
WP_015380194.1\|3223470_3223962_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	1.6e-49	65.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028337

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028338

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP028336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP028334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection