CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045672	Bacillus subtilis strain 2014-3557 chromosome, complete genome	3 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	12	0
NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	1 crisprs	NA	0	2	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045672_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045672_1

917031-917136

Orphan

Consensus_repeat	Method
AGAAAACAAAACCAACAATCAGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045672_1

>merge|NZ_CP045672|1|917031-917136|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTGCTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTCAGAAAACAAAACCAGCAATCAGCTG

>NZ_CP045672|1|1|917031-917136|CRISPRCasFinder
AGAAAACAAAACCAACAATCAGCTG	CTGGTCAAGGTCAATTTGGCACTGAATTTGCTAGCGAAACAAACGCTCAGCAAGTC
AGAAAACAAAACCAGCAATCAGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045672.1\|WP_003243419.1\|908810_909671_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP045672.1\|WP_003233542.1\|915858_916083_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045672.1\|WP_003242803.1\|908491_908824_+\|SdpC-immunity-protein-SpdL	unknown	unknown	gnl\|CDD\|227945
NZ_CP045672.1\|WP_003223262.1\|916164_916917_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	unknown	unknown	gnl\|CDD\|236145
NZ_CP045672.1\|WP_003244136.1\|913542_914526_-\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|224899
NZ_CP045672.1\|WP_003223285.1\|923572_924010_+\|peroxide-responsive-transcriptional-repressor-PerR	unknown	unknown	gnl\|CDD\|223806
NZ_CP045672.1\|WP_003243789.1\|907474_907744_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379438
NZ_CP045672.1\|WP_003223272.1\|917816_918347_+\|DUF402-domain-containing-protein	unknown	unknown	gnl\|CDD\|184219
NZ_CP045672.1\|WP_003233537.1\|920253_921315_-\|aromatic-acid-exporter-family-protein	unknown	unknown	gnl\|CDD\|226614
NZ_CP045672.1\|WP_003244113.1\|909903_910893_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133030
NZ_CP045672.1\|WP_009968853.1\|917328_917673_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372951
NZ_CP045672.1\|WP_003243536.1\|924044_924398_-\|YgzB-family-protein	unknown	unknown	gnl\|CDD\|371346
NZ_CP045672.1\|WP_003243727.1\|924605_925490_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379641
NZ_CP045672.1\|WP_003233481.1\|932455_933232_-\|sporulation-control-protein-Spo0M	unknown	unknown	gnl\|CDD\|226776
NZ_CP045672.1\|WP_003233532.1\|922976_923450_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP045672.1\|WP_009966836.1\|918434_920177_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP045672.1\|WP_003242872.1\|910964_913550_+\|YfhO-family-protein	unknown	unknown	gnl\|CDD\|226888
NZ_CP045672.1\|WP_003243363.1\|907888_908407_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP045672.1\|WP_003243838.1\|914741_915851_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|130156
NZ_CP045672.1\|WP_003233535.1\|921534_922824_-\|glutamate-1-semialdehyde-2,1-aminomutase	unknown	unknown	gnl\|CDD\|183493

Protein	Function_ID	Function_description	E-value
NZ_CP045672.1\|WP_003243419.1\|908810_909671_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.87358e-38
NZ_CP045672.1\|WP_003242872.1\|910964_913550_+\|YfhO-family-protein	gnl\|CDD\|226888	COG4485, COG4485, Predicted membrane protein [Function unknown].	0
NZ_CP045672.1\|WP_003242803.1\|908491_908824_+\|SdpC-immunity-protein-SpdL	gnl\|CDD\|227945	COG5658, COG5658, Predicted integral membrane protein [Function unknown].	1.0168e-26
NZ_CP045672.1\|WP_003223262.1\|916164_916917_+\|enoyl-[acyl-carrier-protein]-reductase-FabL	gnl\|CDD\|236145	PRK08063, PRK08063, enoyl-[acyl-carrier-protein] reductase FabL.	2.59874e-172
NZ_CP045672.1\|WP_003244136.1\|913542_914526_-\|metal-dependent-hydrolase	gnl\|CDD\|224899	COG1988, COG1988, Predicted membrane-bound metal-dependent hydrolases [General function prediction only].	2.00254e-44
NZ_CP045672.1\|WP_003223285.1\|923572_924010_+\|peroxide-responsive-transcriptional-repressor-PerR	gnl\|CDD\|223806	COG0735, Fur, Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism].	2.19115e-56
NZ_CP045672.1\|WP_003243789.1\|907474_907744_+\|hypothetical-protein	gnl\|CDD\|379438	pfam14043, WVELL, WVELL protein. This family includes the B. subtilis YfjH protein, which is functionally uncharacterized. This is not a homolog of E. coli YfjH, a synonym for IscX, which belongs to pfam04384. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length and contain a highly conserved WVELL motif.	4.98563e-41
NZ_CP045672.1\|WP_003223272.1\|917816_918347_+\|DUF402-domain-containing-protein	gnl\|CDD\|184219	PRK13662, PRK13662, hypothetical protein; Provisional.	7.36814e-127
NZ_CP045672.1\|WP_003233537.1\|920253_921315_-\|aromatic-acid-exporter-family-protein	gnl\|CDD\|226614	COG4129, COG4129, Predicted membrane protein [Function unknown].	2.49461e-90
NZ_CP045672.1\|WP_003244113.1\|909903_910893_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	2.54502e-85
NZ_CP045672.1\|WP_009968853.1\|917328_917673_+\|hypothetical-protein	gnl\|CDD\|372951	pfam14182, YgaB, YgaB-like protein. The YgaB-like protein family includes the B. subtilis YgaB protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 90 amino acids in length.	1.16495e-28
NZ_CP045672.1\|WP_003243536.1\|924044_924398_-\|YgzB-family-protein	gnl\|CDD\|371346	pfam11023, DUF2614, Zinc-ribbon containing domain. This is a family of proteins conserved in the Bacillaceae family. Some members are annotated as being protein YgzB. The function is not known.	3.8424e-68
NZ_CP045672.1\|WP_003243727.1\|924605_925490_+\|hypothetical-protein	gnl\|CDD\|379641	pfam14540, NTF-like, Nucleotidyltransferase-like. Structural comparisons with Structure 1kny indicate that this N-terminal domain resembles a nucleotidyltransferase fold.	1.16999e-58
NZ_CP045672.1\|WP_003233481.1\|932455_933232_-\|sporulation-control-protein-Spo0M	gnl\|CDD\|226776	COG4326, Spo0M, Sporulation control protein [General function prediction only].	1.87454e-155
NZ_CP045672.1\|WP_003233532.1\|922976_923450_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	6.45936e-86
NZ_CP045672.1\|WP_009966836.1\|918434_920177_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	0
NZ_CP045672.1\|WP_003243838.1\|914741_915851_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|130156	TIGR01084, A/G-specific_adenine_glycosylase, A/G-specific adenine glycosylase. This equivalog model identifies mutY members of the pfam00730 superfamily (HhH-GPD: Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate). The major members of the superfamily are nth and mutY. [DNA metabolism, DNA replication, recombination, and repair].	5.10517e-157
NZ_CP045672.1\|WP_003243363.1\|907888_908407_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	2.69836e-13
NZ_CP045672.1\|WP_003233535.1\|921534_922824_-\|glutamate-1-semialdehyde-2,1-aminomutase	gnl\|CDD\|183493	PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional.	0

>NZ_CP045672.1|WP_003223262.1|916164_916917_+|enoyl-[acyl-carrier-protein]-reductase-FabL
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVKANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFCAQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVNAVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTIIVDGGRSLLV
>NZ_CP045672.1|WP_003233542.1|915858_916083_-|hypothetical-protein
MYVGRDMSELNMVSKKDWKNSELAYFHHAFQQIMPYLNEEGQSKYRELTQEIEARGGMKRNEADYSHGTRVSYD
>NZ_CP045672.1|WP_003243838.1|914741_915851_+|A/G-specific-adenine-glycosylase
MNVLEDKLKQKDIQQFRDDLISWFEREQRVLPWREDQDPYKVWVSEVMLQQTRVETVIPYFLRFVEQFPTVEALADADEEKVLKAWEGLGYYSRVRNLQSAVKEVKQEYGGIVPPDEKDFGGLKGVGPYTKGAVLSIAYNKPIPAVDGNVMRVMSRILSIWDDIAKPKTRTIFEDAIRAFISKEKPSEFNQGLMELGALICTPKSPSCLLCPVQQHCSAFEEGTERELPVKSKKKKPGIKTMAAIVLTDEDGQVYIHKRPSKGLLANLWEFPNLETQKGIKTEREQLIAFLENEYGIQADISDLQGVVEHVFTHLVWNISVFFGKVKQVSDTSKLKKVTKEELEQFAFPVSHQKIWKMAGEAAAISAAP
>NZ_CP045672.1|WP_003244136.1|913542_914526_-|metal-dependent-hydrolase
MDTGTHVVMGIALGGIATLDPVVGSDPAMAHAVMIATLAGSQAPDIDTVLKLKNNAVYIRNHRGFTHSIPAVLFWSVIIPAILYLFYPQADFLHLWLWTLLAVVLHVFVDIFNAYGTQAIRPFSKKWVALGLINTFDPFIFISHLAAIAIWYAGGSPGITFLSLYIILVGYYLVRLIMQLRIKRKLHEMIHDEIESIIISPTMKFRQWRIAVTTAHAFYVGRSMEGHVVILDTFNRVPVPETDVMHAAKQDDNIAAFLSFSPVYRWEVDTFKDHYEVRFIDLRYRSKGHYPFVAIVHIGHDLTIRSSYTGWIFSEEKLQKKLKLGSI
>NZ_CP045672.1|WP_003242872.1|910964_913550_+|YfhO-family-protein
MKRKHIMIYAASLLVSVLAHAFFVKEWAEGRYMTGPGDGLAQMIVFKKLLFDQYTHGNFFYNYSFGLGGGTFSQLGYYFSASFLFLAVSAAVWLLQAVQLIGETDTLFWAESAVFISIFKLSLIIFTSASVFHYLLKHRAASFTGAVLYGVSIIYFRHEAYWEFFTDTMVWLPLLVLGAEKIIRERRPAWFIVACSLTLINNFYFAYINLIFIGIYVLFRWLIRLEPHEEKRWIQIRLFLVSGFISFGISAAAFVPVVYGFLNNLRPPYSQKIEWLNFDDNILFSSRIIIVPAAFLLFLFIISFYKNRVFRLFAGLSLLFILFHFSPYAASVFNGFSAPQNRFEYVLAFTIAGAAAAGLSQLSELKRKELLPAAAVVLLLYLYHIQRYKLDIWKPANESILLLLLMTIAALFAAAFAKKRAKMAVYGIIILSSLFVANSYQKYALSEGGDLDSVTKEYLTSEEYRGRESSELIRRLQKEDDDPLMRIDWMNGVRNNTPIIYGFNGFSAYSSILNKDLLAFYWNDLSIDMGRESVSRYASLGDRANLYSLLYGKYYMTEKTNEASVPYGFKKHLETEHYAVYENQYMLPFVKTADAIYSESELDRLPALAKEQAMLKGIILKDPSGKTEQTPKPSNLITKSDITAKQAQYQNGLLTVTGENGGELIITPKQPSSAPGDYYVSFYLKSKAKDKGFTLKVNDYVTTRKSNKSIYKTGVNNITVRVPKSGHISINLPKGTYELRNIALYEENYQTLKNAVMQNKTEKADKLNWNKNRLTFSYHLSKDQYIMLPIPYEKGWELKINGKTQKIEKADYAFIGFKAQKGDNHIELTYYPPYFKISAIISLVSLLLAVFYIRRKKPGSI
>NZ_CP045672.1|WP_003244113.1|909903_910893_+|glycosyltransferase-family-2-protein
MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAATCSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVIAQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSKGLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILLLSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPHYLIKEANIPNKDLPETNELKSMRRLTKMH
>NZ_CP045672.1|WP_003243419.1|908810_909671_+|alpha/beta-hydrolase
MDGVKCQFVNTNGITLHVAAAGREDGPLIVLLHGFPEFWYGWKNQIKPLVDAGYRVIAPDQRGYNLSDKPEGIDSYRIDTLRDDIIGLITQFTDEKAIVIGHDWGGAVAWHLASTRPEYLEKLIAINIPHPHVMKTVTPLYPPQWLKSSYIAYFQLPDIPEASLRENDYDTLDKAIGLSDRPALFTSEDVSRYKEAWKQPGALTAMLNWYRALRKGSLAEKPSYETVPYRMIWGMEDRFLSRKLAKETERHCPNGHLIFVDEASHWINHEKPAIVNQLILEYLKNQ
>NZ_CP045672.1|WP_003242803.1|908491_908824_+|SdpC-immunity-protein-SpdL
MTGLVGGGLMIIAGILIKLFPPKSINSVYGYRTRRSMSDQRLWNEANRYSASLMILSGLVIAGMGLLLGSNLFILQLILLIAACVITFMLTEKRLKIMTHSQGGDRSGRS
>NZ_CP045672.1|WP_003243363.1|907888_908407_+|SH3-domain-containing-protein
MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR
>NZ_CP045672.1|WP_003243789.1|907474_907744_+|hypothetical-protein
MNMYIEKLTNLLLEKNEMISYIQAKTWVELLWSDFEATYAKAGHAYQGEKMTEKIVTQWIENYGGQLHLFQSSRNDVNDYLNQSRGLLH
>NZ_CP045672.1|WP_009968853.1|917328_917673_+|hypothetical-protein
MSQRVCFMEIEMIKGGNVYTFIRLKEEPMTEFEKLVSEQMKTMDKLLDLQSELDRCKQIEAELRHLERDARLRGIQAEIAVKRKHLADIQDMFQKQTEQVIRSYRSSEKPSSFV
>NZ_CP045672.1|WP_003223272.1|917816_918347_+|DUF402-domain-containing-protein
MGYPKEGETIQIHSYKHNGLIHRIWNETTILKSTEMCVIGANDRTMVTESDGRTWITREPAICYFHARQWFNVIGMLREDGVHYYCNISSPFAYDGEAIKYIDYDLDVKVFPDMTYNILDEDEYDDHRKAMNYPKEIDSILRDYLNTLLHWIHQRQGPFAPEFVDMWYERYLRYTK
>NZ_CP045672.1|WP_009966836.1|918434_920177_+|ABC-transporter-ATP-binding-protein
MGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGGTASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLRFYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVLFPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKNGHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRMYNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYEKDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEARSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETRVGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTFVVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
>NZ_CP045672.1|WP_003233537.1|920253_921315_-|aromatic-acid-exporter-family-protein
MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANIIGAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMFALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILKEDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHRLENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFLKNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE
>NZ_CP045672.1|WP_003233535.1|921534_922824_-|glutamate-1-semialdehyde-2,1-aminomutase
MHTKSIELHNEALQHIVGGVNSPSRSYKAVGGGSPVAMEKASGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKKAAENGVLYGTPTKHEVTFAKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPKSIANEVITVPFNDIDSYKAALEKWGSEIAAVLVEPIVGNFGIVEPKEGFLEQVNELTHNAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGAYGGKQEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEKGVYEKLDHLGAMLEEGILKHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGETFSTFFKLMLERGINLAPSKYEAWFITTAHTEQDIKDTLTAVEDAFKHLKN
>NZ_CP045672.1|WP_003233532.1|922976_923450_+|thioredoxin-dependent-thiol-peroxidase
MTIEIGQKAPDLELKGDHGETVKLSDYKGKYIVLYFYPKDMTPGCTTEACDFRDSHESFAELDAVIIGVSPDSQEKHGKFKEKHNLPFLLLVDDEHKLAEAFDVWKLKKNFGKEYMGIERSTFLIDKEGRLIKEWRKVKVKDHVAEALQTLKDMSEK
>NZ_CP045672.1|WP_003223285.1|923572_924010_+|peroxide-responsive-transcriptional-repressor-PerR
MAAHELKEALETLKETGVRITPQRHAILEYLVNSMAHPTADDIYKALEGKFPNMSVATVYNNLRVFRESGLVKELTYGDASSRFDFVTSDHYHAICENCGKIVDFHYPGLDEVEQLAAHVTGFKVSHHRLEIYGVCQECSKKENH
>NZ_CP045672.1|WP_003243536.1|924044_924398_-|YgzB-family-protein
MAKYSSKINKIRTFALSLVFVGFIIMYIGIFFKESVLLSSLFMILGLLSIGLSTVVYFWIGMLSTKAVRVICPGCDKETKVLGVVDMCMHCREPLTLDKGLEGKEFDESYNKKKMSK
>NZ_CP045672.1|WP_003243727.1|924605_925490_+|hypothetical-protein
MENLLRPIYQERASHPNTLAVIMIERRNKTSSLTDNFDAALLVIVKDADEPVFIKHYEFDHQTASLHVVTDSQIQEWILLGTNRRIIDWIVNGRVLFDRNEYVVELIDRLNTFPFAERKLKIGLEYGKLIRRYVEGKAFFEANQFLDAYNAVVHALHHLARIEVIDRGFHPETTVWSQVRQMEPQVYKLYSELIESHESLEKRLELLFLANDFLIHSKAEIGSAHLFEVMKEKDIWQFGELLQHHDLKHFTQDLGVMLDYLTEKGLINVCQIETKGQAVYHRGYSFKKGVDSDS
>NZ_CP045672.1|WP_003233481.1|932455_933232_-|sporulation-control-protein-Spo0M
MSFFKKLAASAGIGAAKVDTILEKDAYFPGEEVQGTVHVKGGKIAQDIRYIDLQLSTRYVIVKDDEEHRKYATIHSFRVTGSFTIQPGEEHQFPFTFTLPLDTPITVGKVEVAVVTDLDIQGGIDKSDHDRIFVEAHPWIENVLEAIENLGFRLNEADCEQAPYFQRRLPFVQEFEFVPTSGYYRQMLDELELIFLLDEDGLEIIFEVDRRARGLRGWLEEMYNDGEQLVRVRFSQSELEDTEELEEVLEEILDQYAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045672_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045672_2

3197240-3197347

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045672_2

>merge|NZ_CP045672|2|3197240-3197347|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP045672|2|2|3197240-3197347|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045672.1\|WP_004398841.1\|3192552_3193584_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP045672.1\|WP_004399110.1\|3188718_3191115_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP045672.1\|WP_003229024.1\|3188220_3188688_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP045672.1\|WP_009968049.1\|3193607_3194750_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP045672.1\|WP_003243430.1\|3210075_3211548_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP045672.1\|WP_003228963.1\|3204909_3205431_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP045672.1\|WP_003243556.1\|3212486_3213032_+\|biofilm-surface-layer-protein-BslA	unknown	unknown	gnl\|CDD\|379999
NZ_CP045672.1\|WP_003244320.1\|3211746_3212289_+\|transcriptional-regulator-GbsR	unknown	unknown	gnl\|CDD\|224427
NZ_CP045672.1\|WP_003228960.1\|3205448_3206978_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP045672.1\|WP_003242867.1\|3207690_3208179_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP045672.1\|WP_003229031.1\|3184674_3185730_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP045672.1\|WP_003228966.1\|3204289_3204868_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP045672.1\|WP_003246015.1\|3191101_3192556_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP045672.1\|WP_003243227.1\|3208850_3210059_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP045672.1\|WP_004398803.1\|3194746_3196630_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP045672.1\|WP_010886600.1\|3187067_3188141_+\|spore-coat-kinase-CotI	unknown	unknown	gnl\|CDD\|131952
NZ_CP045672.1\|WP_003243361.1\|3208184_3208763_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NZ_CP045672.1\|WP_004399071.1\|3184241_3184673_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045672.1\|WP_003229028.1\|3185744_3186878_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP045672.1\|WP_003243808.1\|3206998_3207523_-\|membrane-protein	unknown	unknown	gnl\|CDD\|376684

Protein	Function_ID	Function_description	E-value
NZ_CP045672.1\|WP_004398841.1\|3192552_3193584_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP045672.1\|WP_004399110.1\|3188718_3191115_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP045672.1\|WP_003229024.1\|3188220_3188688_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.0961e-40
NZ_CP045672.1\|WP_009968049.1\|3193607_3194750_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP045672.1\|WP_003243430.1\|3210075_3211548_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP045672.1\|WP_003228963.1\|3204909_3205431_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.15425e-10
NZ_CP045672.1\|WP_003244320.1\|3211746_3212289_+\|transcriptional-regulator-GbsR	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	4.43641e-73
NZ_CP045672.1\|WP_003228960.1\|3205448_3206978_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.12922e-123
NZ_CP045672.1\|WP_003242867.1\|3207690_3208179_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
NZ_CP045672.1\|WP_003229031.1\|3184674_3185730_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.56293e-130
NZ_CP045672.1\|WP_003228966.1\|3204289_3204868_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
NZ_CP045672.1\|WP_003246015.1\|3191101_3192556_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP045672.1\|WP_003243227.1\|3208850_3210059_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
NZ_CP045672.1\|WP_004398803.1\|3194746_3196630_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP045672.1\|WP_010886600.1\|3187067_3188141_+\|spore-coat-kinase-CotI	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.3698e-134
NZ_CP045672.1\|WP_003243361.1\|3208184_3208763_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.34032e-05
NZ_CP045672.1\|WP_003243556.1\|3212486_3213032_+\|biofilm-surface-layer-protein-BslA	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
NZ_CP045672.1\|WP_003229028.1\|3185744_3186878_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.47076e-74
NZ_CP045672.1\|WP_003243808.1\|3206998_3207523_-\|membrane-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.00016613

>NZ_CP045672.1|WP_004398803.1|3194746_3196630_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYDLEGYSWQDQKWQKKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKKHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVDFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGQKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>NZ_CP045672.1|WP_009968049.1|3193607_3194750_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASSIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>NZ_CP045672.1|WP_004398841.1|3192552_3193584_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP045672.1|WP_003246015.1|3191101_3192556_-|glycogen-synthase-GlgA
MKILFAVSECTPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAENDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYCQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>NZ_CP045672.1|WP_004399110.1|3188718_3191115_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP045672.1|WP_003229024.1|3188220_3188688_+|TspO/MBR-family-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSFKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>NZ_CP045672.1|WP_010886600.1|3187067_3188141_+|spore-coat-kinase-CotI
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI
>NZ_CP045672.1|WP_003229028.1|3185744_3186878_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>NZ_CP045672.1|WP_003229031.1|3184674_3185730_-|spore-coat-protein-CotS
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALRALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>NZ_CP045672.1|WP_004399071.1|3184241_3184673_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQKETKEKETDRKIVDDEEETKFETTLEPEEERDSKRSAPPYEEEDEDEEPDLAEEAKVEIIILPSESKPAPWFSQTVKRKA
>NZ_CP045672.1|WP_003228966.1|3204289_3204868_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>NZ_CP045672.1|WP_003228963.1|3204909_3205431_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKDIAKVHVDSWRTTYHEIIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEKGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEFLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>NZ_CP045672.1|WP_003228960.1|3205448_3206978_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTIQKSE
>NZ_CP045672.1|WP_003243808.1|3206998_3207523_-|membrane-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>NZ_CP045672.1|WP_003242867.1|3207690_3208179_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>NZ_CP045672.1|WP_003243361.1|3208184_3208763_-|MOSC-domain-containing-protein
MWKRMTAKAEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLASAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>NZ_CP045672.1|WP_003243227.1|3208850_3210059_-|choline-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>NZ_CP045672.1|WP_003243430.1|3210075_3211548_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP045672.1|WP_003244320.1|3211746_3212289_+|transcriptional-regulator-GbsR
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVTAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPVETK
>NZ_CP045672.1|WP_003243556.1|3212486_3213032_+|biofilm-surface-layer-protein-BslA
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045672_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045672_3

3739780-3739892

Orphan

Consensus_repeat	Method
GAAGATTTTAGTGATCGTTTAGATGATTTTGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045672_3

>merge|NZ_CP045672|3|3739780-3739892|CRISPRCasFinder
GAAGATTTTAGTGATCGTTTAGATGATTTTGAAGAACTTTTTGAACGTGACGAACGACCAGATTTGGATGATTGATCATCTGAAGATTTTAGTGATCGTTTAGATGATTTTGA

>NZ_CP045672|3|3|3739780-3739892|CRISPRCasFinder
GAAGATTTTAGTGATCGTTTAGATGATTTTGA	AGAACTTTTTGAACGTGACGAACGACCAGATTTGGATGATTGATCATCT
GAAGATTTTAGTGATCGTTTAGATGATTTTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045672.1\|WP_003244379.1\|3728469_3729951_+\|ribose-ABC-transporter-ATP-binding-protein-RbsA	unknown	unknown	gnl\|CDD\|224053
NZ_CP045672.1\|WP_003227850.1\|3743581_3743917_+\|DUF4181-domain-containing-protein	unknown	unknown	gnl\|CDD\|372726
NZ_CP045672.1\|WP_003244057.1\|3734415_3736128_-\|acetolactate-synthase-AlsS	unknown	unknown	gnl\|CDD\|236312
NZ_CP045672.1\|WP_003242900.1\|3745712_3746189_+\|chromate-efflux-transcriptional-regulator-ChrS	unknown	unknown	gnl\|CDD\|214628
NZ_CP045672.1\|WP_003242760.1\|3730932_3731850_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	unknown	unknown	gnl\|CDD\|380546
NZ_CP045672.1\|WP_003242945.1\|3747573_3748119_-\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728
NZ_CP045672.1\|WP_003243460.1\|3732623_3732920_+\|DUF3892-domain-containing-protein	unknown	unknown	gnl\|CDD\|379026
NZ_CP045672.1\|WP_009968282.1\|3729952_3730921_+\|ribose-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|181922
NZ_CP045672.1\|WP_003242695.1\|3738789_3739467_-\|DUF2642-domain-containing-protein	unknown	unknown	unknown
NZ_CP045672.1\|WP_003227843.1\|3746202_3746796_+\|chromate-efflux-transporter-subunit-ChrB	unknown	unknown	gnl\|CDD\|224970
NZ_CP045672.1\|WP_003242788.1\|3732959_3733487_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225158
NZ_CP045672.1\|WP_010886627.1\|3742025_3742613_+\|spore-coat-protein-CotG	unknown	unknown	unknown
NZ_CP045672.1\|WP_003244457.1\|3733586_3734354_-\|acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|273524
NZ_CP045672.1\|WP_003227854.1\|3740796_3741885_-\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|227642
NZ_CP045672.1\|WP_003227840.1\|3746792_3747329_+\|chromate-resistance-efflux-protein-ChrA	unknown	unknown	gnl\|CDD\|224970
NZ_CP045672.1\|WP_003227852.1\|3742786_3743404_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP045672.1\|WP_003227859.1\|3736285_3737194_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176143
NZ_CP045672.1\|WP_010886626.1\|3737404_3738733_+\|arsenic-transporter	unknown	unknown	gnl\|CDD\|238538
NZ_CP045672.1\|WP_003227847.1\|3743921_3745499_-\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|129176
NZ_CP045672.1\|WP_003243378.1\|3747355_3747577_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP045672.1\|WP_003244379.1\|3728469_3729951_+\|ribose-ABC-transporter-ATP-binding-protein-RbsA	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP045672.1\|WP_003227843.1\|3746202_3746796_+\|chromate-efflux-transporter-subunit-ChrB	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	1.86288e-53
NZ_CP045672.1\|WP_003244057.1\|3734415_3736128_-\|acetolactate-synthase-AlsS	gnl\|CDD\|236312	PRK08617, PRK08617, acetolactate synthase AlsS.	0
NZ_CP045672.1\|WP_003242900.1\|3745712_3746189_+\|chromate-efflux-transcriptional-regulator-ChrS	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	4.48628e-37
NZ_CP045672.1\|WP_003242760.1\|3730932_3731850_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	gnl\|CDD\|380546	cd06323, PBP1_ribose_binding, periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis D-ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group belong to the type 1 periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.	2.81146e-138
NZ_CP045672.1\|WP_003242945.1\|3747573_3748119_-\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	6.41336e-37
NZ_CP045672.1\|WP_003243460.1\|3732623_3732920_+\|DUF3892-domain-containing-protein	gnl\|CDD\|379026	pfam13031, DUF3892, Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length.	4.59339e-16
NZ_CP045672.1\|WP_009968282.1\|3729952_3730921_+\|ribose-ABC-transporter-permease	gnl\|CDD\|181922	PRK09512, rbsC, ribose ABC transporter permease protein; Reviewed.	2.96133e-116
NZ_CP045672.1\|WP_003227850.1\|3743581_3743917_+\|DUF4181-domain-containing-protein	gnl\|CDD\|372726	pfam13789, DUF4181, Domain of unknown function (DUF4181).	0.000225734
NZ_CP045672.1\|WP_003227840.1\|3746792_3747329_+\|chromate-resistance-efflux-protein-ChrA	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	7.8803e-49
NZ_CP045672.1\|WP_003227859.1\|3736285_3737194_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176143	cd08452, PBP2_AlsR, The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate. Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.7247e-130
NZ_CP045672.1\|WP_003244457.1\|3733586_3734354_-\|acetolactate-decarboxylase	gnl\|CDD\|273524	TIGR01252, Alpha-acetolactate_decarboxylase, alpha-acetolactate decarboxylase. Puruvate can be fermented to 2,3-butanediol. It is first converted to alpha-acetolactate by alpha-acetolactate synthase, then decarboxylated to acetoin by this enzyme. Acetoin can be reduced in some species to 2,3-butanediol by acetoin reductase. [Energy metabolism, Fermentation].	1.81642e-136
NZ_CP045672.1\|WP_003227854.1\|3740796_3741885_-\|spore-coat-protein-CotH	gnl\|CDD\|227642	COG5337, CotH, Spore coat assembly protein [Cell envelope biogenesis, outer membrane].	0
NZ_CP045672.1\|WP_003227852.1\|3742786_3743404_+\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	2.41792e-45
NZ_CP045672.1\|WP_003242788.1\|3732959_3733487_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	1.33013e-57
NZ_CP045672.1\|WP_010886626.1\|3737404_3738733_+\|arsenic-transporter	gnl\|CDD\|238538	cd01118, ArsB_permease, Anion permease ArsB. These permeases have been shown to export arsenate and antimonite in eubacteria and archaea. A typical ArsB permease contains 8-13 transmembrane helices and can function either independently as a chemiosmotic transporter or as a channel-forming subunit of an ATP-driven anion pump (ArsAB). The ArsAB complex is similar in many ways to ATP-binding cassette transporters, which have two groups of six transmembrane-spanning helical segments and two nucleotide-binding domains. The ArsB proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium, arsenate, sulfate, and organic anions across biological membranes in all three kingdoms of life.	5.48885e-104
NZ_CP045672.1\|WP_003227847.1\|3743921_3745499_-\|gamma-glutamyltransferase	gnl\|CDD\|129176	TIGR00066, Contains:_Gamma-glutamyltranspeptidase_large_chain, gamma-glutamyltranspeptidase. Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	0

>NZ_CP045672.1|WP_003242695.1|3738789_3739467_-|DUF2642-domain-containing-protein
MKGLNQFLNTDVEVVISGDTRFVGTLIDIGQDIFVIFDGCNYLYIPLLHLHQINKAKIVTSTEKPFLINPEDPMIEAETQAFSYRNTLNKVKGQFIEVYVTGGRSIHGYVTNVLNDYIVFFSPVFKILFISMHHLKWFTPYSTEQTPYTLDNSQLPVVPSKVPLVRNFEEQIKKNIGELVIFDMGEVPEKVGLLKGVSNNIIELINASGEPVIWKLNHLKTMHLP
>NZ_CP045672.1|WP_010886626.1|3737404_3738733_+|arsenic-transporter
MLAFFVTMIFIFWRPKGLNEAIPATFGALMVLLCGSVSLADLGEIGTKVTGASVTILATMIMAIALESFGFFYWVAAKLLQQSKGSGIKLFWLTNLLCFLMTIFLNNDGSILITTPILLLVLKYLGLKKHQKAPYLLSGVLIATASSAPIGVSNIVNLISLKIIGMDLYLHTAMMFVPSMMGLIFMTCLLFMFFYKRLPKSLPDIPGHFQSLRHRRYHPLHSPSAPLPERNQTKIMLFVLAFVFLVRMSLFAASYTGISVPLVAVIGSFILLSWRWIYFKTSPRDLLYKSPWHIFIFAFTMYVLIYGLHNIGFTELLVSYFEPVVSGSLAHATFASGISTSVFSNLFNNHPALMISTFTLTEMTLNPSTTKIIYLANIIGSDIGSLLLPMGTLATLIWMHILKQHDESISWGEYIKTTIIIIPLTVLFTLTCLYFWISWLFL
>NZ_CP045672.1|WP_003227859.1|3736285_3737194_+|LysR-family-transcriptional-regulator
MELRHLQYFIAVAEELHFGKAARRLNMTQPPLSQQIKQLEEEVGVTLLKRTKRFVELTAAGEIFLNHCRMALMQIGQGIELAQRTARGEQGLLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSSRQQEELLKGNIDIGILHPPLQHTALHIETAQSSPCVLALPKQHPLTSKESITIEDLRDEPIITVAKEAWPTLYMDFIQFCEQAGFRPNIVQEATEYQMVIGLVSAGIGMTFVPSSAKKLFNLDVTYRKMDQIQLNAEWVIAYRKDNHNPLIKHFIHISNCQQTRTKESDAGT
>NZ_CP045672.1|WP_003244057.1|3734415_3736128_-|acetolactate-synthase-AlsS
MTKATKEQKSLVKNRGAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGPEIIVARHEQNAAFMAQAVGRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTNTKNVRAVAAPKLGPAADDAISAAIAKIQTAKLPVVLVGMKGGRPEAIKAVRKLLKKVQLPFVETYQAAGTLSRDLEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNINGDRTIIHLDEIIADIDHAYQPDLELIGDIPSTINHIEHDAVKVEFAEREQKILSDLKQYMHEGEQVPADWKSDRAHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISNGMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTYDMVAFQQLKKYNRTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVIIDVPVDYSDNINLASDKLPKEFGELMKTKAL
>NZ_CP045672.1|WP_003244457.1|3733586_3734354_-|acetolactate-decarboxylase
MKRESNIQVLSRGQKDQPVSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSDGTATPVQNGDRSPFCSFTFFTPDMTHKIDAKMTREDFEKEINSMLPSRNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTADFFNANLDNPDFAKDIETTEGSPE
>NZ_CP045672.1|WP_003242788.1|3732959_3733487_-|NAD(P)H-dependent-oxidoreductase
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV
>NZ_CP045672.1|WP_003243460.1|3732623_3732920_+|DUF3892-domain-containing-protein
MDQFEAAYESYKARQTTADQENVPSGKEEIIAVRRNEEDNIIAVKTNTGRELDYPTALSEAKSGKLAHVDVFHKYGRDILRSEPDGIKENNLSELPDF
>NZ_CP045672.1|WP_003242760.1|3730932_3731850_+|ribose-ABC-transporter-substrate-binding-protein-RbsB
MKKAVSVILTLSLFLLTACSLEPPQWAKPSNSGNKKEFTIGLSVSTLNNPFFVSLKKGIEKEAKKRGMKVIIVDAQNDSSKQTSDVEDLIQQGVDALLINPTDSSAISTAVESANAVGVPVVTIDRSAEQGKVETLVASDNVKGGEMAAAFIADKLGKGAKVAELEGVPGASATRERGSGFHNIADQKLQVVTKQSADFDRTKGLTVMENLLQGHPDIQAVFAHNDEMALGALEAINSSGKDILVIGFDGNKDALASIKDRKLSATVAQQPELIGKLATEAADDILHGKKVQKTISAPLKLETQK
>NZ_CP045672.1|WP_009968282.1|3729952_3730921_+|ribose-ABC-transporter-permease
MKTEQLQTEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGLIAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPVLAIILGCIIGAVLGMINGLLITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYGFQMFGRGYFLGIPVPAITMVLAFVILWVLLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTSRLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIVGTLIGVLIIGTLNNGLNLLGVSSFYQLVVKGIVILIAVLLDRKKSA
>NZ_CP045672.1|WP_003244379.1|3728469_3729951_+|ribose-ABC-transporter-ATP-binding-protein-RbsA
MQIEMKDIHKTFGKNQVLSGVSFQLMPGEVHALMGENGAGKSTLMNILTGLHKADKGQISINGNETYFSNPKEAEQHGIAFIHQELNIWPEMTVLENLFIGKEISSKLGVLQTRKMKALAKEQFDKLSVSLSLDQEAGECSVGQQQMIEIAKALMTNAEVIIMDEPTAALTEREISKLFEVITALKKNGVSIVYISHRMEEIFAICDRITIMRDGKTVDTTNISETDFDEVVKKMVGRELTERYPKRTPSLGDKVFEVKNASVKGSFEDVSFYVRSGEIVGVSGLMGAGRTEMMRALFGVDRLDTGEIWIAGKKTAIKNPQEAVKKGLGFITENRKDEGLLLDTSIRENIALPNLSSFSPKGLIDHKREAEFVDLLIKRLTIKTASPETHARHLSGGNQQKVVIAKWIGIGPKVLILDEPTRGVDVGAKREIYTLMNELTERGVAIIMVSSELPEILGMSDRIIVVHEGRISGEIHAREATQERIMTLATGGR
>NZ_CP045672.1|WP_003227854.1|3740796_3741885_-|spore-coat-protein-CotH
MKNQSNLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKKSYHISFYQPKTFRGAREIHLNAEYKDPSLMRNKLSLDFFSELGTLSPKAEFAFVKMNGKNEGVYLELESVDEYYLAKRKLADGAIFYAVDDDANFSLMSDLERETKTSLELGYEKKTGTEEDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSGETGLFEVIPWDYDATWGRDIHGERMAADYVRIQGFNTLTARILDESEFRKSYKRLLEKTLQSLFTIEYMEPKIMAMYERIRPFVLMDPYKKNDIERFDREPDVICEYIKNRSQYLKDHLSIL
>NZ_CP045672.1|WP_010886627.1|3742025_3742613_+|spore-coat-protein-CotG
MGHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSHKKSHRTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKYYKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK
>NZ_CP045672.1|WP_003227852.1|3742786_3743404_+|flavin-reductase-family-protein
MYIFQADQLSAKDTYKLLSGTVIPRPIAFVTTLSSGGAVNAAPFSFYNVVSSDPPLLSISVNRTEGRQKDTARNAVENGEFVVHVSDEAIIEDINETAASLRPDESELTRTSLHPVESKAVSVPGIKEARVRFECKLERHITFDNDQGITTADLLIGRVVCFHLDEKVYDAEKGYILTDELKPASRLAGNHYAKLGEEFTLIRPS
>NZ_CP045672.1|WP_003227850.1|3743581_3743917_+|DUF4181-domain-containing-protein
MTNFWILMLIAITISLASQFFIKKKYGIDKSGWRYKHVSNTHKWIEITLLILFVFSLSFFPVEYLLLLFFIVIDSIRIFMEWHYRPEDKQYMYHIVEVSLMFMLLIYVCTL
>NZ_CP045672.1|WP_003227847.1|3743921_3745499_-|gamma-glutamyltransferase
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYGRLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYRGYSVYQAPPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDPAFADIPLERLLDKRYAKQLAEEIGYLAIPAESRPVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFTDKTIQKLKDSGHLVEVVGDYDPLMGQAAAIKVDEEGFLQGGADPRGDGAAVGI
>NZ_CP045672.1|WP_003242900.1|3745712_3746189_+|chromate-efflux-transcriptional-regulator-ChrS
MSHEYQIPNLVLDETDKQILTILHEEGRISYTDLGKRVDLSRVAVQARINQLIEAGVIEKFTAVINPAKIGIHVSVFFNVEVEPQFLEEVALKLEEEPAVTSLYHMTGPSKLHMHGIFTNDQEMEEFLTKRLYPLRGVVSVDCQMLIKRYKSRMGMKL
>NZ_CP045672.1|WP_003227843.1|3746202_3746796_+|chromate-efflux-transporter-subunit-ChrB
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGPIATKMAAYLGFKLKGTLGAIVAILAHILPTCLAMVGLFAAVNVLSHSAIVAGMIGAVTPVIAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKLKDKITNKHSKDKGMSAS
>NZ_CP045672.1|WP_003227840.1|3746792_3747329_+|chromate-resistance-efflux-protein-ChrA
MISIYLFMAFFIANLLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIATKIAAYVGYSAGGWPGFLIALIATVVPSALALIVLLRIIQRFRQSPVIKGMTLSVQPVIAVMMLILTWQIGADGIKAIGWVQSIVITGISLLAMTKFKMHPAFLIIAAFLYGGLVIPYL
>NZ_CP045672.1|WP_003243378.1|3747355_3747577_-|hypothetical-protein
MKFLLSVIAGLLILALYLFWKVQPPVWIQVETNSSQLKQSVRMAGTTLQVKHMIKSDAGEETAVISNGISGLK
>NZ_CP045672.1|WP_003242945.1|3747573_3748119_-|flavodoxin-family-protein
MKIAVINGGTRSGGNTDVLAEKAVQGFDAEHIYLQKYPIQPIEDLRHAQGGFRPVQDDYDSIIERILQCHILIFATPIYWFGMSGTLKLFIDRWSQTLRDPRFPDFKQQMSVKQAYVIAVGGDNPKIKGLPLIQQFEHIFHFMGMSFKGYVLGEGNRPGDILRDHQALSAASRLLKRSDAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
NZ_CP045672_2	2.1\|3197264\|60\|NZ_CP045672\|CRISPRCasFinder	3197264-3197323	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3197264|60|NZ_CP045672|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

679317 : 687683

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003233955.1\|679317_680613_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
WP_044455961.1\|680686_681412_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	7.0e-46	44.1
WP_003219409.1\|681404_681659_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003243954.1\|681655_682339_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003244429.1\|682322_684551_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
WP_003233947.1\|684526_685957_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
WP_003242485.1\|686058_687099_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.1e-63	41.7
WP_003244322.1\|687095_687683_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-28	40.4

DBSCAN-SWA_2

1186911 : 1230677

Planktothrix_phage(25.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003232972.1\|1186911_1187151_-\|coat	spore coat protein YjzB	NA	NA	NA	NA
WP_003232971.1\|1187315_1188254_+	beta-ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_003244890.1\|1188276_1189518_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_003232967.1\|1189593_1190379_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_003232965.1\|1190563_1191550_+	oligopeptide ABC transporter ATP-binding protein AppD	G9BWD6	Planktothrix_phage	5.7e-22	32.9
WP_003232964.1\|1191546_1192536_+	oligopeptide ABC transporter ATP-binding protein AppF	F2Y302	Organic_Lake_phycodnavirus	6.7e-07	26.1
WP_003245828.1\|1194329_1195280_+	oligopeptide ABC transporter permease AppB	NA	NA	NA	NA
WP_003232961.1\|1195296_1196208_+	oligopeptide ABC transporter permease AppC	NA	NA	NA	NA
WP_003239298.1\|1196412_1197165_+	YjbA family protein	A0A0A0RP53	Bacillus_phage	5.4e-49	43.9
WP_003245134.1\|1197199_1198192_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003232957.1\|1198935_1200573_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
WP_003245554.1\|1200680_1201616_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_003232954.1\|1201619_1202537_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_014906294.1\|1202541_1203618_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	2.1e-17	30.8
WP_003245567.1\|1203619_1204537_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_010886478.1\|1204643_1205861_+	MFS transporter	NA	NA	NA	NA
WP_003244921.1\|1206024_1206603_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003245483.1\|1206783_1207179_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_003232944.1\|1207221_1207878_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
WP_119122854.1\|1208047_1208188_+	hypothetical protein	NA	NA	NA	NA
WP_003245194.1\|1208154_1208811_+	adaptor protein MecA	NA	NA	NA	NA
WP_003245684.1\|1208805_1208928_-	hypothetical protein	NA	NA	NA	NA
WP_003245839.1\|1208971_1210123_+	competence protein CoiA	NA	NA	NA	NA
WP_009967010.1\|1210169_1212182_+	oligoendopeptidase F	NA	NA	NA	NA
WP_003244944.1\|1212219_1212387_-	hypothetical protein	NA	NA	NA	NA
WP_003245184.1\|1212700_1213600_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003232928.1\|1213596_1213995_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_010886480.1\|1214249_1214795_-	bifunctional muramidase/murein lytic transglycosylase	A0A1P8CWQ1	Bacillus_phage	4.8e-39	60.4
WP_003232924.1\|1214998_1215571_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_003232922.1\|1215695_1216064_+	hypothetical protein	NA	NA	NA	NA
WP_003245294.1\|1216092_1216728_+	GTP diphosphokinase	NA	NA	NA	NA
WP_003232918.1\|1216746_1217547_+	NAD kinase	NA	NA	NA	NA
WP_010886481.1\|1217609_1218461_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_003244765.1\|1218473_1219208_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	M4Q4T6	Vibrio_phage	3.2e-06	25.0
WP_003232910.1\|1219442_1221287_+	sodium:proton antiporter	NA	NA	NA	NA
WP_003232909.1\|1221535_1222246_+	thiaminase II	NA	NA	NA	NA
WP_003232908.1\|1222220_1222838_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_003245044.1\|1222821_1223931_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_010886482.1\|1223930_1224131_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_010886483.1\|1224127_1224898_+	thiazole synthase	NA	NA	NA	NA
WP_003245868.1\|1224894_1225905_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_003245050.1\|1225923_1226739_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003232896.1\|1226874_1227651_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_010886484.1\|1227751_1228435_+\|coat	spore coat protein CotO	NA	NA	NA	NA
WP_003244982.1\|1228528_1228975_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_003239243.1\|1229102_1229591_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_003244668.1\|1229742_1230261_-\|coat	spore coat protein CotX	NA	NA	NA	NA
WP_003245818.1\|1230359_1230677_-\|coat	spore coat protein CotW	NA	NA	NA	NA

DBSCAN-SWA_3

1293539 : 1338375

uncultured_Caudovirales_phage(27.78%)

plate,holin,terminase,portal,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003245490.1\|1293539_1294811_+	ATPase YjoB	A0A1V0SEI6	Indivirus	8.6e-15	37.1
WP_010886491.1\|1294955_1296092_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	8.3e-94	47.4
WP_003245487.1\|1296081_1296216_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
WP_003232731.1\|1296246_1296504_-	YciI family protein	NA	NA	NA	NA
WP_003244876.1\|1296624_1297578_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	7.3e-67	74.1
WP_003245254.1\|1297617_1297995_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	6.1e-17	42.3
WP_003244789.1\|1298100_1298703_+	poly-gamma-glutamate hydrolase family protein	F8WQ53	Bacillus_phage	3.8e-45	49.2
WP_003245071.1\|1298779_1299616_+	manganese catalase	NA	NA	NA	NA
WP_003232721.1\|1299659_1300256_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
WP_003232719.1\|1300418_1300760_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_003232712.1\|1300937_1301117_+	hypothetical protein	NA	NA	NA	NA
WP_003245799.1\|1301103_1301940_+	phage-like element PBSX protein XkdB	S6BFM4	Thermus_phage	1.8e-24	28.2
WP_010886492.1\|1301839_1302640_+	ATP-binding protein	A6XMI1	Bacillus_virus	5.0e-61	51.7
WP_003245588.1\|1302639_1302807_+	hypothetical protein	NA	NA	NA	NA
WP_003245290.1\|1302891_1303242_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
WP_003244900.1\|1303238_1303445_+	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	1.6e-11	50.0
WP_003245797.1\|1303560_1304070_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.9e-21	38.6
WP_003244697.1\|1304185_1304983_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
WP_003245584.1\|1304979_1306281_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.4e-153	60.2
WP_003245427.1\|1306284_1307772_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
WP_003245836.1\|1307791_1308619_+	phage-like element PBSX protein XkdF	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
WP_003232690.1\|1308644_1309580_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
WP_003245011.1\|1309601_1309985_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.9e-13	40.2
WP_009967053.1\|1309981_1310338_+	YqbH/XkdH family protein	NA	NA	NA	NA
WP_003245226.1\|1310334_1310820_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
WP_003232680.1\|1310832_1311273_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
WP_003232679.1\|1311276_1311495_+	hypothetical protein	NA	NA	NA	NA
WP_003245369.1\|1311491_1312892_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	2.3e-77	39.3
WP_003232677.1\|1312893_1313337_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003232676.1\|1313428_1313875_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
WP_003239113.1\|1313904_1314054_+	hypothetical protein	NA	NA	NA	NA
WP_010886493.1\|1314055_1318054_+	phage-like element PBSX protein XkdO	A0A1L2JY60	Aeribacillus_phage	2.1e-43	44.9
WP_003232674.1\|1318046_1318706_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	3.7e-25	34.0
WP_003245730.1\|1318721_1319699_+	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
WP_003244812.1\|1319698_1319965_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	1.7e-05	36.4
WP_003232671.1\|1320021_1320447_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.8e-13	38.0
WP_009967060.1\|1320439_1321486_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	4.4e-73	44.3
WP_003244743.1\|1321469_1322048_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	3.0e-15	34.2
WP_003232665.1\|1322044_1322317_+	hypothetical protein	NA	NA	NA	NA
WP_003244681.1\|1322319_1324383_+	phage-like element PBSX protein XkdV	A0A2H4J4R1	uncultured_Caudovirales_phage	4.8e-31	37.4
WP_003232660.1\|1324394_1324724_+	phage-like element PBSX protein XkdW	A0A2H4JCI0	uncultured_Caudovirales_phage	1.7e-15	41.3
WP_003232658.1\|1324720_1324885_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	3.2e-15	66.0
WP_003245597.1\|1324928_1325768_+	phage-like element PBSX protein XepA	NA	NA	NA	NA
WP_003232655.1\|1325820_1326090_+	hypothetical protein	A0A2H4JD40	uncultured_Caudovirales_phage	6.2e-24	64.8
WP_003232653.1\|1326102_1326366_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	4.7e-24	65.5
WP_003245230.1\|1326378_1327272_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.8e-83	69.7
WP_003232648.1\|1327308_1327446_-	hypothetical protein	NA	NA	NA	NA
WP_003232646.1\|1327531_1327702_-	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
WP_003244695.1\|1327701_1328448_-	toxin-antitoxin-antitoxin system toxin SpoIISA	NA	NA	NA	NA
WP_003232642.1\|1328557_1329559_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_003218470.1\|1329571_1330189_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_003244819.1\|1330464_1331781_-	serine/threonine exchanger	NA	NA	NA	NA
WP_003245086.1\|1332169_1333120_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_003244977.1\|1333220_1333367_+	hypothetical protein	NA	NA	NA	NA
WP_003245387.1\|1333374_1335525_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_003232632.1\|1335536_1336508_+	glycosyltransferase family 2 protein	A0A2H5BFL1	Salmonella_phage	1.9e-62	41.0
WP_009967069.1\|1337025_1338375_-\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-25	33.7

DBSCAN-SWA_4

1848988 : 1855543

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231758.1\|1848988_1849381_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
WP_003245700.1\|1849340_1851443_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	87.0
WP_003231754.1\|1851460_1852450_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
WP_003245105.1\|1852499_1853120_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
WP_003244862.1\|1853183_1853951_-	sporulation-specific N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	9.1e-52	49.5
WP_003231746.1\|1854574_1855543_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_5

2040062 : 2045749

Bacillus_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231348.1\|2040062_2040236_-	hypothetical protein	A0A1P8CWY7	Bacillus_phage	5.6e-18	82.5
WP_009967407.1\|2040380_2040605_+	hypothetical protein	A0A1P8CWZ1	Bacillus_phage	8.9e-16	82.0
WP_003231345.1\|2040608_2041064_-	hypothetical protein	NA	NA	NA	NA
WP_010886526.1\|2041188_2041449_+	hypothetical protein	NA	NA	NA	NA
WP_075058859.1\|2042202_2042367_+\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	3.9e-21	92.6
WP_003231340.1\|2042521_2043637_+	response regulator aspartate phosphatase RapK	D6R410	Bacillus_phage	1.5e-95	49.2
WP_004399440.1\|2043633_2043756_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_003231333.1\|2044911_2045205_-	YolD-like family protein	O64030	Bacillus_phage	7.5e-39	86.6
WP_009967409.1\|2045413_2045749_+	hypothetical protein	A0A1P8CWM9	Bacillus_phage	7.2e-46	86.5

DBSCAN-SWA_6

2131998 : 2267426

198

Bacillus_phage(97.8%)

transposase,integrase,bacteriocin

attL 2132421:2132436|attR 2266787:2266802

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399353.1\|2131998_2132424_+	SDR family NAD(P)-dependent oxidoreductase	A0A1V0SAI8	Catovirus	4.9e-15	36.8
2132421:2132436	attL	NA	NA	NA	NA
WP_004399451.1\|2132458_2132635_-	recombination directionality factor SprB	O64196	Bacillus_phage	5.3e-24	100.0
WP_004399411.1\|2132637_2133225_-	hypothetical protein	O64195	Bacillus_phage	3.6e-109	100.0
WP_004399259.1\|2133299_2133542_+	helix-turn-helix transcriptional regulator	O64194	Bacillus_phage	8.6e-41	100.0
WP_010886533.1\|2133543_2133729_-	hypothetical protein	O64193	Bacillus_phage	2.1e-26	100.0
WP_009967444.1\|2133812_2134025_-	hypothetical protein	O64192	Bacillus_phage	5.2e-34	100.0
WP_004399562.1\|2134090_2134453_-	hypothetical protein	A0A1P8CX73	Bacillus_phage	1.1e-63	100.0
WP_010886534.1\|2134449_2134623_-	hypothetical protein	O64190	Bacillus_phage	3.4e-23	100.0
WP_010886535.1\|2134638_2134956_-	hypothetical protein	A0A1P8CX53	Bacillus_phage	2.1e-55	100.0
WP_010886536.1\|2134968_2135046_-	hypothetical protein	A0A1P8CX55	Bacillus_phage	7.4e-07	100.0
WP_009967447.1\|2135077_2135224_-	hypothetical protein	A0A1P8CX49	Bacillus_phage	1.0e-17	100.0
WP_009967449.1\|2135259_2135391_-	rubrerythrin family protein	A0A1P8CX61	Bacillus_phage	2.6e-20	100.0
WP_004399249.1\|2135430_2135622_-	hypothetical protein	A0A1P8CX54	Bacillus_phage	1.0e-33	100.0
WP_004399351.1\|2135665_2136493_-	hypothetical protein	O64184	Bacillus_phage	4.4e-169	100.0
WP_009967454.1\|2136611_2136830_+	acid-soluble spore protein SspC	Q77YX0	Bacillus_phage	5.6e-31	100.0
WP_004399299.1\|2137129_2137483_-	hypothetical protein	A0A1P8CX43	Bacillus_phage	3.9e-34	64.1
WP_010886537.1\|2137713_2138055_-	hypothetical protein	O64181	Bacillus_phage	5.1e-55	100.0
WP_004399449.1\|2138201_2138492_-	hypothetical protein	O64180	Bacillus_phage	4.3e-47	100.0
WP_004399585.1\|2138492_2138660_-	hypothetical protein	A0A1P8CX64	Bacillus_phage	1.8e-21	88.9
WP_009967458.1\|2138811_2139057_+	hypothetical protein	A0A1P8CX50	Bacillus_phage	1.6e-31	100.0
WP_004399409.1\|2139096_2139546_-	SPBc2 prophage-derived transcriptional regulator YosT	A0A1P8CX48	Bacillus_phage	2.0e-83	100.0
WP_004399492.1\|2139640_2140069_-	SPBc2 prophage-derived deoxyuridine 5'-triphosphate nucleotidohydrolase YosS	A0A1P8CX51	Bacillus_phage	5.4e-78	100.0
WP_004399328.1\|2140114_2140357_-	thioredoxin family protein	A0A1P8CX24	Bacillus_phage	1.4e-38	100.0
WP_004399561.1\|2140937_2141459_-	HNH endonuclease	A0A1P8CX39	Bacillus_phage	7.4e-98	100.0
WP_095374983.1\|2142480_2145018_-	hypothetical protein	A0A1P8CX40	Bacillus_phage	0.0e+00	99.1
WP_080031206.1\|2145264_2145942_-	ribonucleotide-diphosphate reductase subunit alpha	A0A1P8CX40	Bacillus_phage	2.3e-107	88.4
WP_004399478.1\|2145949_2146345_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A1P8CX56	Bacillus_phage	3.7e-65	95.4
WP_004399275.1\|2146344_2146698_-	hypothetical protein	O64171	Bacillus_phage	1.1e-60	100.0
WP_009967463.1\|2146785_2146986_-	hypothetical protein	O64170	Bacillus_phage	2.1e-32	100.0
WP_004399360.1\|2147030_2147225_-	hypothetical protein	O64169	Bacillus_phage	7.6e-32	100.0
WP_004399476.1\|2147245_2147380_-	hypothetical protein	O64168	Bacillus_phage	2.5e-18	100.0
WP_004399315.1\|2147411_2147882_-	hypothetical protein	O64167	Bacillus_phage	1.4e-82	100.0
WP_004399442.1\|2147942_2148305_-	hypothetical protein	O64166	Bacillus_phage	8.6e-61	100.0
WP_004399307.1\|2148347_2148473_-	hypothetical protein	O64165	Bacillus_phage	3.5e-14	100.0
WP_004399279.1\|2148486_2148834_-	hypothetical protein	O64164	Bacillus_phage	1.2e-56	100.0
WP_009967464.1\|2148848_2149244_-	hypothetical protein	O64163	Bacillus_phage	4.1e-72	100.0
WP_009967465.1\|2149282_2149825_-	hypothetical protein	O64162	Bacillus_phage	1.4e-99	100.0
WP_004399458.1\|2149869_2150049_-	hypothetical protein	O64161	Bacillus_phage	6.8e-27	100.0
WP_004399362.1\|2150179_2150299_+	YhzE/YjcZ family sporulation protein YosA	NA	NA	NA	NA
WP_009969822.1\|2150402_2150615_-	hypothetical protein	O64159	Bacillus_phage	1.2e-35	100.0
WP_010886541.1\|2150681_2150864_-	hypothetical protein	O64158	Bacillus_phage	1.5e-26	100.0
WP_004399541.1\|2150876_2151104_-	hypothetical protein	O64157	Bacillus_phage	9.2e-37	100.0
WP_004399530.1\|2151143_2151509_-	hypothetical protein	O64156	Bacillus_phage	4.9e-64	100.0
WP_004399346.1\|2151511_2151730_-	hypothetical protein	O64155	Bacillus_phage	4.3e-31	100.0
WP_004399270.1\|2151773_2153105_-	DNA (cytosine-5-)-methyltransferase	Q77YW9	Bacillus_phage	1.5e-256	100.0
WP_004399507.1\|2153153_2153273_-	hypothetical protein	O64154	Bacillus_phage	1.7e-13	100.0
WP_004399368.1\|2153304_2153823_-	5'-3'-deoxyribonucleotidase	A0A1P8CX15	Bacillus_phage	2.2e-97	100.0
WP_004399428.1\|2153831_2154329_-	deoxynucleoside kinase	A0A1P8CX28	Bacillus_phage	1.0e-88	100.0
WP_004399305.1\|2154328_2154484_-	hypothetical protein	A0A1P8CX36	Bacillus_phage	2.0e-22	100.0
WP_009967472.1\|2154476_2154692_-	YorP family protein	O64150	Bacillus_phage	7.9e-38	100.0
WP_009967473.1\|2154724_2154922_-	hypothetical protein	O64149	Bacillus_phage	1.9e-30	100.0
WP_004399415.1\|2154957_2155107_-	hypothetical protein	O64148	Bacillus_phage	7.9e-21	100.0
WP_010886542.1\|2155224_2155941_-	3D domain-containing protein	O64147	Bacillus_phage	2.1e-127	100.0
WP_009967475.1\|2155968_2159886_-	DNA polymerase III subunit alpha	A0A1P8CX14	Bacillus_phage	0.0e+00	96.9
WP_004399433.1\|2159898_2161629_-	single-stranded-DNA-specific exonuclease RecJ	A0A1P8CX07	Bacillus_phage	0.0e+00	98.3
WP_009967477.1\|2161628_2162765_-	hypothetical protein	A0A1P8CX05	Bacillus_phage	1.2e-225	100.0
WP_004399302.1\|2162780_2164295_-	hypothetical protein	A0A1P8CWZ7	Bacillus_phage	3.6e-286	100.0
WP_009967478.1\|2164309_2164780_-	hypothetical protein	A0A1P8CX08	Bacillus_phage	1.4e-87	100.0
WP_004399537.1\|2164822_2165794_-	ATP-binding protein	A0A1P8CX29	Bacillus_phage	1.7e-180	100.0
WP_004399276.1\|2165876_2166791_-	hypothetical protein	O64140	Bacillus_phage	3.0e-171	100.0
WP_004399457.1\|2166812_2167184_-	hypothetical protein	O64139	Bacillus_phage	2.6e-65	100.0
WP_004399509.1\|2167357_2167672_-	SPBc2 prophage-derived stress response protein SCP1	NA	NA	NA	NA
WP_004399313.1\|2167748_2168129_-	hypothetical protein	O64137	Bacillus_phage	3.8e-67	100.0
WP_004399516.1\|2168191_2168488_-	hypothetical protein	O64136	Bacillus_phage	8.1e-49	100.0
WP_009967482.1\|2168576_2170337_-	hypothetical protein	O64135	Bacillus_phage	0.0e+00	100.0
WP_044456440.1\|2170333_2171158_-	gamma-polyglutamate hydrolase PghZ	O64134	Bacillus_phage	1.1e-148	99.6
WP_004399280.1\|2171256_2171652_-	hypothetical protein	O64133	Bacillus_phage	7.7e-71	100.0
WP_004399584.1\|2171706_2171928_-	hypothetical protein	O64132	Bacillus_phage	5.8e-36	100.0
WP_004399300.1\|2171998_2172673_+	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	5.9e-79	98.6
WP_004399261.1\|2172742_2173555_+	SPBc2 prophage-derived DNA ligase-like protein LigB	O64130	Bacillus_phage	2.5e-156	100.0
WP_004399463.1\|2173620_2174034_-	hypothetical protein	O64129	Bacillus_phage	1.8e-78	100.0
WP_004399538.1\|2174199_2174349_+	hypothetical protein	O64128	Bacillus_phage	2.7e-21	100.0
WP_004399296.1\|2174425_2174773_-	hypothetical protein	O64127	Bacillus_phage	1.1e-60	100.0
WP_009967487.1\|2174774_2175131_-	hypothetical protein	O64126	Bacillus_phage	1.6e-51	100.0
WP_004399557.1\|2175090_2175432_-	hypothetical protein	O64125	Bacillus_phage	8.1e-61	100.0
WP_009967489.1\|2175545_2175920_+	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	3.4e-60	100.0
WP_004399461.1\|2175936_2176155_-	hypothetical protein	O64123	Bacillus_phage	2.7e-33	100.0
WP_009967493.1\|2176358_2176637_+	hypothetical protein	O64122	Bacillus_phage	2.3e-45	100.0
WP_010886543.1\|2176761_2177454_-	HNH endonuclease	O64121	Bacillus_phage	7.2e-133	100.0
WP_010886544.1\|2177493_2177697_-	hypothetical protein	O64120	Bacillus_phage	8.5e-34	100.0
WP_009967495.1\|2177716_2178343_-	DUF1273 domain-containing protein	A0A1P8CWY2	Bacillus_phage	5.6e-108	89.8
WP_004399432.1\|2178442_2178637_-	hypothetical protein	O64118	Bacillus_phage	3.2e-30	100.0
WP_009967496.1\|2178685_2179138_-	hypothetical protein	O64117	Bacillus_phage	6.7e-79	100.0
WP_004399295.1\|2179220_2179478_-	hypothetical protein	O64116	Bacillus_phage	3.0e-44	100.0
WP_009967498.1\|2179522_2179726_-	hypothetical protein	O64115	Bacillus_phage	1.3e-34	100.0
WP_004399423.1\|2179734_2179899_-	hypothetical protein	O64114	Bacillus_phage	1.7e-24	100.0
WP_004399389.1\|2179952_2180708_-	SPBc2 prophage-derived antirepressor protein YoqD	A0A1P8CWY0	Bacillus_phage	1.1e-137	100.0
WP_004399569.1\|2180748_2181156_-	hypothetical protein	A0A1P8CWY3	Bacillus_phage	2.6e-74	100.0
WP_004399388.1\|2181162_2181501_-	hypothetical protein	O64111	Bacillus_phage	8.9e-52	100.0
WP_014906374.1\|2181497_2181848_-	hypothetical protein	A0A1P8CWX8	Bacillus_phage	8.3e-61	100.0
WP_009967502.1\|2181860_2182064_-	hypothetical protein	A0A1P8CWX9	Bacillus_phage	5.7e-30	100.0
WP_004399424.1\|2182077_2182356_-	hypothetical protein	A0A1P8CWX5	Bacillus_phage	9.2e-47	100.0
WP_004399266.1\|2182352_2182757_-	hypothetical protein	A0A1P8CWX0	Bacillus_phage	2.9e-73	100.0
WP_004399316.1\|2182753_2183089_-	hypothetical protein	A0A1P8CWX6	Bacillus_phage	3.2e-46	100.0
WP_003231036.1\|2183177_2183372_-	hypothetical protein	O64105	Bacillus_phage	1.9e-27	100.0
WP_009967504.1\|2183483_2183681_-	hypothetical protein	O64104	Bacillus_phage	3.6e-29	100.0
WP_003231034.1\|2183750_2183969_-	YopT family protein	O64103	Bacillus_phage	6.6e-32	100.0
WP_004399410.1\|2184151_2184376_+	helix-turn-helix transcriptional regulator	O64102	Bacillus_phage	1.9e-34	100.0
WP_003231032.1\|2184564_2185542_-	hypothetical protein	O64101	Bacillus_phage	4.0e-177	99.7
WP_004399247.1\|2185565_2186948_-	hypothetical protein	O64100	Bacillus_phage	1.3e-263	100.0
WP_004399272.1\|2187054_2188131_-\|integrase	SPBc2 prophage-derived probable integrase/recombinase YopP	O64099	Bacillus_phage	1.5e-198	100.0
WP_004399407.1\|2188120_2188333_-	helix-turn-helix transcriptional regulator	O64098	Bacillus_phage	8.6e-29	100.0
WP_009967507.1\|2188380_2188698_-	hypothetical protein	NA	NA	NA	NA
WP_004399418.1\|2188700_2188901_-	hypothetical protein	O64096	Bacillus_phage	9.0e-28	100.0
WP_009967508.1\|2189227_2189353_-	lysogeny pheromone AimP family peptide	NA	NA	NA	NA
WP_009968986.1\|2189366_2190527_-	hypothetical protein	NA	NA	NA	NA
WP_004399583.1\|2190703_2191120_-	hypothetical protein	O64093	Bacillus_phage	1.2e-71	100.0
WP_009967509.1\|2191121_2191655_-	hypothetical protein	O64092	Bacillus_phage	9.3e-88	100.0
WP_004399323.1\|2191681_2192218_-	hypothetical protein	O64091	Bacillus_phage	2.2e-97	100.0
WP_004399255.1\|2192256_2192388_-	hypothetical protein	O64090	Bacillus_phage	1.7e-19	100.0
WP_004399349.1\|2192398_2192614_-	hypothetical protein	O64089	Bacillus_phage	5.0e-32	100.0
WP_004399430.1\|2192617_2192869_-	hypothetical protein	A0A1P8CWV6	Bacillus_phage	1.6e-37	100.0
WP_003231000.1\|2192939_2193119_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.6e-28	96.6
WP_009967511.1\|2193220_2193451_+	hypothetical protein	NA	NA	NA	NA
WP_009967512.1\|2193455_2193851_-	UPF0715 family protein	O64087	Bacillus_phage	1.0e-62	100.0
WP_004399370.1\|2193908_2195237_-	RES domain-containing protein	O64086	Bacillus_phage	8.7e-260	100.0
WP_004399298.1\|2195344_2195572_-	helix-turn-helix transcriptional regulator	O64085	Bacillus_phage	1.0e-35	100.0
WP_004399369.1\|2195832_2197149_-	hypothetical protein	O64084	Bacillus_phage	1.1e-257	100.0
WP_004399486.1\|2197505_2198012_-	hypothetical protein	O64083	Bacillus_phage	4.9e-70	100.0
WP_004399445.1\|2198339_2199572_-	hypothetical protein	O64082	Bacillus_phage	1.7e-238	100.0
WP_004399547.1\|2199653_2199842_-	hypothetical protein	O64081	Bacillus_phage	1.5e-24	100.0
WP_010886546.1\|2199886_2200138_-	hypothetical protein	A0A1P8CWU4	Bacillus_phage	1.6e-29	94.4
WP_009967515.1\|2200156_2200333_-	hypothetical protein	O64080	Bacillus_phage	6.7e-11	100.0
WP_009967516.1\|2200707_2201319_-	lipoprotein	O64079	Bacillus_phage	5.0e-85	100.0
WP_009967517.1\|2201433_2201760_-	helix-turn-helix transcriptional regulator	O64078	Bacillus_phage	9.8e-56	100.0
WP_004399291.1\|2202712_2202907_+	hypothetical protein	O64077	Bacillus_phage	2.7e-29	100.0
WP_004399271.1\|2202946_2205466_+	hypothetical protein	O64076	Bacillus_phage	0.0e+00	100.0
WP_004399274.1\|2205709_2205988_+	HU-related DNA-binding protein HupN	A0A1P8CWT5	Bacillus_phage	1.2e-30	76.9
WP_119123066.1\|2206548_2206719_+	hypothetical protein	NA	NA	NA	NA
WP_004399317.1\|2207669_2207861_+	hypothetical protein	O64074	Bacillus_phage	1.5e-27	100.0
WP_004399278.1\|2207877_2209095_+	hypothetical protein	O64073	Bacillus_phage	1.3e-230	99.8
WP_004399334.1\|2209128_2209539_-	hypothetical protein	A0A1P8CWT0	Bacillus_phage	8.8e-70	100.0
WP_004399264.1\|2209757_2210258_+	hypothetical protein	A0A1P8CWS3	Bacillus_phage	3.6e-89	100.0
WP_004399257.1\|2210360_2211281_+	hypothetical protein	A0A1P8CWS6	Bacillus_phage	5.4e-176	100.0
WP_004399591.1\|2211267_2213037_+	hypothetical protein	O64069	Bacillus_phage	0.0e+00	100.0
WP_004399314.1\|2213054_2214575_+	hypothetical protein	O64068	Bacillus_phage	1.4e-282	100.0
WP_004399245.1\|2214605_2216042_+	hypothetical protein	A0A1P8CWR1	Bacillus_phage	2.7e-267	100.0
WP_004399581.1\|2216066_2216603_+	hypothetical protein	A0A1P8CWS2	Bacillus_phage	3.6e-95	100.0
WP_004399434.1\|2216641_2217658_+	hypothetical protein	A0A1P8CWR9	Bacillus_phage	1.3e-186	100.0
WP_004399413.1\|2217693_2218164_+	hypothetical protein	A0A1P8CWS5	Bacillus_phage	6.7e-82	100.0
WP_004399452.1\|2218178_2218574_+	hypothetical protein	A0A1P8CWR5	Bacillus_phage	2.5e-69	100.0
WP_009967519.1\|2218570_2218825_+	hypothetical protein	A0A1P8CWS7	Bacillus_phage	2.2e-39	100.0
WP_003230958.1\|2218808_2219459_+	hypothetical protein	A0A1P8CWR8	Bacillus_phage	3.2e-122	100.0
WP_004399477.1\|2219455_2219962_+	hypothetical protein	O64060	Bacillus_phage	5.9e-92	100.0
WP_003230954.1\|2219958_2220669_+	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	1.8e-131	100.0
WP_004399252.1\|2220711_2221509_+	hypothetical protein	A0A1P8CWR0	Bacillus_phage	2.1e-91	100.0
WP_010886547.1\|2221526_2222138_+	hypothetical protein	A0A1P8CWQ5	Bacillus_phage	3.3e-65	100.0
WP_009967521.1\|2222137_2222365_+	hypothetical protein	A0A1P8CWR2	Bacillus_phage	6.4e-38	100.0
WP_009967523.1\|2222428_2222785_+	hypothetical protein	O64055	Bacillus_phage	1.4e-58	100.0
WP_004399226.1\|2222786_2224004_+	hypothetical protein	A0A1P8CWR7	Bacillus_phage	2.5e-173	100.0
WP_004399254.1\|2224014_2224365_+	hypothetical protein	O64053	Bacillus_phage	5.4e-60	100.0
WP_004399574.1\|2224361_2224553_+	XkdX family protein	A0A1P8CWR4	Bacillus_phage	3.5e-29	100.0
WP_004399471.1\|2224602_2225103_+	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	5.7e-87	100.0
WP_004399281.1\|2225086_2225506_+	hypothetical protein	A0A1P8CWQ4	Bacillus_phage	4.8e-71	100.0
WP_009969431.1\|2225519_2226521_+	SPBc2 prophage-derived recombinase-like protein YomM	A0A1P8CWP6	Bacillus_phage	4.8e-194	100.0
WP_004399258.1\|2226523_2226853_-	hypothetical protein	A0A1P8CWQ2	Bacillus_phage	1.2e-61	99.1
WP_009967529.1\|2227028_2227715_-	hypothetical protein	O64048	Bacillus_phage	2.2e-126	100.0
WP_009966645.1\|2227739_2227916_-	hypothetical protein	NA	NA	NA	NA
WP_009967530.1\|2228261_2228708_+	hypothetical protein	O64047	Bacillus_phage	8.1e-77	100.0
WP_003246141.1\|2228789_2229473_+	hypothetical protein	Q37974	Bacillus_phage	2.1e-116	100.0
WP_004398858.1\|2229526_2236384_+	transglycosylase CwlP	A0A1P8CWQ1	Bacillus_phage	0.0e+00	67.7
WP_004398627.1\|2236434_2237193_+	hypothetical protein	O64045	Bacillus_phage	1.4e-145	100.0
WP_004398800.1\|2237204_2239832_+	hypothetical protein	O64044	Bacillus_phage	0.0e+00	100.0
WP_010886548.1\|2239847_2240669_+	hypothetical protein	O64043	Bacillus_phage	1.2e-134	100.0
WP_003246098.1\|2240705_2242640_+	hypothetical protein	O64042	Bacillus_phage	0.0e+00	100.0
WP_004398829.1\|2242809_2243634_+	hypothetical protein	A0A1P8CWP0	Bacillus_phage	1.5e-164	100.0
WP_004399160.1\|2243623_2243842_+	hypothetical protein	A0A1P8CWN7	Bacillus_phage	1.7e-35	100.0
WP_004399108.1\|2243861_2244965_+	N-acetylmuramoyl-L-alanine amidase BlyA	O64040	Bacillus_phage	2.8e-187	100.0
WP_003246119.1\|2245052_2245265_+	SPBc2 prophage-derived protein BhlA	A0A290GDY2	Caldibacillus_phage	4.2e-15	59.7
WP_004399099.1\|2245275_2245542_+	SPBc2 prophage-derived protein BhlB	A0A2H4J6M0	uncultured_Caudovirales_phage	1.1e-15	50.0
WP_009967541.1\|2245597_2246044_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_004399050.1\|2246040_2247309_-	SunS family peptide S-glycosyltransferase	NA	NA	NA	NA
WP_003230920.1\|2247308_2247722_-	disulfide bond formation protein BdbA	NA	NA	NA	NA
WP_003246186.1\|2247718_2249836_-	sublancin transporter SunT	W8CYL7	Bacillus_phage	6.9e-25	26.1
WP_009967544.1\|2249893_2250064_-\|bacteriocin	bacteriocin sublancin-168	NA	NA	NA	NA
WP_009967545.1\|2250360_2250678_-	sublancin immunity protein SunI	NA	NA	NA	NA
WP_004398504.1\|2250779_2252030_-	UV-damage repair protein uvrX	O64031	Bacillus_phage	4.2e-240	100.0
WP_004398710.1\|2252022_2252355_-	YolD-like family protein	O64030	Bacillus_phage	1.3e-55	100.0
WP_004399073.1\|2252528_2252864_+	hypothetical protein	O64029	Bacillus_phage	2.1e-53	100.0
WP_004398595.1\|2252906_2253263_-	hypothetical protein	O64028	Bacillus_phage	5.0e-61	100.0
WP_003246138.1\|2253268_2253736_-	YolA family protein	O64027	Bacillus_phage	5.1e-82	100.0
WP_009967548.1\|2253966_2254083_+	type I toxin-antitoxin system toxin BsrG	Q96209	Bacillus_phage	9.8e-11	100.0
WP_004399156.1\|2254361_2254895_-	GNAT family N-acetyltransferase	O64026	Bacillus_phage	6.2e-100	100.0
WP_004399123.1\|2254930_2255509_-	SMI1/KNR4 family protein	O64025	Bacillus_phage	9.4e-110	100.0
WP_003246188.1\|2255572_2256070_-	SMI1/KNR4 family protein	O64024	Bacillus_phage	1.9e-95	100.0
WP_004398855.1\|2256078_2257794_-	ribonuclease	O64023	Bacillus_phage	1.4e-302	99.8
WP_003246042.1\|2257893_2258451_-	SMI1/KNR4 family protein	O64022	Bacillus_phage	3.6e-106	100.0
WP_003245951.1\|2258534_2258720_+\|transposase	transposase	NA	NA	NA	NA
WP_004399120.1\|2258974_2260048_-	SPBc2 prophage-derived pesticidal crystal protein-like YokG	O64021	Bacillus_phage	9.3e-204	100.0
WP_004399048.1\|2260349_2261240_+	endonuclease YokF	O64020	Bacillus_phage	3.3e-114	100.0
WP_004398883.1\|2261253_2261736_+	hypothetical protein	O64019	Bacillus_phage	2.5e-84	100.0
WP_004399070.1\|2262039_2262858_+	AAC(3) family N-acetyltransferase	O64018	Bacillus_phage	1.9e-156	100.0
WP_004398929.1\|2262877_2263012_-	hypothetical protein	NA	NA	NA	NA
WP_003246211.1\|2263173_2263329_-	hypothetical protein	NA	NA	NA	NA
WP_004398503.1\|2263508_2264024_-	hypothetical protein	O64017	Bacillus_phage	2.0e-95	100.0
WP_004398623.1\|2264230_2264941_-	lipoprotein	O64016	Bacillus_phage	3.7e-108	100.0
WP_004399105.1\|2265143_2266781_+\|integrase	serine-type integrase SprA	O64015	Bacillus_phage	2.8e-308	100.0
WP_004399080.1\|2266835_2267426_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	4.9e-13	28.6
2266787:2266802	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2405620 : 2411866

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003223904.1\|2405620_2406214_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_160232620.1\|2406203_2406959_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.4e-09	29.1
WP_076983148.1\|2407166_2407256_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_013352728.1\|2407343_2407865_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_013352730.1\|2408414_2408879_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.2e-44	60.0
WP_013352731.1\|2408911_2410108_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.7
WP_014470033.1\|2410122_2410770_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.0e-39	44.3
WP_013352733.1\|2410750_2411866_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.2e-54	35.7

DBSCAN-SWA_8

2439743 : 2445984

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080334995.1\|2439743_2440145_-	protein rep	A0A286QS97	Streptococcus_phage	2.5e-08	62.0
WP_013352727.1\|2440321_2441077_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.9e-09	25.3
WP_076983148.1\|2441284_2441374_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_013352728.1\|2441461_2441983_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_013352730.1\|2442532_2442997_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.2e-44	60.0
WP_013352731.1\|2443029_2444226_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-116	54.7
WP_014470033.1\|2444240_2444888_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.0e-39	44.3
WP_013352733.1\|2444868_2445984_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.2e-54	35.7

DBSCAN-SWA_9

2686093 : 2724235

uncultured_Caudovirales_phage(30.3%)

plate,holin,terminase,portal,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004399034.1\|2686093_2687689_+	type II toxin-antitoxin system toxin ribonuclease YqcG	A0A1P8CWI7	Bacillus_phage	6.9e-78	61.3
WP_009967790.1\|2687703_2688282_+	type II toxin-antitoxin system antitoxin YqcF	NA	NA	NA	NA
WP_009967791.1\|2688399_2688546_+	hypothetical protein	NA	NA	NA	NA
WP_003229947.1\|2688542_2688905_-	hypothetical protein	NA	NA	NA	NA
WP_004399085.1\|2688920_2689400_-	hypothetical protein	NA	NA	NA	NA
WP_003229946.1\|2689564_2690383_-	N-acetylmuramoyl-L-alanine amidase	A0A218KC88	Bacillus_phage	1.0e-64	74.4
WP_003246208.1\|2690427_2690850_-\|holin	holin family protein	D6R405	Bacillus_phage	3.3e-48	73.7
WP_003246010.1\|2690894_2691788_-	hypothetical protein	NA	NA	NA	NA
WP_003229944.1\|2691875_2692040_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	2.7e-14	67.9
WP_009967793.1\|2692036_2692372_-\|portal	phage portal protein	NA	NA	NA	NA
WP_003229943.1\|2692381_2693482_-	hypothetical protein	M4ZRP1	Bacillus_phage	1.7e-19	56.1
WP_003229942.1\|2693484_2693757_-	hypothetical protein	NA	NA	NA	NA
WP_003229941.1\|2693753_2694332_-	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	1.5e-14	33.8
WP_003229940.1\|2694315_2695362_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	8.3e-72	43.5
WP_004398572.1\|2695354_2695780_-	DUF2634 domain-containing protein	A0A0A8WJV8	Clostridium_phage	1.5e-11	36.4
WP_003229938.1\|2695792_2696056_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_004398524.1\|2696052_2697033_-	hypothetical protein	H7BV96	unidentified_phage	2.1e-40	32.0
WP_004398548.1\|2697045_2697705_-	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	4.8e-25	34.7
WP_003246092.1\|2697697_2702455_-	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	1.3e-44	47.2
WP_003229934.1\|2702457_2702595_-	hypothetical protein	NA	NA	NA	NA
WP_003229933.1\|2702636_2703086_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	2.7e-11	41.1
WP_004398662.1\|2703231_2703411_+	type I toxin-antitoxin system toxin TxpA	NA	NA	NA	NA
WP_075058862.1\|2703790_2703880_+	type I toxin-antitoxin system toxin BsrH	NA	NA	NA	NA
WP_003229930.1\|2704133_2704577_-\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	3.2e-25	45.4
WP_003229929.1\|2704579_2705980_-\|portal	phage portal protein	S5MNC1	Brevibacillus_phage	4.1e-74	39.1
WP_010886574.1\|2705980_2706172_-	hypothetical protein	NA	NA	NA	NA
WP_003229927.1\|2706168_2706606_-	hypothetical protein	NA	NA	NA	NA
WP_003246050.1\|2706618_2707122_-	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	8.3e-38	46.9
WP_003229925.1\|2707118_2707481_-	YqbH/XkdH family protein	A0A249XXE9	Clostridium_phage	6.9e-10	39.3
WP_004398566.1\|2707477_2707873_-	DUF3199 family protein	NA	NA	NA	NA
WP_003229923.1\|2707876_2708188_-	hypothetical protein	NA	NA	NA	NA
WP_003229922.1\|2708198_2709134_-\|portal	phage portal protein	A0A1B1P7E3	Bacillus_phage	8.6e-105	65.0
WP_003229921.1\|2709152_2710121_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	7.4e-59	57.3
WP_003229920.1\|2710153_2710807_-	hypothetical protein	NA	NA	NA	NA
WP_004398748.1\|2710847_2711765_-	hypothetical protein	A0A1B1P7D7	Bacillus_phage	2.4e-51	39.1
WP_004398894.1\|2711761_2713294_-\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	4.7e-148	51.9
WP_003229917.1\|2713297_2714593_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.1e-155	63.4
WP_003229916.1\|2714585_2715305_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	1.7e-55	55.9
WP_004398685.1\|2715372_2715837_-	hypothetical protein	NA	NA	NA	NA
WP_044455521.1\|2715980_2716436_-	hypothetical protein	A0A2H4J4R7	uncultured_Caudovirales_phage	4.5e-59	74.2
WP_003229913.1\|2716633_2717563_+	hypothetical protein	NA	NA	NA	NA
WP_003229912.1\|2717636_2717843_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.5e-20	71.6
WP_009967809.1\|2717924_2718353_-	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	5.6e-43	65.7
WP_003229910.1\|2718448_2718598_-	hypothetical protein	NA	NA	NA	NA
WP_075058863.1\|2718588_2719530_-	ATP-binding protein	A6XMI1	Bacillus_virus	8.0e-58	52.2
WP_010886575.1\|2719411_2720089_-	DNA-binding protein	A0A2H4J6G9	uncultured_Caudovirales_phage	1.1e-05	31.8
WP_003229907.1\|2720164_2721019_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	7.1e-122	79.0
WP_004398673.1\|2721021_2721981_-	YqaJ viral recombinase family protein	A0A2H4JA52	uncultured_Caudovirales_phage	2.2e-135	72.9
WP_003229905.1\|2722086_2722281_-	hypothetical protein	NA	NA	NA	NA
WP_119123069.1\|2722240_2722414_-	hypothetical protein	NA	NA	NA	NA
WP_003245994.1\|2722410_2722668_-	hypothetical protein	A0A2H4J4M9	uncultured_Caudovirales_phage	6.4e-10	42.2
WP_004398626.1\|2722664_2723234_-	helix-turn-helix transcriptional regulator	A0A2H4J884	uncultured_Caudovirales_phage	1.5e-64	61.0
WP_003229902.1\|2723307_2723448_-	hypothetical protein	NA	NA	NA	NA
WP_004398958.1\|2723477_2723708_-	helix-turn-helix transcriptional regulator	A8ATK0	Listeria_phage	1.1e-08	53.4
WP_004398704.1\|2723884_2724235_+	transcriptional regulator SknR	A0A2H4J6F9	uncultured_Caudovirales_phage	2.0e-06	30.6

DBSCAN-SWA_10

2857718 : 2911035

uncultured_Mediterranean_phage(12.5%)

coat,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003229725.1\|2857718_2858864_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	44.0
WP_003229723.1\|2858890_2859919_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003222669.1\|2859948_2860149_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_003229718.1\|2860141_2861146_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	1.1e-07	30.8
WP_003229717.1\|2861156_2861762_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003229715.1\|2861900_2862413_-	sporulation cell-cell signaling protein BofC	NA	NA	NA	NA
WP_003246197.1\|2862460_2863768_-	MFS transporter	NA	NA	NA	NA
WP_004398990.1\|2863838_2864864_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_003246159.1\|2865101_2865749_+	serine/threonine protein kinase	A0A2R3ZQF2	Marseillevirus	5.4e-05	26.3
WP_003229707.1\|2865794_2865917_-	hypothetical protein	NA	NA	NA	NA
WP_003246047.1\|2866001_2866292_+	hypothetical protein	NA	NA	NA	NA
WP_004398683.1\|2866298_2866439_+	hypothetical protein	NA	NA	NA	NA
WP_004398698.1\|2866602_2868057_+	alanine:cation symporter family protein	NA	NA	NA	NA
WP_004398802.1\|2868097_2868820_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_003245996.1\|2868922_2869519_-	spore germination protein SgpA	NA	NA	NA	NA
WP_003229695.1\|2869666_2870830_-\|coat	spore coat assembly protein SafA	NA	NA	NA	NA
WP_003229691.1\|2870946_2872053_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_003229689.1\|2872039_2872909_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_003229687.1\|2872862_2874458_-	L-aspartate oxidase	NA	NA	NA	NA
WP_004398844.1\|2874560_2875748_+	cysteine desulfurase NifS	A0A141ZJV0	Faustovirus	8.6e-33	27.1
WP_004398582.1\|2875707_2876250_+	transcription repressor NadR	NA	NA	NA	NA
WP_004398512.1\|2876274_2877132_-	prephenate dehydratase	NA	NA	NA	NA
WP_003222630.1\|2877148_2877592_-	transcriptional regulator ThrR	NA	NA	NA	NA
WP_003246161.1\|2877652_2878939_-	GTPase ObgE	NA	NA	NA	NA
WP_004399131.1\|2878972_2879551_-	sporulation initiation phosphotransferase Sop0B	NA	NA	NA	NA
WP_003229671.1\|2879628_2879751_+	hypothetical protein	NA	NA	NA	NA
WP_003222623.1\|2879871_2880156_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_003229669.1\|2880168_2880507_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_003229668.1\|2880509_2880818_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_004398649.1\|2880964_2881831_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_004398684.1\|2881823_2882618_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_004398624.1\|2882767_2883574_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_004398901.1\|2883575_2884256_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_004398811.1\|2884308_2884827_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_009967915.1\|2884823_2885696_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_003229650.1\|2885726_2886740_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_003246034.1\|2886831_2887527_-	JAB domain-containing protein	NA	NA	NA	NA
WP_004398496.1\|2887563_2888133_-	septum formation protein Maf	NA	NA	NA	NA
WP_004398782.1\|2888285_2889284_-	stage II sporulation protein SpoIIB	NA	NA	NA	NA
WP_010886586.1\|2889417_2890164_-	prepilin peptidase	NA	NA	NA	NA
WP_003229640.1\|2890303_2891596_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_004398606.1\|2891655_2894298_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
WP_003222590.1\|2894745_2894937_+	hypothetical protein	NA	NA	NA	NA
WP_004399056.1\|2894955_2895981_-\|coat	spore coat protein CotN	NA	NA	NA	NA
WP_003246083.1\|2896013_2897741_-\|coat	spore coat morphogenetic protein SpoVID	NA	NA	NA	NA
WP_004398699.1\|2897871_2899164_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_003229631.1\|2899193_2900168_-	porphobilinogen synthase	NA	NA	NA	NA
WP_003229629.1\|2900164_2900953_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_010886587.1\|2900942_2901887_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_003222575.1\|2901919_2902750_-	protein HemX	NA	NA	NA	NA
WP_004399038.1\|2902757_2904125_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_003229624.1\|2904354_2904852_+	hypothetical protein	NA	NA	NA	NA
WP_003229621.1\|2904873_2905461_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003229618.1\|2905457_2907782_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.4e-182	43.7
WP_004398923.1\|2907962_2909621_-\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
WP_003229613.1\|2909772_2911035_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9

DBSCAN-SWA_11

3484593 : 3495790

Organic_Lake_phycodnavirus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003228374.1\|3484593_3485274_-\|holin	choline ABC transporter permease OpuBD	NA	NA	NA	NA
WP_003228372.1\|3485290_3486211_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003228370.1\|3486222_3486876_-\|holin	choline ABC transporter permease OpuBB	NA	NA	NA	NA
WP_003242811.1\|3486892_3488038_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.0e-15	32.7
WP_003243347.1\|3488321_3488855_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_009968174.1\|3489076_3489553_+	sporulation-delaying system protein SdpA	NA	NA	NA	NA
WP_003228363.1\|3489549_3490521_+	sporulation-delaying protein SdpB	NA	NA	NA	NA
WP_003243360.1\|3490563_3491175_+	sporulation delaying protein SdpC	NA	NA	NA	NA
WP_003228357.1\|3491221_3491845_-	immunity protein SdpI	NA	NA	NA	NA
WP_003243541.1\|3491841_3492114_-	sporulation delaying system autorepressor SdpR	NA	NA	NA	NA
WP_003244403.1\|3492333_3493023_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCD	NA	NA	NA	NA
WP_003228350.1\|3493040_3493952_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_044455615.1\|3493971_3494625_-\|holin	glycine betaine/carnitine/choline/choline sulfate ABC transporter permease OpuCB	NA	NA	NA	NA
WP_003243370.1\|3494647_3495790_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.2e-12	29.3

DBSCAN-SWA_12

3858334 : 3934906

Bacillus_phage(26.67%)

coat,protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003227570.1\|3858334_3860005_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_003243604.1\|3860001_3860430_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_003222002.1\|3860742_3860874_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_010886632.1\|3860830_3860983_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
WP_003242599.1\|3861007_3862354_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_003222006.1\|3862366_3862528_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_003227564.1\|3862524_3863244_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
WP_003243158.1\|3863236_3864547_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
WP_010886633.1\|3864536_3865697_+	insulinase family protein	NA	NA	NA	NA
WP_003242974.1\|3865701_3866982_+	insulinase family protein	NA	NA	NA	NA
WP_003243391.1\|3866978_3867680_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
WP_003244415.1\|3867685_3869062_-	YncE family protein	NA	NA	NA	NA
WP_003227552.1\|3869100_3870456_-	YncE family protein	NA	NA	NA	NA
WP_009968328.1\|3870452_3870683_-	hypothetical protein	NA	NA	NA	NA
WP_003227549.1\|3870685_3871831_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
WP_009968329.1\|3871814_3871934_+	phosphatase RapF inhibitor PhrF	NA	NA	NA	NA
WP_003227547.1\|3872032_3872506_+	YbaK/EbsC family protein	NA	NA	NA	NA
WP_003227545.1\|3872537_3873410_-	agmatinase	NA	NA	NA	NA
WP_003227543.1\|3873470_3874301_-	spermidine synthase	NA	NA	NA	NA
WP_003227540.1\|3874502_3876578_+	penicillin-binding protein	NA	NA	NA	NA
WP_003244446.1\|3876870_3877389_-	hypothetical protein	NA	NA	NA	NA
WP_003243167.1\|3877402_3878062_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3878170_3878359_+	2-hydroxymuconate tautomerase	NA	NA	NA	NA
WP_003242889.1\|3878401_3878821_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003243399.1\|3878940_3880857_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	6.2e-142	43.2
WP_003243441.1\|3881701_3883102_-	MFS transporter	NA	NA	NA	NA
WP_003243988.1\|3883101_3883572_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003227524.1\|3883683_3884184_-	YwgA family protein	NA	NA	NA	NA
WP_003243873.1\|3884219_3885521_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|3885682_3885907_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_003243464.1\|3886121_3886898_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
WP_003242581.1\|3887041_3887932_-	DMT family transporter	NA	NA	NA	NA
WP_003227511.1\|3888099_3888945_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_003243173.1\|3888993_3889893_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_003243393.1\|3890039_3891011_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003242896.1\|3891280_3892045_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_003244095.1\|3892177_3892957_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_003242568.1\|3892971_3894171_-	transaminase BacF	NA	NA	NA	NA
WP_003244502.1\|3894171_3895356_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_003242921.1\|3895352_3896771_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_003243359.1\|3896789_3897551_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
WP_003244300.1\|3897553_3898261_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_009968341.1\|3898250_3898865_-	prephenate decarboxylase	NA	NA	NA	NA
WP_003242790.1\|3899016_3900255_-	MFS transporter	NA	NA	NA	NA
WP_003244348.1\|3900464_3901877_-	amino acid permease	NA	NA	NA	NA
WP_003227487.1\|3901876_3903577_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_003243454.1\|3903650_3905198_-	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_003227482.1\|3905424_3906699_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_003242493.1\|3906875_3907340_-	biofilm-surface layer protein BslB	NA	NA	NA	NA
WP_003242881.1\|3907663_3908119_-\|coat	spore coat polysaccharide biosynthesis protein SpsL	NA	NA	NA	NA
WP_003242585.1\|3908111_3908963_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.1e-37	38.5
WP_003244201.1\|3908976_3909924_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
WP_003243368.1\|3909923_3910664_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	2.6e-48	41.9
WP_003244190.1\|3910688_3911708_-\|coat	spore coat polysaccharide biosynthesis protein SpsG	NA	NA	NA	NA
WP_003243421.1\|3911710_3912433_-\|coat	spore coat polysaccharide biosynthesis protein SpsF	NA	NA	NA	NA
WP_003243135.1\|3912425_3913547_-\|coat	spore coat biosynthesis protein SpsE	NA	NA	NA	NA
WP_003243179.1\|3913546_3914416_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003243878.1\|3914416_3915586_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	5.5e-16	26.6
WP_003243510.1\|3915606_3917031_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_003244383.1\|3917035_3917806_-\|coat	spore coat dTDP-glycosyltransferase SpsA	A0A0F7L2F7	uncultured_marine_virus	3.4e-06	28.6
WP_003227448.1\|3918125_3918671_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
WP_003227446.1\|3918714_3919086_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_003243806.1\|3920488_3920806_-	YwdI family protein	NA	NA	NA	NA
WP_044456259.1\|3920973_3922302_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_003242965.1\|3922326_3923004_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
WP_003242519.1\|3923017_3923824_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_009968358.1\|3923913_3924447_-	hypothetical protein	NA	NA	NA	NA
WP_003227434.1\|3924494_3925130_-	hypothetical protein	NA	NA	NA	NA
WP_003227432.1\|3925122_3925461_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003242645.1\|3925604_3926420_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_003243437.1\|3926509_3926758_-	hypothetical protein	NA	NA	NA	NA
WP_003227428.1\|3926851_3928291_-	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	7.0e-21	26.3
WP_003227426.1\|3928287_3929673_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_003243563.1\|3929974_3930745_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_003243088.1\|3930783_3931614_-	sac operon transcriptional antiterminator SacT	NA	NA	NA	NA
WP_003222155.1\|3931653_3931956_-	hypothetical protein	NA	NA	NA	NA
WP_003227419.1\|3932485_3934906_+\|protease	serine protease Vpr	A0A217EQY2	Bacillus_phage	6.9e-21	36.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045673_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045673_1

4069-4182

Orphan

Consensus_repeat	Method
ACTCCAGTTGATCCAGTTGATCCA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP045673_1

>merge|NZ_CP045673|1|4069-4182|CRISPRCasFinder
GATCCAGTCGTTCCAGTAGAACCGACAGACCCGACTACTCCAGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCGGTTGATCCAGTTGATCCAGTTGATCCA

>NZ_CP045673|1|1|4069-4182|CRISPRCasFinder
GATCCAGTCGTTCCAGTAGAACCG	ACAGACCCGACTACTCCAGTT
GATCCAGTTGATCCAGTTGATCCA	GTTGATCCAGTTGATCCGGTT
GATCCAGTTGATCCAGTTGATCCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045673.1\|WP_000301765.1\|11875_12148_+\|antitoxin	unknown	unknown	gnl\|CDD\|370234
NZ_CP045673.1\|WP_001835294.1\|10655_11552_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|366743
NZ_CP045673.1\|WP_001062589.1\|7791_8409_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP045673.1\|WP_003230498.1\|356_881_-\|DUF309-domain-containing-protein	unknown	unknown	gnl\|CDD\|224464
NZ_CP045673.1\|WP_003223904.1\|1906_2500_+\|SMC-Scp-complex-subunit-ScpB	unknown	unknown	gnl\|CDD\|213521
NZ_CP045673.1\|WP_001835296.1\|11643_11859_+\|peptide-binding-protein	unknown	unknown	gnl\|CDD\|311623
NZ_CP045673.1\|WP_001284311.1\|12149_13013_+\|toxin-zeta	unknown	unknown	gnl\|CDD\|368892
NZ_CP045673.1\|WP_023843711.1\|13190_13331_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045673.1\|WP_001025003.1\|5769_7260_+\|replication-protein-RepR	unknown	unknown	gnl\|CDD\|378031
NZ_CP045673.1\|WP_011266100.1\|5113_5386_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP045673.1\|WP_000516429.1\|3523_3892_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045673.1\|WP_001038790.1\|13275_14013_-\|23S-rRNA-(adenine(2058)-N(6))-methyltransferase-Erm(B)	unknown	unknown	gnl\|CDD\|366074
NZ_CP045673.1\|WP_000108741.1\|8408_10553_+\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP045673.1\|WP_003246108.1\|1161_1917_+\|segregation/condensation-protein-A	unknown	unknown	gnl\|CDD\|234635

Protein	Function_ID	Function_description	E-value
NZ_CP045673.1\|WP_000301765.1\|11875_12148_+\|antitoxin	gnl\|CDD\|370234	pfam08998, Epsilon_antitox, Bacterial epsilon antitoxin. The epsilon antitoxin, produced by various prokaryotes, forms part of a postsegregational killing system which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it.	9.42049e-34
NZ_CP045673.1\|WP_001835294.1\|10655_11552_+\|ParA-family-protein	gnl\|CDD\|366743	pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyze amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.	6.80256e-46
NZ_CP045673.1\|WP_001062589.1\|7791_8409_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.58429e-42
NZ_CP045673.1\|WP_003230498.1\|356_881_-\|DUF309-domain-containing-protein	gnl\|CDD\|224464	COG1547, COG1547, Predicted metal-dependent hydrolase [General function prediction only].	3.52389e-31
NZ_CP045673.1\|WP_003223904.1\|1906_2500_+\|SMC-Scp-complex-subunit-ScpB	gnl\|CDD\|213521	TIGR00281, Segregation_and_condensation_protein_B, segregation and condensation protein B. Shown to be required for chromosome segregation and condensation in B. subtilis. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	2.62328e-84
NZ_CP045673.1\|WP_001284311.1\|12149_13013_+\|toxin-zeta	gnl\|CDD\|368892	pfam06414, Zeta_toxin, Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.	1.35607e-47
NZ_CP045673.1\|WP_001025003.1\|5769_7260_+\|replication-protein-RepR	gnl\|CDD\|378031	pfam08708, PriCT_1, Primase C terminal 1 (PriCT-1). This alpha helical domain is found at the C terminal of primases.	4.89052e-16
NZ_CP045673.1\|WP_011266100.1\|5113_5386_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.26826e-07
NZ_CP045673.1\|WP_001835296.1\|11643_11859_+\|peptide-binding-protein	gnl\|CDD\|311623	pfam07764, Omega_Repress, Omega Transcriptional Repressor. The omega transcriptional repressor regulates expression of involved in copy number control and stable maintenance of plasmids. The omega protein belongs to the structural superfamily of MetJ/Arc repressors featuring a ribbon-helix-helix DNA-binding motif with the beta-ribbon located in and recognising the major groove of operator DNA.	3.67778e-37
NZ_CP045673.1\|WP_001038790.1\|13275_14013_-\|23S-rRNA-(adenine(2058)-N(6))-methyltransferase-Erm(B)	gnl\|CDD\|366074	pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase.	1.79353e-85
NZ_CP045673.1\|WP_000108741.1\|8408_10553_+\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP045673.1\|WP_003246108.1\|1161_1917_+\|segregation/condensation-protein-A	gnl\|CDD\|234635	PRK00104, scpA, segregation and condensation protein A; Reviewed.	2.55197e-115

>NZ_CP045673.1|WP_000516429.1|3523_3892_+|hypothetical-protein
MGKINLNQIYTAKEMSERIGKNRNYLSQAYRNNKHEILKNFNYRKIGGTIIFSDNPNNDLSQLITAKEASQLLGKNDEYFAHIYKRFPHRLEGIDHIYTGKTLFLTKESLEVFKKKMNKNVR
>NZ_CP045673.1|WP_003223904.1|1906_2500_+|SMC-Scp-complex-subunit-ScpB
MGLDIVNWKAIVEALLYAAGDEGLTKKQLLTVLEIEEPELNTIMADVADEYRGDTRGIELIEYADTYMLSTKKDFAPYLKKLIEVPSKGLSQASLEVLAIVSYKQPITRAEIEEIRGVKSERILHSLVAKALLCEVGRADGPGRAILYGTTPTFLEQFGLKTLDELPPLPENAEEDVLQEEADLFFENFNQTFEDIK
>NZ_CP045673.1|WP_003246108.1|1161_1917_+|segregation/condensation-protein-A
MEEYQVKIDTFEGPLDLLLHLINRLEIDIYDIPVAKITEQYLLYVHTMRVLELDIASEYLVMAATLLSIKSRMLLPKQEEELFEDELLEEEDPREELIEKLIEYRKYKDAAKDLKEREEERQKSFTKPPSDLSEYAKEVKQSEQKLSVTVYDMIGAFQKVLKRKKINRPMETTITRQDIPIEARMNEIVHSLKSRGTRINFMDLFPYEQKEHLVVTFLAVLELMKNQLVLIEQEHNFSDIYITGSESIHGA
>NZ_CP045673.1|WP_003230498.1|356_881_-|DUF309-domain-containing-protein
MYPKAYIDYLVEFHATRDYFECHEILEEYWKEDPPKKRKRYWVGFIQLAVALYHHRRQNTAGAKRLMANSIRILQAEHRAVEDLGLDHGRLLELMQSVYEQIETVSAYKSIILPIKDEKLEEACRIECRKKKYTWGQPSALSNIFLIDKHRLRDRTDVIREREKEIERRKKSRD
>NZ_CP045673.1|WP_011266100.1|5113_5386_+|helix-turn-helix-transcriptional-regulator
MELAFRESLKKMRGTKSKEKFSQELEMSRSNYSRIESGKSDPTIKTLEQIAKLTNSTLVVDLIPNEPTEPESEQVTLDLEMEEEKSNDFV
>NZ_CP045673.1|WP_001025003.1|5769_7260_+|replication-protein-RepR
MNIPFVVETVLHDGLLKYKFKNSKIRSITTKPGKSKGAIFAYRSKKSMIGGRGVVLTSEEAIHENQDTFTHWTPNVYRYGTYADENRSYTKGHSENNLRQINTFFIDFDIHTEKETISASDILTTAIDLGFMPTLIIKSDKGYQAYFVLETPVYVTSKSEFKSVKAAKIISQNIREYFGKSLPVDLTCNHFGIARIPRTDNVEFFDPNYRYSFKEWQDWSFKQTDNKGFTRSSLMVLSGTEGKKQVDEPWFNLLLHETKFSGEKGLVGRNSVMFTLSLAYFSSGYSIETCEYNMFEFNNRLDQPLEEKEVIKLVRSAYSENYQGANREYITILCKAWVSSDLTSKDLFVRQGWFKFKKKRSERQRVHLSEWKEDLMAYISEKSDVYKPYLVTTKKEIREALGIPERTLDKLLKVLKANQEIFFKIKSGRNGGIQLASVKSLLLSIIKVKKEEKESYIKALTNSFDLEHTFIQETLNKLAERPKTDTQLDLFSYDTG
>NZ_CP045673.1|WP_001062589.1|7791_8409_+|recombinase-family-protein
MAKIGYARVSSKEQNLDRQLQALQGVSKVFSDKLSGQSVERPQLQAMLNYIREGDIVVVTELDRLGRNNKELTELMNAIQQKGATLEVLNLPSMNGIEDENLRRLINNLVIELYKYQAESERKRIKERQAQGIEIAKSKGKFKGRQHKFKENDPRLKHAFDLFLNGCSDKEVEEQTGINRRTFRRYRTRYNVTVDQRKNKGKRDS
>NZ_CP045673.1|WP_000108741.1|8408_10553_+|type-IA-DNA-topoisomerase
MSTVILAEKPSQALAYAQAFNQSDKKDGYFEIKDPLFTDETFITFGFGHLVELAEPGNYDEKWQNWKLESLPIFPDRYDFEVAKDKGKQFKIVAELLKKANTIIVATDSDREGENIAWSIIHKANAFSKDKTFKRLWINSLEKDVIRSGFQNLQPGMNYYPFYQEAQTRQIADWLIGMNASPLYTLNLQQKGVQGTFSLGRVQTPTLYLIFQRQEAIENFKKEPFFEVEASIKVNQGSFKGVLSPTQRFKTQEELLAFVSSKQAKIGNQEGRITDVQTKEKKTNSPSLFSLSSLQSKVNQLYKATASQTLKAMQGLYEAKLLSYPRTDTPFITENEFAYLKANFGKYSGFLGLDLEMVQTEPRKRYVDGSKVQEHHAIIPTKQVPTESALAKMDDLQRKIYALVVKTTVAMFLPDYLYEETKIQTKVADLLFQSIGKTPKQEGWKILFKQQNKEEKEDVQTLPLVIIGEHAEVDVKSAEKETQPPKAFTEGTLLTAMKTAGKTIDDEEAQKILKDTEGIGTEATRASIIEALKQKEYIQVIKNKLVVTEKGKLLCQAVESQHLLTSAEMTAKWETYLKKIGKREGNQENFITNIKKFIVHLLEAVPTDIEKLNFSDYQEQKEKEAEKSIVGKCPKCGNNIVLKKSFYGCSNYPECKFTLAEHFRKKKLTKTNVKELLEGKETLVKGIKNKEKKSYNAVVKIGEKGYIDFISFSK
>NZ_CP045673.1|WP_001835294.1|10655_11552_+|ParA-family-protein
MIQYYYTKKEWGVVMEKEELKILEELRRILSNKNEAIVILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFKVELPRVNFYEGLKNGNLASSIVHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSNLEELYKQHKEDNLVFQNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYKNVFFEMLERIIQLENEKE
>NZ_CP045673.1|WP_001835296.1|11643_11859_+|peptide-binding-protein
MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
>NZ_CP045673.1|WP_000301765.1|11875_12148_+|antitoxin
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA
>NZ_CP045673.1|WP_001284311.1|12149_13013_+|toxin-zeta
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
>NZ_CP045673.1|WP_023843711.1|13190_13331_-|hypothetical-protein
MSKYCLFLIVIYYLTGGNNSMSRFCKFGKLHVTKGNVDKLLGIGHL
>NZ_CP045673.1|WP_001038790.1|13275_14013_-|23S-rRNA-(adenine(2058)-N(6))-methyltransferase-Erm(B)
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNIRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTVTYEQVLSIFNSYLLFNGRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	48299-48319	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	27953-27973	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	18453-18473	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NC_006978	S.pyogenes plasmid pMD101 DNA	18181-18201	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33586-33606	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4093-4113	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13832-13852	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	50163-50183	0	1.0
NZ_CP045673_1	1.1\|4093\|21\|NZ_CP045673\|CRISPRCasFinder	4093-4113	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42162-42182	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP030934	Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence	1737-1757	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	18426-18446	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	27980-28000	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006978	S.pyogenes plasmid pMD101 DNA	18208-18228	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33631-33651	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4138-4158	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13877-13897	0	1.0
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP030934	Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence	1728-1748	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP030934	Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence	1755-1775	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP030934	Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence	1764-1784	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP030934	Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence	1773-1793	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	18408-18428	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	18435-18455	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	27971-27991	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006979	Streptococcus pyogenes plasmid pSM19035, complete sequence	27998-28018	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006978	S.pyogenes plasmid pMD101 DNA	18199-18219	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_006978	S.pyogenes plasmid pMD101 DNA	18226-18246	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33604-33624	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33613-33633	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33622-33642	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_008445	Enterococcus faecalis RE25 plasmid pRE25, complete sequence	33649-33669	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4111-4131	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4120-4140	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4129-4149	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP045673	Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence	4156-4176	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13850-13870	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13859-13879	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13868-13888	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP038866	Vagococcus sp. CF-49 plasmid punnamed1, complete sequence	13895-13915	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	10193-10213	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	10202-10222	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	10211-10231	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP032740	Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence	10220-10240	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5135-5155	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5144-5164	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5153-5173	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5162-5182	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5171-5191	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5180-5200	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5189-5209	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5198-5218	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5207-5227	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5216-5236	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5225-5245	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_KY579372	Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence	5234-5254	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP041740	Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence	9-29	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP041740	Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence	18-38	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_014475	Enterococcus faecalis plasmid pWZ1668, complete sequence	1651-1671	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_014475	Enterococcus faecalis plasmid pWZ1668, complete sequence	1660-1680	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP014284	Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence	178881-178901	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15077-15097	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15086-15106	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15095-15115	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15104-15124	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15113-15133	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15122-15142	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15131-15151	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15140-15160	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15149-15169	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15158-15178	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15167-15187	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15176-15196	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15185-15205	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15194-15214	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15203-15223	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_MF580438	Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence	15212-15232	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37202-37222	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37211-37231	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37220-37240	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37229-37249	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37238-37258	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37247-37267	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37256-37276	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37265-37285	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37274-37294	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37283-37303	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	37292-37312	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	81453-81473	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	81462-81482	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MH830362	Enterococcus faecalis plasmid p4, complete sequence	81471-81491	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_011140	Enterococcus faecium plasmid pIP816, complete sequence	20359-20379	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_011140	Enterococcus faecium plasmid pIP816, complete sequence	20368-20388	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_011140	Enterococcus faecium plasmid pIP816, complete sequence	20377-20397	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_011140	Enterococcus faecium plasmid pIP816, complete sequence	20386-20406	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_011140	Enterococcus faecium plasmid pIP816, complete sequence	20395-20415	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP032609	Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence	270782-270802	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28253-28273	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28262-28282	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28271-28291	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28280-28300	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28289-28309	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28298-28318	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28307-28327	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_AP018541	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence	28316-28336	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_019284	Enterococcus faecalis plasmid pWZ7140, complete sequence	1651-1671	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_019284	Enterococcus faecalis plasmid pWZ7140, complete sequence	1660-1680	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_019213	Enterococcus faecalis plasmid pWZ909, complete sequence	1651-1671	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_019213	Enterococcus faecalis plasmid pWZ909, complete sequence	1660-1680	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	734976-734996	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	734985-735005	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	734994-735014	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	735003-735023	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	735012-735032	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_013514	Enterococcus faecalis plasmid pAMbeta1, complete sequence	27022-27042	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_013514	Enterococcus faecalis plasmid pAMbeta1, complete sequence	27031-27051	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NC_013514	Enterococcus faecalis plasmid pAMbeta1, complete sequence	27040-27060	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42090-42110	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42099-42119	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42108-42128	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42117-42137	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42126-42146	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42135-42155	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	NZ_CP033741	Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence	42144-42164	1	0.952
NZ_CP045673_1	1.2\|4138\|21\|NZ_CP045673\|CRISPRCasFinder	4138-4158	21	MN694403	Marine virus AFVG_250M373, complete genome	19488-19508	1	0.952

1. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

2. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

3. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

4. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

5. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

6. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

7. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

8. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

9. spacer 1.1|4093|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acagacccgactactccagtt	CRISPR spacer
acagacccgactactccagtt	Protospacer
*********************

10. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP030934 (Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

11. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

12. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

13. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

14. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

15. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

16. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtt	Protospacer
*********************

17. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP030934 (Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

18. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP030934 (Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

19. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP030934 (Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

20. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP030934 (Enterococcus gilvus strain CR1 plasmid pCR1B, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

21. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

22. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

23. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

24. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006979 (Streptococcus pyogenes plasmid pSM19035, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

25. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

26. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_006978 (S.pyogenes plasmid pMD101 DNA) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

27. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

28. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

29. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

30. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_008445 (Enterococcus faecalis RE25 plasmid pRE25, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

31. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

32. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

33. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

34. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP045673 (Bacillus subtilis strain 2014-3557 plasmid pGMrib, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

35. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

36. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

37. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

38. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP038866 (Vagococcus sp. CF-49 plasmid punnamed1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

39. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccggtc	Protospacer
********************.

40. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

41. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

42. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP032740 (Enterococcus casseliflavus strain EC-369 plasmid pEC369, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

43. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

44. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

45. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

46. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

47. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

48. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

49. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

50. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

51. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

52. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

53. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

54. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_KY579372 (Enterococcus faecium strain F120805 substr. faecium plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

55. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP041740 (Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

56. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP041740 (Enterococcus faecalis EnGen0107 strain B594 plasmid p2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

57. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_014475 (Enterococcus faecalis plasmid pWZ1668, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

58. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_014475 (Enterococcus faecalis plasmid pWZ1668, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

59. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP014284 (Bacillus thuringiensis strain Bt185 plasmid pBT1850294, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatcctgttgatccggtt	Protospacer
******** ************

60. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

61. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

62. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

63. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

64. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

65. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

66. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

67. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

68. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

69. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

70. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

71. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

72. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

73. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

74. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

75. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_MF580438 (Enterococcus faecium strain E35048 plasmid pE35048-oc, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

76. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

77. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

78. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

79. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

80. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

81. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

82. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

83. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

84. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

85. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

86. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

87. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

88. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

89. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

90. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_011140 (Enterococcus faecium plasmid pIP816, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

91. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_011140 (Enterococcus faecium plasmid pIP816, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

92. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_011140 (Enterococcus faecium plasmid pIP816, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

93. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_011140 (Enterococcus faecium plasmid pIP816, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

94. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_011140 (Enterococcus faecium plasmid pIP816, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

95. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP032609 (Bacillus thuringiensis strain QZL38 plasmid p.2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatcctgttgatccggtt	Protospacer
******** ************

96. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

97. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

98. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

99. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

100. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

101. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

102. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

103. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_AP018541 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-3, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

104. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_019284 (Enterococcus faecalis plasmid pWZ7140, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

105. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_019284 (Enterococcus faecalis plasmid pWZ7140, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

106. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_019213 (Enterococcus faecalis plasmid pWZ909, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

107. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_019213 (Enterococcus faecalis plasmid pWZ909, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

108. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

109. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

110. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

111. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

112. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

113. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_013514 (Enterococcus faecalis plasmid pAMbeta1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

114. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_013514 (Enterococcus faecalis plasmid pAMbeta1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

115. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NC_013514 (Enterococcus faecalis plasmid pAMbeta1, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

116. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

117. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

118. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

119. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

120. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

121. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

122. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to NZ_CP033741 (Enterococcus sp. FDAARGOS_553 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatccagtt	Protospacer
*****************.***

123. spacer 1.2|4138|21|NZ_CP045673|CRISPRCasFinder matches to MN694403 (Marine virus AFVG_250M373, complete genome) position: , mismatch: 1, identity: 0.952

gttgatccagttgatccggtt	CRISPR spacer
gttgatccagttgatcctgtt	Protospacer
***************** ***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7791 : 19510

Streptococcus_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062589.1\|7791_8409_+	recombinase family protein	A0A219YA40	Aeromonas_phage	4.5e-17	36.1
WP_000108741.1\|8408_10553_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.5e-264	96.9
WP_001835294.1\|10655_11552_+	ParA family protein	A0A1X9I765	Streptococcus_phage	8.2e-153	98.2
WP_001835296.1\|11643_11859_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_000301765.1\|11875_12148_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_001284311.1\|12149_13013_+	toxin zeta	NA	NA	NA	NA
WP_023843711.1\|13190_13331_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.0e-15	93.0
WP_001038790.1\|13275_14013_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
WP_031929417.1\|14137_14221_-	23S rRNA methyltransferase attenuator leader peptide ErmL	NA	NA	NA	NA
WP_001284311.1\|14707_15571_-	toxin zeta	NA	NA	NA	NA
WP_000301765.1\|15572_15845_-	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_001835296.1\|15861_16077_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_001835294.1\|16168_17065_-	ParA family protein	A0A1X9I765	Streptococcus_phage	8.2e-153	98.2
WP_160232621.1\|17167_19510_-	type IV secretory system conjugative DNA transfer family protein	A0A1X9I6W8	Streptococcus_phage	1.1e-132	96.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045672

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045673

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection