CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_AP022332	Methylosinus sp. C49 isolate Methylosinus sp. C49	3 crisprs	DEDDh,cas3,RT,WYL,csa3	1	2	3
NZ_AP022336	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49d, complete sequence	0 crisprs	NA	0	0	1
NZ_AP022334	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49b, complete sequence	0 crisprs	NA	0	0	1
NZ_AP022333	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49a, complete sequence	0 crisprs	csa3,cas3	0	0	0
NZ_AP022335	Methylosinus sp. C49 isolate Methylosinus sp. C49 plasmid pMSC49c, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_AP022332_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP022332_1

516904-517004

Orphan

Consensus_repeat	Method
GGCGACCGCCCGCGCGGCCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_AP022332_1

>merge|NZ_AP022332|1|516904-517004|CRISPRCasFinder
GGCGACCGCCCGCGCGGCCGGCGCCGGCGAGGGGCTCTGCGCGGCGATCGAAAAGGCCAATAGCGCGCTGGAGGCGCAGGCGACCGCCCGCGCGGCGGGCG

>NZ_AP022332|1|1|516904-517004|CRISPRCasFinder
GGCGACCGCCCGCGCGGCCGGCG	CCGGCGAGGGGCTCTGCGCGGCGATCGAAAAGGCCAATAGCGCGCTGGAGGCGCA
GGCGACCGCCCGCGCGGCGGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP022332.1\|WP_161912201.1\|505910_506540_-\|cyclodeaminase/cyclohydrolase-family-protein	unknown	unknown	gnl\|CDD\|377428
NZ_AP022332.1\|WP_161912212.1\|520726_522577_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293737
NZ_AP022332.1\|WP_161912209.1\|517164_518604_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341045
NZ_AP022332.1\|WP_174242353.1\|527723_528620_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213022
NZ_AP022332.1\|WP_161912210.1\|518677_519511_-\|molybdenum-storage-protein-subunit-alpha	unknown	unknown	gnl\|CDD\|239788
NZ_AP022332.1\|WP_161912200.1\|504696_505866_-\|malate--CoA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|237594
NZ_AP022332.1\|WP_161912215.1\|525173_526133_-\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119375
NZ_AP022332.1\|WP_161912207.1\|514409_515387_-\|cobalamin-biosynthesis-protein-CobD	unknown	unknown	gnl\|CDD\|377002
NZ_AP022332.1\|WP_161912203.1\|507564_508506_-\|D-2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240639
NZ_AP022332.1\|WP_162561571.1\|524778_525177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP022332.1\|WP_161912205.1\|509965_511690_-\|formate--tetrahydrofolate-ligase	unknown	unknown	gnl\|CDD\|376511
NZ_AP022332.1\|WP_174242352.1\|515390_515942_-\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
NZ_AP022332.1\|WP_161912204.1\|508623_509817_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|178031
NZ_AP022332.1\|WP_161914847.1\|512351_512756_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	unknown	unknown	gnl\|CDD\|376583
NZ_AP022332.1\|WP_161912211.1\|519519_520332_-\|uridine-kinase	unknown	unknown	gnl\|CDD\|239788
NZ_AP022332.1\|WP_161912214.1\|523530_524742_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226868
NZ_AP022332.1\|WP_161912202.1\|506557_507418_-\|methylenetetrahydrofolate-dehydrogenase	unknown	unknown	gnl\|CDD\|133446
NZ_AP022332.1\|WP_161912216.1\|526216_527629_-\|magnesium-transporter	unknown	unknown	gnl\|CDD\|225148
NZ_AP022332.1\|WP_161912206.1\|512980_514243_-\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|226926
NZ_AP022332.1\|WP_161912213.1\|522692_523091_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP022332.1\|WP_161912201.1\|505910_506540_-\|cyclodeaminase/cyclohydrolase-family-protein	gnl\|CDD\|377428	pfam04961, FTCD_C, Formiminotransferase-cyclodeaminase. Members of this family are thought to be Formiminotransferase- cyclodeaminase enzymes EC:4.3.1.4. This domain is found in the C-terminus of the bifunctional animal members of the family.	2.65755e-71
NZ_AP022332.1\|WP_161912212.1\|520726_522577_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|293737	cd16013, AcpA, acid phosphatase A. Acid phosphatase A catalyzes the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at low pH. AcpA hydrolyzes a variety of substrates, including p-nitrophenylphosphate (pNPP), p-nitrophenylphosphorylcholine (pNPPC), peptides containing phosphotyrosine, inositol phosphates, AMP, ATP, fructose 1,6-bisphosphate, glucose and fructose 6-phosphates, NADP, and ribose 5-phosphate. AcpA is distinct from histidine ACPs and purple ACPs, as well as class A, B, and C bacterial nonspecific ACPs.	6.27809e-55
NZ_AP022332.1\|WP_161912209.1\|517164_518604_+\|MFS-transporter	gnl\|CDD\|341045	cd17502, MFS_Azr1_MDR_like, Saccharomyces cerevisiae Azole resistance protein 1 (Azr1p), and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including various Saccharomyces cerevisiae proteins such as azole resistance protein 1 (Azr1p), vacuolar basic amino acid transporter 1 (Vba1p), vacuolar basic amino acid transporter 5 (Vba5p), and Sge1p (also known as Nor1p, 10-N-nonyl acridine orange resistance protein, and crystal violet resistance protein). MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.3546e-55
NZ_AP022332.1\|WP_174242353.1\|527723_528620_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213022	cd10917, CE4_NodB_like_6s_7s, Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.	1.34443e-50
NZ_AP022332.1\|WP_161912210.1\|518677_519511_-\|molybdenum-storage-protein-subunit-alpha	gnl\|CDD\|239788	cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis. The Mo storage protein from the nitrogen-fixing bacterium, Azotobacter vinelandii, is characterized as an alpha4-beta4 octamer containing a polynuclear molybdenum-oxide cluster which is ATP-dependent to bind Mo and pH-dependent to release Mo. These and related bacterial sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).	1.53317e-134
NZ_AP022332.1\|WP_161912200.1\|504696_505866_-\|malate--CoA-ligase-subunit-beta	gnl\|CDD\|237594	PRK14046, PRK14046, malate--CoA ligase subunit beta; Provisional.	0
NZ_AP022332.1\|WP_161912215.1\|525173_526133_-\|glycoside-hydrolase-family-25	gnl\|CDD\|119375	cd06413, GH25_muramidase_1, Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.	1.56148e-92
NZ_AP022332.1\|WP_161912207.1\|514409_515387_-\|cobalamin-biosynthesis-protein-CobD	gnl\|CDD\|377002	pfam03186, CobD_Cbib, CobD/Cbib protein. This family includes CobD proteins from a number of bacteria, in Salmonella this protein is called Cbib. Salmonella CobD is a different protein. This protein is involved in cobalamin biosynthesis and is probably an enzyme responsible for the conversion of adenosylcobyric acid to adenosylcobinamide or adenosylcobinamide phosphate.	6.28779e-107
NZ_AP022332.1\|WP_161912203.1\|507564_508506_-\|D-2-hydroxyacid-dehydrogenase	gnl\|CDD\|240639	cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	8.9316e-163
NZ_AP022332.1\|WP_161912205.1\|509965_511690_-\|formate--tetrahydrofolate-ligase	gnl\|CDD\|376511	pfam01268, FTHFS, Formate--tetrahydrofolate ligase.	0
NZ_AP022332.1\|WP_174242352.1\|515390_515942_-\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	5.76971e-62
NZ_AP022332.1\|WP_161912204.1\|508623_509817_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|178031	PLN02409, PLN02409, serine--glyoxylate aminotransaminase.	0
NZ_AP022332.1\|WP_161914847.1\|512351_512756_-\|peptide-methionine-(R)-S-oxide-reductase-MsrB	gnl\|CDD\|376583	pfam01641, SelR, SelR domain. Methionine sulfoxide reduction is an important process, by which cells regulate biological processes and cope with oxidative stress. MsrA, a protein involved in the reduction of methionine sulfoxides in proteins, has been known for four decades and has been extensively characterized with respect to structure and function. However, recent studies revealed that MsrA is only specific for methionine-S-sulfoxides. Because oxidized methionines occur in a mixture of R and S isomers in vivo, it was unclear how stereo-specific MsrA could be responsible for the reduction of all protein methionine sulfoxides. It appears that a second methionine sulfoxide reductase, SelR, evolved that is specific for methionine-R-sulfoxides, the activity that is different but complementary to that of MsrA. Thus, these proteins, working together, could reduce both stereoisomers of methionine sulfoxide. This domain is found both in SelR proteins and fused with the peptide methionine sulfoxide reductase enzymatic domain pfam01625. The domain has two conserved cysteine and histidines. The domain binds both selenium and zinc. The final cysteine is found to be replaced by the rare amino acid selenocysteine in some members of the family. This family has methionine-R-sulfoxide reductase activity.	1.07594e-75
NZ_AP022332.1\|WP_161912211.1\|519519_520332_-\|uridine-kinase	gnl\|CDD\|239788	cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis. The Mo storage protein from the nitrogen-fixing bacterium, Azotobacter vinelandii, is characterized as an alpha4-beta4 octamer containing a polynuclear molybdenum-oxide cluster which is ATP-dependent to bind Mo and pH-dependent to release Mo. These and related bacterial sequences in this CD are members of the Amino Acid Kinase Superfamily (AAK).	5.28271e-148
NZ_AP022332.1\|WP_161912214.1\|523530_524742_+\|hypothetical-protein	gnl\|CDD\|226868	COG4461, LprI, Uncharacterized protein conserved in bacteria, putative lipoprotein [Function unknown].	8.88144e-09
NZ_AP022332.1\|WP_161912202.1\|506557_507418_-\|methylenetetrahydrofolate-dehydrogenase	gnl\|CDD\|133446	cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an alpha-beta-alpha configuration. NAD binding involves numerous hydrogen and van der Waals contacts.	1.79103e-60
NZ_AP022332.1\|WP_161912216.1\|526216_527629_-\|magnesium-transporter	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	7.48949e-133
NZ_AP022332.1\|WP_161912206.1\|512980_514243_-\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|226926	COG4553, DepA, Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism].	0

>NZ_AP022332.1|WP_174242352.1|515390_515942_-|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MTRNLLDFHILLAPAEAAGGGFSLTSPDIAEGATIDRKFVFDDFGGTGDNVSPQLNWSEPPAGTKSFALFCHDPDAPTGGAGFWHWLVVDIPASARALAQGAGAAGGAGLPAGAKPIRNDYGFSHWGGPCPPVGDPPHRYVFTVYALSVEKVEAPEGATASLVGFIVNQNVLAKASLTGLYGR
>NZ_AP022332.1|WP_161912207.1|514409_515387_-|cobalamin-biosynthesis-protein-CobD
MLAALAENLALAALGLSIEAAIGYPPRLFAAIGHPVTWIGALIAALDRSLNHDGAPPLLRRLAGVVAILLVVAIAFAIGWLLQAACLALPFGILPLAVLTSSLYAQRSLYTHVRDVAEQLDRSLERGRASVGKIVGRDVSRLDEAGVSRAAIESLAENFSDGVIGPALATVLFGLPGALIYKSVNTADSMIGHRTMRHEAFGWASARLDDLLNLPAARLSAALIAIGAALTGTSFRAAISTCLSDAGAHASPNAGWPEAAMAGALDLRLGGPRAYGAHEVAGVWLGSGRAEATPADIRRALRIFSCAAATTICAFAGAAVVLLSN
>NZ_AP022332.1|WP_161912206.1|512980_514243_-|polyhydroxyalkanoate-depolymerase
MDRISYQFYEMMHLAFAPARAMSDATLTTFKNPFNPFAHTSVGRSVAAAAELFERMTRRYGKPIFDLPETLIDGVATPIVEEVVWERPFCRLLHFQRIFQGEAPRQSKLLIVAPMSGHYATLLRGTVEAFLPSHDVYITDWCDARAVPTEKGVFGLDDYVDYLVDMLRLLSKRDDGVPLHTLGVCQASVPLVCAIAALDGEGGVDAPESMVLMGGPIDPRRSPTAVNRLAVERGVDWFHRNCIHSVPFPHAGLGRKVYPGFLQLSGFMAMNLERHVAAHFDMFNHLVEGDGDSAEKHRDFYDEYLAVMDLAAEFYLETVEKVFIRHEIPQGLLRHRGEIIDLSAIQRTALLTVEGEKDDISGVGQTYAAQELCANIPDVRKQHYLQEGVGHYGVFNGSRFRREIVPRIRDFFARVETYSS
>NZ_AP022332.1|WP_161914847.1|512351_512756_-|peptide-methionine-(R)-S-oxide-reductase-MsrB
MTSGDQFPVTRTEEEWRARLTPDQYVIMRRHGTEPPGSCALDQEKRPGVFSCAGCDQPLFATRQKFSSGTGWPSFFDPLDGAIATSVDHSHGMTRTEVHCSRCGSHLGHVFPDGPPPTGLRYCINGLALTFFPE
>NZ_AP022332.1|WP_161912205.1|509965_511690_-|formate--tetrahydrofolate-ligase
MSDTSIPASGKGNQHLSPKSDIEISQAASMRPIVDVAREKLGIPAEHVLPYGHYKAKISLDYLNSLQDRPDGKLILVTAITPTPAGEGKTTTTVGLGDALNHIGKKAIMCLREPSLGPCFGVKGGAAGGGYAQVVPMEDINLHFTGDFHAIGAANNLLSALIDNHVYWGNSLGVDPRRISWRRAVDMNDRSLRSIVSSLGGVANGFPREDGFDITVASEVMAIFCLATSLEDLQRRLGDIIVAQTRDKKSIRASELKAQGSMAALLKDAIAPNLVQTLENNPAFIHGGPFANIAHGCNSVIATKAALKLADYVVTEAGFGADLGAEKFFDIKCRKAGIKPDVTVIVATIRALKMHGGVAKDDLKVENVAALEKGFANLKRHIANVQKFGVPVIVSVNRFSTDTQAEIDLLQKLSEAEGVDCVLADHWGSGGPGAAELAHKVVSTIETKPSQFKPLYADDLPLVEKVRTIARELYGASDIALDPSVKTRFAELEKEGFGHLPVCIAKTQYSFSTDANAKGAPSGHVIPVRELRLSAGAEFVVVVCGDIMTMPGLPKVPAANNIEVGADGRIAGLF
>NZ_AP022332.1|WP_161912204.1|508623_509817_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MSNSRIPGRNFLFVPGPTNIPDRILRAMNVVSEDHRSPKFPELTLPLFTQLKKVFKTESAQAFIFPASGTGGWEAAITNTLSPGDKVIAQRFGQFTHLWIDLAKRIGLDVIEQDEEWGVGNNPDRIEETLKADKNHEIKAVFATHNETATGVTSDIGAVRKAIDNAKHPAMLFVDGVSSVGSLDFKQDEWGVDVAVSGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDHVKANATGYFPYTPALPLLYGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQAVYRANPILQV
>NZ_AP022332.1|WP_161912203.1|507564_508506_-|D-2-hydroxyacid-dehydrogenase
MSHKIVFLDRETLDANLRKPNFPHDYTEYAQSSPADVVERLKGATIAITNKVPLREDALKQLPDLKLIAVAATGTDVIDKAYTTANGITVSNIRNYAYNTLPEHVIALIFALRRNLVNYVDSVRRGRWQEASQFCYFDYPIYDIAGSTLGIIGYGALGKSIATRAEALGMKLLINDVVPGPGIVDIPTILREADVVTLNLPLTPQTKNLIGAKELASMKKTSIIINTARGGIVDEQALADALRNGVIAGAGFDVLTVEPPKQGNILLDPTIPNLIVTPHVAWASREAMQVLADQLIDNVDAFVAGAPRNLVTA
>NZ_AP022332.1|WP_161912202.1|506557_507418_-|methylenetetrahydrofolate-dehydrogenase
MTQKLLFLLDTDAVPSVFDTVVAYDGGADHVIGYANVTPANVGALVDGAIYTRGPKEKQFTALFVGGGDMVAGETLFKAVRKRFFSNFRVSVMLDSNGSNTTAAAGVALLAKAKPLAGKKATVLAGTGPVGLRAAAFLHSEGAEVAITSRQKSRADAAAAALQERFGFTPTAIEAVDNAARAAAVKGTNIVFAAGAIGVQLLEEKDWQNDPTIELLADVNAQPPLGIGGVEATDKAKERHGKIVIGALGVGGLKLKLHRACIGQLFESSDKVLDAEEIYAQAKANA
>NZ_AP022332.1|WP_161912201.1|505910_506540_-|cyclodeaminase/cyclohydrolase-family-protein
MTKDETIGKFLDDLASERPTPGGGGAAAVMGAIGAALVSMVANLTIGKKNYEAVEEDLKAARAEAERVRAELTAAIDEDVVAFNSVMGAYGLPRATDEDKAVRTAAIQVALKDATLAPLRAVKACFEVIVLSEAVADKGNLNVISDAGVAVLAANAGLRSAALNVYINAKAIKDREFAEKQIGEVEALLAAAAEKTEAVYKVVRDKIGS
>NZ_AP022332.1|WP_161912200.1|504696_505866_-|malate--CoA-ligase-subunit-beta
MDVHEYQAKELLASCGVAVPPGTVAFSPDQAVYAATELGGSHWVVKAQIHAGARGKAGGVKLCRTYHEVQQAARELLGKRLVTKQTGPEGKPVQRVYVELADPYERELYLGFVLDRKLERVRVIASKHGGMEIEEIAKTDPDAILQVIVEPAVGLLPFQARELAFQLGLNLKQVSRAVQSILGAYRAFRDNDATMLEINPLVVTKDDKVLALDAKMSFDDNALFRRRNIVDMNDPSQSDPREAQALEHSLNYIGLDGEIGCIVNGAGLAMATMDMIKHAGGNPANFLDVGGGASAERVATAFRLVLSDANVKVVLVNIFAGINRCDWVAQGVVDAVKATNITAPLVVRLAGTNVEAGRKLLDESGINVITADSLADAAQKAVAAWRSVK
>NZ_AP022332.1|WP_161912209.1|517164_518604_+|MFS-transporter
MNKPAAGFSHAHLSRGEMLQIMIGLGLAMLLSALDQTIVATALPTIGKDLGDFEHLPWIVTAYLVAATALTPLYGKLADIHGVRVMLLIGIFTFVLGSLACAVSPNLTLLAIARAAQGAGGGALIALAQTIIADLVSVRERGRALAYFSVVFAGASVGGPILGGVFAEYLHWSLIFWINLPLGLAAFFMTYFKLARLPLRRHPHRVDIAGAAMLIVASVASLLALSWGGVRYPWGSAPILAMLATALAGWAIFAWRTKTAEEPLIPLAVLADDVIRNAILAGGFGLGTFVALTMYMPIYFEGALRLSADQSGLALIPLTVATVTGAAISGRLLGRLRHYKAPPLAALALAFVALLIARQFLADLPLAALDALLAIVGFGVGAMLPVTTVCVQSAAPGHNLGTATAVMQFSRQLGAALIVAIIGAIVIGAGHGALIAEAGAGVEALRETFRTAFLVGAMFIALCFFFLARMEERNLHGEG
>NZ_AP022332.1|WP_161912210.1|518677_519511_-|molybdenum-storage-protein-subunit-alpha
MTHTYNIKHVASPLARQTLLDSELTRPVAGKRPIRVLPWLQVVKIGGRSIMDRGADAILPLVEEIRKLMPEHRLLFLTGAGVRARHLYGVGLDLGLPVGSLAPLAASEAGQNGHILASLLAPEGVSYIEHPTIANQLAIHLSATRAVVGSAFPPYHHHEFPGSRIPPHRADTGAFLLADAYGAAGLTIVEDVDGLYTSDPNGPDGEKAQLIGETSFAEVAEHKGTLPFDRALLEVMATARHIDHVQIVNGLVPGRLTAALRGEHVGTIIHTAARRNS
>NZ_AP022332.1|WP_161912211.1|519519_520332_-|uridine-kinase
MAHTTAELEAILMQRSLTDVELLAAADKAEDFRILPDASVIKIGGQSIIDRGRSAVYPLVDEIVTARKTHQMLIGTGAGTRARHLYSIAAGVGLPAGVLSQLGASVADQNAAMLGQLLAKHGISAVEGAGLSAVPLYLEEVNAVVFSGMPPYNLWMRPAAEGVIPPYRTDAGCFLIAEQFGCKAMIFVKDEQGLFTANPKTDKNAKFIPKITVDEMKEQGLQDSILEFPLLDLLKSARHIREVQVVNGLVPGNMTRALSGEHVGTIITAS
>NZ_AP022332.1|WP_161912212.1|520726_522577_+|alkaline-phosphatase-family-protein
MNIRLFLKSACLATTALTATSTAIVANADSSTRTPIKHVIIVVGENRTFDNLFGGYRPAAGQSVDNLLSKGIIKADGTPGPHFSEAAQNIGSDLYHYEVATPSTGAYATLPQPYTTYAAGVPQGVPDTRFPADLPNGPYQISKYVSYAAYTGDPVHRFFQMWQQWDGGKLDKFVWVEKTIGTGSNGKPPAGFDPKEGAISMGFFNMNAYTDAHGVAQTGDAPYFKSLADSYAISDNFHQAVMGGTGANFQAIVTGHAAFYTDPTRLDGSPATPPVNQIENPDPVSGTNNYYTQDGYSGGSYVNCHDLSQPGVAAVDQQLRRNGAFERKCAPGHYYLVNNYNMYWNEKPSVTRALGATNFTLPPQKASTIVDVLNAHGVSWKYYSADRGDDPTVFANSVDGVNFPVAGGTPFHAYCGICDPLTGYLQVMTTSEYAKLQNYGAFLKDLTDSALPAVSFVRPFEAFAAHPADSTSHLYEQFLKTLIARVQSSSAWDSTAIFITTDEGGGYYDSGYIQPVDFFGDGTRIPFIAVSPYAKKGYVDHTYYDHVSLLKFIERNWKLPTVSHLSRDNLPNPIPSRENPYIPANRPAIGDLVDLFVFADHDDDHDHGHHHHGRDR
>NZ_AP022332.1|WP_161912213.1|522692_523091_-|hypothetical-protein
MRLAAAIFATCVSFSVLALEMPAASPKDMAPAAIAQLDVRVPETAPVADVAPLPPVIERARVARPSTAAPHRRICSAARRSGALAHHPLPTRRRIEARAPLLPAPVAEALHPAARRCEAITCPRFVLVGVGF
>NZ_AP022332.1|WP_161912214.1|523530_524742_+|hypothetical-protein
MDCAKATTLVEKTICADPHIKWQDDVISRNYFAALKSLREKGDKPAHAQMQETQRRWLAARNACGSKAAGGLDYCIEETTSKRLGRLPAPTAEAGAVPPAGLRIGTEILAWGKPKDGLRTLDHRGRIVLQEPRNSLVDSPFTIHDRWKDGQTDAVLVEEGAADYNNCSTFYVVESRKPGAVARHELGKICGDRSSDDDSDNDPDPWSTRNADGFAFVSPARPFSNGEVRQWRSKTGDLTTSVIQFLPTPGSTMQSLAESQEPKVIEPLRNAEFFAAVSRLATLDRRRMADALWELTNGGYRNRSPDMPQPELYGLAMDQNTVAYSGCGAVWRGGAHFGCEEGDALAVWDRAGGGFYFALNKFGDNGRDREKAQVEPPLASWPPSTRARYENWRNGGRWTDERR
>NZ_AP022332.1|WP_162561571.1|524778_525177_-|hypothetical-protein
MIPRRAARARAFWLALAATLPAAEAAGCEAGDPSLVGHYYLSGVMETGSELLLRPDGRFDYMLAYGALDEIASGCWSRRGDMVTLAVSKFEASMDDPMKFDRLELAVTPRGGLSRRFEGGRTGVYSRPRGGR
>NZ_AP022332.1|WP_161912215.1|525173_526133_-|glycoside-hydrolase-family-25
MRSNEIFAAAAAVLLSTALSGCGSAVDPSYSARPRFATSAPLVNARKDPTYLAYAVPESQLHAYPATRSAEFAVHGVDVSKYQGDIDWQAVKESGVGFAFIKATEGGDALDSKFQRNWAAAKAAGVPRGAYHFVYWCRPPHEETGFFKSVVPVEPDALPPVLDVEATPTSRSCKRTLYRDEVLRDMRVMLEDMERHYGKKPIIYSSVDFYQAILHSGALAEYPIWVRSTKYHPAVRYGDRKWTFWQYRSDGHVPGIPVAVDQNTFNGSHAQWREWLADQTGLKAQPVATAAAKPIDDRSIEKLIEEDPAMLPSAMKNAQ
>NZ_AP022332.1|WP_161912216.1|526216_527629_-|magnesium-transporter
MSQDHEKSAPAEGNFRDEETGEPRADFVAAVEEAIAEGDSGHVKELVSPLHEADVGALIELLDHEERPRLVELMGDEFDFAALTEVGETTREEILEELPVATLAEAMRELESDDAVAILETLEPEEQAEVLEALPAQERIILRRSLEAAEGTAGRLMQTTLIAVPPFWSAGEVLDFFRATEPDELPDNFFEVFVVDPAYRLLGTVFLDALVRAHPQTRVEEIMQADRRRVQFDEDTEEVARLFERYNLVSVPVVDEAERLVGVITIDDVVDVIQEAASEEIKALGGVSPDEELTDSFWWIVKSRFLWLLINLGTAFISASVLKTFESQLQQMVALAVLAPIVASQGGNSATQTMTVTVRALATRELSRSNAMRIILRELATGAFNGAAFGLLTGLVAANWFQTIGLGPVMAMAMFTNLAAGALGGILVPMLLERWKVDPAVASSAFVTTVTDVVGYGSFLGIATLWFRLG
>NZ_AP022332.1|WP_174242353.1|527723_528620_+|polysaccharide-deacetylase-family-protein
MHVLSTLFRLTAALLALMPAAAGAAECGAQALGVSRTIAIDGSEGLALGLQTYPRTLALADHEVVLTFDDGPAHGATERVLDALKAECARATFFLVGSHAAESPALVRRIVAEGHNAGHHSYSHPARTLRLMSEDAAQADIEKGFRAVDAAAGFPPADSPHFPFFRFPGFADTPQLVRWLEDRDVSVFGADLWASDWQEMSPHAELELVMSRLQAAGKGIVLFHDPRPSTAAMMPDFLRELKARGFRLVHIVPGEGPTPIARAKPGWTSATEAIIAKTLGPKGLRSEPQEEGRGVKSQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP022332_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP022332_3

3284192-3284358

Orphan

Consensus_repeat	Method
CAGATCGGCGCGCTCACCTCGAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_AP022332_3

>merge|NZ_AP022332|3|3284192-3284358|CRISPRCasFinder
CAGATCGGCGCCTTGTCGGCGACGGCTTTCGCCGGCCTCTCGTCGACGGAAGTCCAGGCCTGGAGCACCACACAGCTCGCCGGCCTCACCGCCACGCAGATCGGCAAGCTCACCACCACCGCGATCTCGAACCTCTCCACCACCCAGGTCACCGATCTGACCTCGAC

>NZ_AP022332|3|3|3284192-3284358|CRISPRCasFinder
CAGATCGGCGCCTTGTCGGCGAC	GGCTTTCGCCGGCCTCTCGTCGACGGAAGTCCAGGCCTGGAGCACCACA
CAGCTCGCCGGCCTCACCGCCAC	GCAGATCGGCAAGCTCACCACCACCGCGATCTCGAACCTCTCCACCACC
CAGGTCACCGATCTGACCTCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP022332.1\|WP_161914368.1\|3282050_3283145_+\|molybdenum-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226628
NZ_AP022332.1\|WP_018264919.1\|3280967_3281294_+\|thioredoxin	unknown	unknown	gnl\|CDD\|200072
NZ_AP022332.1\|WP_161914373.1\|3296960_3297734_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180295
NZ_AP022332.1\|WP_161914376.1\|3298677_3299928_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	unknown	unknown	gnl\|CDD\|235513
NZ_AP022332.1\|WP_161914367.1\|3281334_3282054_+\|molybdate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|181841
NZ_AP022332.1\|WP_161915042.1\|3273310_3274351_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_AP022332.1\|WP_161914371.1\|3294162_3295650_-\|chromosomal-replication-initiator-protein-DnaA	unknown	unknown	gnl\|CDD\|273037
NZ_AP022332.1\|WP_174242462.1\|3279958_3280756_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_AP022332.1\|WP_161914375.1\|3298210_3298681_-\|dUTP-diphosphatase	unknown	unknown	gnl\|CDD\|234802
NZ_AP022332.1\|WP_161914379.1\|3300872_3303893_-\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|380119
NZ_AP022332.1\|WP_161914363.1\|3275600_3276788_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_AP022332.1\|WP_161915043.1\|3274341_3275586_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_AP022332.1\|WP_161914372.1\|3296555_3296822_-\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|178943
NZ_AP022332.1\|WP_161914374.1\|3297767_3298214_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273242
NZ_AP022332.1\|WP_161914365.1\|3278017_3279181_+\|LptF/LptG-family-permease	unknown	unknown	gnl\|CDD\|367632
NZ_AP022332.1\|WP_174242414.1\|3292109_3294140_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|226428
NZ_AP022332.1\|WP_161914364.1\|3277036_3277936_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP022332.1\|WP_161914378.1\|3300572_3300848_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP022332.1\|WP_161914366.1\|3279228_3279969_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224057
NZ_AP022332.1\|WP_161914377.1\|3300134_3300545_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP022332.1\|WP_161914368.1\|3282050_3283145_+\|molybdenum-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226628	COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism].	1.75442e-118
NZ_AP022332.1\|WP_018264919.1\|3280967_3281294_+\|thioredoxin	gnl\|CDD\|200072	TIGR01068, Thioredoxin-like_protein_slr0233, thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin. [Energy metabolism, Electron transport].	1.28615e-46
NZ_AP022332.1\|WP_161914373.1\|3296960_3297734_-\|enoyl-CoA-hydratase	gnl\|CDD\|180295	PRK05862, PRK05862, enoyl-CoA hydratase; Provisional.	3.25593e-154
NZ_AP022332.1\|WP_161914376.1\|3298677_3299928_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	gnl\|CDD\|235513	PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated.	0
NZ_AP022332.1\|WP_161914367.1\|3281334_3282054_+\|molybdate-ABC-transporter-permease-subunit	gnl\|CDD\|181841	PRK09421, modB, molybdate ABC transporter permease subunit.	9.8076e-117
NZ_AP022332.1\|WP_161915042.1\|3273310_3274351_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	8.83266e-44
NZ_AP022332.1\|WP_161914363.1\|3275600_3276788_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.63591e-14
NZ_AP022332.1\|WP_174242462.1\|3279958_3280756_-\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	1.00093e-32
NZ_AP022332.1\|WP_161914375.1\|3298210_3298681_-\|dUTP-diphosphatase	gnl\|CDD\|234802	PRK00601, dut, dUTP diphosphatase.	1.39725e-76
NZ_AP022332.1\|WP_161914371.1\|3294162_3295650_-\|chromosomal-replication-initiator-protein-DnaA	gnl\|CDD\|273037	TIGR00362, DnaA, chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006). [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_AP022332.1\|WP_161915043.1\|3274341_3275586_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.12303e-13
NZ_AP022332.1\|WP_161914372.1\|3296555_3296822_-\|30S-ribosomal-protein-S20	gnl\|CDD\|178943	PRK00239, rpsT, 30S ribosomal protein S20; Reviewed.	4.09393e-24
NZ_AP022332.1\|WP_161914374.1\|3297767_3298214_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|273242	TIGR00738, Putative_HTH-type_transcriptional_regulator, Rrf2 family protein. This model represents a superfamily of probable transcriptional regulators. One member, RRF2 of Desulfovibrio vulgaris is an apparent regulatory protein experimentally (MEDLINE:97293189). The N-terminal region appears related to the DNA-binding biotin repressor region of the BirA bifunctional according to results after three rounds of PSI-BLAST with a fairly high stringency. [Unknown function, General].	6.83589e-23
NZ_AP022332.1\|WP_161914365.1\|3278017_3279181_+\|LptF/LptG-family-permease	gnl\|CDD\|367632	pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this.	4.66787e-22
NZ_AP022332.1\|WP_174242414.1\|3292109_3294140_+\|glycosyl-transferase	gnl\|CDD\|226428	COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].	0
NZ_AP022332.1\|WP_161914379.1\|3300872_3303893_-\|N-6-DNA-methylase	gnl\|CDD\|380119	pfam18135, Type_ISP_C, Type ISP C-terminal specificity domain. This is the C-terminal domain of Type ISP restriction-modification enzyme LLaBIII present in Lactococcus lactis subsp. cremoris. Type ISP restriction-modification (RM) enzymes provide a potent defence against infection by foreign and bacteriophage DNA. This domain interacts extensively with DNA and is known as the target recognition domain (TRD). TRD works by recognising 6/7 base pairs of asymmetric sequence.	2.96663e-74
NZ_AP022332.1\|WP_161914366.1\|3279228_3279969_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224057	COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.72567e-97

>NZ_AP022332.1|WP_161914368.1|3282050_3283145_+|molybdenum-ABC-transporter-ATP-binding-protein
MIGVDIKLRRGDFTLAAAFTSKARILALHGPSGSGKTTLAHLVAGLAAPDEGHIVVNGALLVDTAQRLFIPPEKRRIGLVFQDALLFPHFDVKTNILFGRFFTPKAERRVPFEAVVETLGVAHLLRRRAGALSGGERQRVGLARALLCSPRLLVMDEPMASLDYDRRQEIMTLIERLRDEFQIPILLVSHAADEILRLADEVISLERGRIVAQGLPSETLAAASRHTEGGRFSVVSALAAHVGAYDARYGVTRLTHPAGEIVVAAHVANGDRQARTLINATDVALAYRKPENTSIRTVLLGRIVAIDEDASPLAFVRLELEGGDRLISATTRLSVAEMNLSVGAQVYALVKSVALDERELRANA
>NZ_AP022332.1|WP_161914367.1|3281334_3282054_+|molybdate-ABC-transporter-permease-subunit
MNLSDFTPSVYFSPQELTAIVLSLKVAATATAFSLPLAVFVAYALARWRFPGHAALNAFIHLPLVMPPVVTGFALLLLLGRKTPLGHFLAEYFGVVFAFRWTGAALAAAVMSFPLMIRPIRLSFESIDERLALASRSLGADPLWTFFVVTLPLAAPGVIVGSILGFAKALGEFGATITFVSNIPGETQTIPSAIYSFTQTPDGDADALRLAAVSATIAVAALVVSEILQKRADATRAGK
>NZ_AP022332.1|WP_018264919.1|3280967_3281294_+|thioredoxin
MSAATVKVSDASFEAEVLKSDQPVVVDFWAEWCGPCRTIAPALEEIATELKDKLKIVKLNVDENPNVAGMLGIRSIPTLIIFKDGKAASQKVGAAPKGELLRWINGAI
>NZ_AP022332.1|WP_174242462.1|3279958_3280756_-|ABC-transporter-permease
MAYVAPFERAWHHRELIRAVVRRELTSRFRGSVLGPLWAVLAPLIMLLTYTVLFSITVPQLSAGMSTSDYAAGIFIGLIVFNLFSELAYRAPGLLHEHVTFVKKSIFPSETIAWVATIRAFVYGGISLGVYVVFRLLTAGELPMTIFFAPLLILPFACFMLGVVWFLMALGAFTRDVAHIMVSVVPVLMFATPIFYRLDQMPSHISIWLRLNLVGDYIEMLRGAALDGVLPNPIAYVALSLVSYGIFLFGYQFFMRYKSVIVDVI
>NZ_AP022332.1|WP_161914366.1|3279228_3279969_-|ATP-binding-cassette-domain-containing-protein
MSSEPIIRCESVGKAFQLYLHRNDQLKQILFGLWKKFYQEHWVLHDIGFEVAKGEKVGIIGRNGAGKTTLLQILCGITRPTRGSFEVKGRVAPILALGSGFDGLLTGRENAMIGGAILGLKRKEVEKRLPAIAAFADIGPFFDQPMRLYSSGMVARVAFAICANADADILIVDEALSVGDEVFQAKCEAFIADFAKKGTILMVSHDLRFLGDLCDRVIWIDEGAVRETGAPDVVIPHYREVVLAAA
>NZ_AP022332.1|WP_161914365.1|3278017_3279181_+|LptF/LptG-family-permease
MPRLLFLYLARRILFSTLVVQLALIVPVVLSYLLYTLTPAAIRAGLLAPALVGTMPTVGFITLPMAIGVATALEFARMSNEGMIAVLYALRLSVWSVCRPAIVCAGALVVLGYGLANLMAPYYASGLQDVINVVRNSLNHRMLDAAHFYTFDNGVKTLYLQRWETPDIAVNLFVRQISIEKRQEETITAARAEFRRQPSGVVVALSNGSIQTKPFDTDEVRIANFDEYAMALPMQGSESLPPRNWRGVYELTLPEFIANWQTAKLDRRQAGEWMAEAAKRFGVPSLAVAHTLLAMALVLTFGSVTGRRGGMSSLVIIAIPAAHIFFLVALESLLRADARFAFLLAGAAALEIGVSILLIHRRNRSTSPMRKLSAFEAIAAEPQTVAA
>NZ_AP022332.1|WP_161914364.1|3277036_3277936_+|hypothetical-protein
MSLRPANPDFSPPRAAPDQSGAAAGKRYGIAIVGNDKIIDWLLPFLESYAQTNAHLPLYLVPYDENVAQTRRAADIYGAHFIEEVPEAIDRLAAELYPGPFNGNRRRLRKLQALALPLDEVAYVDVDVVLYRDFSPIFGRLEAKKTEFIVASPSFEYVYNEKKANYPFLRDALLFNDGFWVTSNQYLKLDHFIETMREDAKLFHEVRKRGQLFAQPLVNFVTHRRGLAITLLPHCVERASHESFYQAPGITFSDGKPLDPDGKEIYFCHWAGATALPSTGVFDASWKEFSKAAWAKFRK
>NZ_AP022332.1|WP_161914363.1|3275600_3276788_-|glycosyltransferase
MVHAAWHSCGSYQVNVSQLEAYRALGARTISVALMDAPAPRPPRGPRWEAYFAASADLPADKRYFCGPSRLAALSPSFLAYAWWRLIHGDQATWLVELAKLVALPPGLADEKVDLVHANHYFTLPFVARLLRGRNTPVMVETQDIQARQYILRNQGGFFLPPYVTYDDMLSIELEWMRAADLCIHLNEEERAEFARLLPQARHRLVYPAIAPVPCGPGGERIIIVASDNYGNFVSLRWFLREVAPLAPSVEVEIYGNIDSGVKRLDKVLYESHRALFKGRIDDIGAVYAQAACVLLPTIEGHGLSVKAVEAMASGAPLIATRRAFRGMAIDPERLGNVILADEVADFAAALREIGQRREAGAREVSDTRRLYDDMFSPAAYARALHETAAPLLAQ
>NZ_AP022332.1|WP_161915043.1|3274341_3275586_-|glycosyltransferase
MKDAASLPLAGRHVAIVHPAWHSCGTYRVVLGQVAAYRALGARVAPVAICDLPGFTPDRAWRWRAFVEATPELSRGERWFGGASFHAFAAPRFLRDVLWPYLHGDQAIIRAGVAERAELPLGLMDRRFDLVHCNHFFLMSVAKRLARGAPIMLDSHDLQARQFALMNEHTPWLPPRVTYEQMLARELELMRGADLLLHLNAQEYDDFRALLPEKEHALLYPSAPEAPLGPGGEDILLVASNNSANVDSVCWFLREALGDTKIPHLRIVGNVDAGVKARDPALYAAHRACFVGRVDDPGAAYATARLVLLPTISGHGLSIKTVEALASGLPLVSTTHAFRGMHVDLARFADVTIADSAEDFARALKAAAADARVPSETQRAASEMRRVYDAHFSLDAYRANLAALAPTLIGARHT
>NZ_AP022332.1|WP_161915042.1|3273310_3274351_+|patatin-like-phospholipase-family-protein
MVVGGTGAMRDEILVDLALQGGGAHGAFTWGVLDRLIEEPWLRIDGVSGTSAGAMNAAALIHGFSQGGVEGARAAMEEFWRRVAAVARFSPLQRSPLDMLLGRWTLDNSPAFLAMDLSSRLVSPYDLNPAGANPLRDILCETIDFERLARSPIKLFVTATNVRTGRARVFRNADLSAEALLASACLPTMFQAIEIDGEAYWDGGYAGNPTITPLVRECASQDTILVQVNPIERKETPRSAIDILNRLNEISFNSPLLKELRMIALLREVADPGHSEGPRWASMRIHAIATDMAAELSASSKLIAEWDFLLMLREEGRRRAEAFLERNGDALGKRSSFDLAAMLNYV
>NZ_AP022332.1|WP_174242414.1|3292109_3294140_+|glycosyl-transferase
MTTQPNESETALALFQAAIEKSYSRKLTIADLFTAAAQLKALGLDRRAAELYKHWIAFNADDPVVYAAYFNYATALADSGDRPGAINALREAIRIQPDFQPPYINLGRLLEDSGLVGAAVAQWMALVERTAAVNGESVAHKLSALQQTGRVLESLNKDEAAEDALRQILEIDPKRQEVVQHWIALRQRQCKWPVVQPSERVSLADLANGISSLSLANHSDDPMFQLAKAHHYEKRSIGRPKRGLCPAEPKRAREQRLRIGYVSSDLREHAVGFAMTDVLESHDRAHFEIYAYYCGIARNDPTRERIAAAIDRWTDINGMDDETAAKKIAEDEIDILVDLNGYTKDARTKVFSLRPAPIIVNWFGFPGTMGSPYHHYIIADPVIIPEGAELYYSEKVARLACYQPNDRKRVVAPQRPTRAEAGLPEDAFVYCSLNGMQKLTALTFDRWARILTAVPGSVLWLLTGTEQTNARVREEAKARGVAPERIIFAEKMANPHHLARYPLADLFLDNFPYGAHTTAADSLWMGVPIVTYPGRSFASRVCASLVRAAGVGELACASAEDYVALAIELGKDRRKLAGLRDRLANVRETSLLFDTPRLVGDLEQLYRDMWRDYENGELPRPDLRNLDIYHEIGLDLDLEKIELLSDADYRALYQRKLAEWDAAYPIEPDARMWRPR
>NZ_AP022332.1|WP_161914371.1|3294162_3295650_-|chromosomal-replication-initiator-protein-DnaA
MSDNSDDQSNSSELSAEARQKWERVRGRLRAELGEAVYSSWFARLELEGLKDGAALLTVPTKFLKSWIQSHYADRIRTRLCAEFTSLEQIVIDVRSPTRRPRARDAETVSGAVVEKAPPASAAHVVERVEAPPAKAPMRHAARGDGESFGGSPLDRRLSFSTFLVGPSNQLAYAAACRVADARPGEHPLFNPLYTHAAVGLGKTHLLQAVARSANDNKRRVLYLTAEKFMSGFVSALSQQNSIAFKERLRNIDVLIIDDVQFLQGKSIQQEFCHTLNSLIDAGKQVVVAADRPPSDLETLDERVLSRFKGGLCVDIGPLDEELRMKILEARIAAAQEAQPNFHVPPAVMSYIAKTIVTNGRDLEGAVNRLLAHSTLNGAPLCVETAENAIRDLVRSAEPKRVKIDDIQKLVASHYNISRADILSSRRTANVVRPRQIAMYLSKVLTLRSLPEIGRRFGGRDHTTVLHAVRKVEELASKDKSLSEVIELLKRMLAE
>NZ_AP022332.1|WP_161914372.1|3296555_3296822_-|30S-ribosomal-protein-S20
MANTSSAKKAVRKIARRTAVNRARRSQLRTQVRKVEEAIASGDATTAAAVLKSVAPVVMRAAQHGVIHKNTASRKVSRLTARVKALSA
>NZ_AP022332.1|WP_161914373.1|3296960_3297734_-|enoyl-CoA-hydratase
MDYETIEIETHDRVALLRLNRPHALNALNERLIGEIADALAHFEADPQIGCVVLTGSAEAFAAGADIKELRDKTVAEAYLDDFLARWDGVARARKPVIAAVAGYALGGGCELAMMCDFILAADTAKFGQPEIKLGVIPGSGGTQRLVRSIGKSKAMELVLTGRLMGAEEAERCGLVARIVPADKLLEEALKSARTIAALSLPAVLMAKEAVERAYETPLSEGVRFERRLFYSLFATQDQKEGMTAFIEKRPPRFEHR
>NZ_AP022332.1|WP_161914374.1|3297767_3298214_-|Rrf2-family-transcriptional-regulator
MSLLPRPARLAVLAALDIALHARSRPVSSRALAARHDLPPRHLESMLQAMVRAGILKSVRGPAGGYELARERRRLNVGEIVRVALRAEEGAQDGETPPLLTLAVDPVFAEAERQALAKLDTITLDELHGRAVAAGLGESEANEGDFEI
>NZ_AP022332.1|WP_161914375.1|3298210_3298681_-|dUTP-diphosphatase
MTKIAIRRLSHGEGLPLPAYASAGAAGLDLRAAIAPGGKLVLKPGARDLVPTGLSLALPPGFEAQVRPRSGLALEFGVSVLNAPGTIDSDYRGEVKVLLVNFGTHPFEISRGMRIAQLVVARYEHVELIETMEALEETARGDGGFGSTGASEGGDA
>NZ_AP022332.1|WP_161914376.1|3298677_3299928_-|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC
MVSSDPQSLSGKRILLVVGGGVAAYKSLELVRRLRERGAFVRVVLTAAAARFVTPLSFASLSGERVYEDLFSLTDEQEMGHIRLSREADLVVVAPATAHLLARMAQGLADDLATTLLLATDKRALLAPAMNLRMWLHPATQRNVATLRGDGALFVGPDDGEMACGEYGPGRMAEPLAIVAALETALRGDTVLPLSLAGRGPLAGRHVLVTSGPTREPIDPARFLSNRSSGKQGHAIAAAAAQAGARVTLVSGPVEIADPTGVATRHVETAQQMLEAVEAALPADIFIGAAAVADWRVEPSADKIKKGASRAPPTLVLRENPDILASVAQRREGRPALVVGFAAETRDVLLHAQEKLARKGCDLIVANDVGVGVFGADSNEVHLVSRAGVASWPRLDKTEVAARLIAHIAETLGETP
>NZ_AP022332.1|WP_161914377.1|3300134_3300545_+|hypothetical-protein
MSDYLDKVNRIPISADLLGEVMDMLRALPVEERWASGSRSSRLYEMLERRGLTDTADIVAVAIDLRVTALLRLQSLDALRGWTTPGGGLRASLVHPDLLKAAAAEPLIEEAGGEASFDVASFRLRLLAGAEVYGRA
>NZ_AP022332.1|WP_161914378.1|3300572_3300848_-|hypothetical-protein
MAKLSQASSPSEQGDLFAVPEPQYRPDPDKVRRRLERILAEMRAEEKMVWDFSQRALYEKIFPDMTHYLPDEEGARYRADFEKEWERLATA
>NZ_AP022332.1|WP_161914379.1|3300872_3303893_-|N-6-DNA-methylase
MVARAGMILGYVEVKEIGENLDKILKTDQIKRYCKLSDNIIVSDYLQFLWIDKTAKLRARAVLAFPSDLESRKLRVDPQKAAEVGKLLSAFFSTAPQGVAHSEQLAIELATRARLLRDFLEEELLRQSKEHREGRLHALYEVFRQQVFHELELKEFADAFAQMLAYGLFLARLNADANEKVTLENVRRFIPGSFRLIRELVRFLEEMNEAEYEEARWVVDEILSIVNGLDLTAVHSDLSFRRRKAISRKVRAQDEEEHRLFERDPFIYFYEDFLKAYDKETRKARGVYYTPPPIVNFIVRAVDDILKSEFGIADGLADHERVTVLDFACGTGTFLLEVFERIFETIGGADVGKAKKVVREHILRNIFGFEYLIAPYTIAHLKLSQYLKDKGHELHADERLQVFLTNTLEPVEPQANLLLPAITEEVKAAQQVKDQKILVITGNPPYSGHSRNKGAWISQEINSYKFTIEADADGREFKKPLGERNLKWLNDDYVKFIRFAQAKMDAVDEGVVGIITNHSWLDNPTFRGMRQSLMRSFNRIIVIDLHGSIKPKELPPGGARNENVFDIQKGVALSFFIKRSGMERGIWRSDIWGTRLEKYSALAIGTLESAHLSRLHPTCESYLFAYQNAEIRTQYECFTSVREIFETASVGVATARDALTIHFQRKELLQTIDDFSSRETEDARETYRLGTDAEDWKVMWAQQDIRSATEKEKHIVHILYRPFDVRWTFYTGKSNGFHCRPRAEAMRHMRQISNLALITSRLTKGENFRHVQITEHISEVICMSPETSNNGFLFPLYKANDAKTGVENFKPDFRDDLDARYRHHYSPEEILGYIYAVLHAPTYRTRYAEFLRLDFPRIPFPEKAVHFEALSALGWALVQVHLLRDLPRRKLGQLVGKGEDAVEFVRYSEAEKAVAINGRQSFRPVPEEVWNFHIGGYQVIDKYLKSRKGRTLSLDEIRQVERICDALSFTIDQMAAIDRAYLAAFPDAETGGKPAPAPRARKPRKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_AP022332_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_AP022332_2

3283625-3283960

Orphan

Consensus_repeat	Method
CAGATCGGCGCGCTCACCTCGAC	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_AP022332_2

>merge|NZ_AP022332|2|3283625-3283960|CRISPRCasFinder
CAGGTTGCCGGGCTCACCACGACGATCATATCAAATCTGACGACAACGGACATAGCGGCGCTCAGCACCACGCAGGCGGCGGCGCTCAAATCGACGCAGCTCAACGCGCTCAACTCGACCGATCTCCAATATTTCGCGCAGACGCAGATCGCGGCGCTCTCGGCCAACGCCATCGCCGGCCTCTCGCTCGCGCAGATCGGCAATCTGACGACGACGCAGGCGGACGAATTCACCGCCACTCAGATCGCCGCACTCACCTCCTCGCAGATCGGCGCGCTCACCTCGACCGAGCTGGAGGGATGGGACGCCACACAGATCGGCGCGCTCACCTCCACG

>NZ_AP022332|2|2|3283625-3283960|CRISPRCasFinder
CAGGTTGCCGGGCTCACCACGAC	GATCATATCAAATCTGACGACAACGGACATAGCGGCGCTCAGCACCACG
CAGGCGGCGGCGCTCAAATCGAC	GCAGCTCAACGCGCTCAACTCGACCGATCTCCAATATTTCGCGCAGACG
CAGATCGCGGCGCTCTCGGCCAA	CGCCATCGCCGGCCTCTCGCTCGCG
CAGATCGGCAATCTGACGACGAC	GCAGGCGGACGAATTCACCGCCACT
CAGATCGCCGCACTCACCTCCTC	GCAGATCGGCGCGCTCACCTCGACCGAGCTGGAGGGATGGGACGCCACA
CAGATCGGCGCGCTCACCTCCACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_AP022332.1\|WP_161914368.1\|3282050_3283145_+\|molybdenum-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226628
NZ_AP022332.1\|WP_018264919.1\|3280967_3281294_+\|thioredoxin	unknown	unknown	gnl\|CDD\|200072
NZ_AP022332.1\|WP_161914373.1\|3296960_3297734_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|180295
NZ_AP022332.1\|WP_161914376.1\|3298677_3299928_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	unknown	unknown	gnl\|CDD\|235513
NZ_AP022332.1\|WP_161914367.1\|3281334_3282054_+\|molybdate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|181841
NZ_AP022332.1\|WP_161915042.1\|3273310_3274351_+\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_AP022332.1\|WP_161914371.1\|3294162_3295650_-\|chromosomal-replication-initiator-protein-DnaA	unknown	unknown	gnl\|CDD\|273037
NZ_AP022332.1\|WP_174242462.1\|3279958_3280756_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224596
NZ_AP022332.1\|WP_161914375.1\|3298210_3298681_-\|dUTP-diphosphatase	unknown	unknown	gnl\|CDD\|234802
NZ_AP022332.1\|WP_161914379.1\|3300872_3303893_-\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|380119
NZ_AP022332.1\|WP_161914363.1\|3275600_3276788_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_AP022332.1\|WP_161915043.1\|3274341_3275586_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_AP022332.1\|WP_161914372.1\|3296555_3296822_-\|30S-ribosomal-protein-S20	unknown	unknown	gnl\|CDD\|178943
NZ_AP022332.1\|WP_161914374.1\|3297767_3298214_-\|Rrf2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273242
NZ_AP022332.1\|WP_161914365.1\|3278017_3279181_+\|LptF/LptG-family-permease	unknown	unknown	gnl\|CDD\|367632
NZ_AP022332.1\|WP_174242414.1\|3292109_3294140_+\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|226428
NZ_AP022332.1\|WP_161914364.1\|3277036_3277936_+\|hypothetical-protein	unknown	unknown	unknown
NZ_AP022332.1\|WP_161914378.1\|3300572_3300848_-\|hypothetical-protein	unknown	unknown	unknown
NZ_AP022332.1\|WP_161914366.1\|3279228_3279969_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224057
NZ_AP022332.1\|WP_161914377.1\|3300134_3300545_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_AP022332.1\|WP_161914368.1\|3282050_3283145_+\|molybdenum-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226628	COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism].	1.75442e-118
NZ_AP022332.1\|WP_018264919.1\|3280967_3281294_+\|thioredoxin	gnl\|CDD\|200072	TIGR01068, Thioredoxin-like_protein_slr0233, thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model. Any protein that hits once with a score greater than the second (per domain) trusted cutoff may be taken as thioredoxin. [Energy metabolism, Electron transport].	1.28615e-46
NZ_AP022332.1\|WP_161914373.1\|3296960_3297734_-\|enoyl-CoA-hydratase	gnl\|CDD\|180295	PRK05862, PRK05862, enoyl-CoA hydratase; Provisional.	3.25593e-154
NZ_AP022332.1\|WP_161914376.1\|3298677_3299928_-\|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC	gnl\|CDD\|235513	PRK05579, PRK05579, bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated.	0
NZ_AP022332.1\|WP_161914367.1\|3281334_3282054_+\|molybdate-ABC-transporter-permease-subunit	gnl\|CDD\|181841	PRK09421, modB, molybdate ABC transporter permease subunit.	9.8076e-117
NZ_AP022332.1\|WP_161915042.1\|3273310_3274351_+\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	8.83266e-44
NZ_AP022332.1\|WP_161914363.1\|3275600_3276788_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	2.63591e-14
NZ_AP022332.1\|WP_174242462.1\|3279958_3280756_-\|ABC-transporter-permease	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	1.00093e-32
NZ_AP022332.1\|WP_161914375.1\|3298210_3298681_-\|dUTP-diphosphatase	gnl\|CDD\|234802	PRK00601, dut, dUTP diphosphatase.	1.39725e-76
NZ_AP022332.1\|WP_161914371.1\|3294162_3295650_-\|chromosomal-replication-initiator-protein-DnaA	gnl\|CDD\|273037	TIGR00362, DnaA, chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006). [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_AP022332.1\|WP_161915043.1\|3274341_3275586_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.12303e-13
NZ_AP022332.1\|WP_161914372.1\|3296555_3296822_-\|30S-ribosomal-protein-S20	gnl\|CDD\|178943	PRK00239, rpsT, 30S ribosomal protein S20; Reviewed.	4.09393e-24
NZ_AP022332.1\|WP_161914374.1\|3297767_3298214_-\|Rrf2-family-transcriptional-regulator	gnl\|CDD\|273242	TIGR00738, Putative_HTH-type_transcriptional_regulator, Rrf2 family protein. This model represents a superfamily of probable transcriptional regulators. One member, RRF2 of Desulfovibrio vulgaris is an apparent regulatory protein experimentally (MEDLINE:97293189). The N-terminal region appears related to the DNA-binding biotin repressor region of the BirA bifunctional according to results after three rounds of PSI-BLAST with a fairly high stringency. [Unknown function, General].	6.83589e-23
NZ_AP022332.1\|WP_161914365.1\|3278017_3279181_+\|LptF/LptG-family-permease	gnl\|CDD\|367632	pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family. Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this.	4.66787e-22
NZ_AP022332.1\|WP_174242414.1\|3292109_3294140_+\|glycosyl-transferase	gnl\|CDD\|226428	COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].	0
NZ_AP022332.1\|WP_161914379.1\|3300872_3303893_-\|N-6-DNA-methylase	gnl\|CDD\|380119	pfam18135, Type_ISP_C, Type ISP C-terminal specificity domain. This is the C-terminal domain of Type ISP restriction-modification enzyme LLaBIII present in Lactococcus lactis subsp. cremoris. Type ISP restriction-modification (RM) enzymes provide a potent defence against infection by foreign and bacteriophage DNA. This domain interacts extensively with DNA and is known as the target recognition domain (TRD). TRD works by recognising 6/7 base pairs of asymmetric sequence.	2.96663e-74
NZ_AP022332.1\|WP_161914366.1\|3279228_3279969_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224057	COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	2.72567e-97

>NZ_AP022332.1|WP_161914368.1|3282050_3283145_+|molybdenum-ABC-transporter-ATP-binding-protein
MIGVDIKLRRGDFTLAAAFTSKARILALHGPSGSGKTTLAHLVAGLAAPDEGHIVVNGALLVDTAQRLFIPPEKRRIGLVFQDALLFPHFDVKTNILFGRFFTPKAERRVPFEAVVETLGVAHLLRRRAGALSGGERQRVGLARALLCSPRLLVMDEPMASLDYDRRQEIMTLIERLRDEFQIPILLVSHAADEILRLADEVISLERGRIVAQGLPSETLAAASRHTEGGRFSVVSALAAHVGAYDARYGVTRLTHPAGEIVVAAHVANGDRQARTLINATDVALAYRKPENTSIRTVLLGRIVAIDEDASPLAFVRLELEGGDRLISATTRLSVAEMNLSVGAQVYALVKSVALDERELRANA
>NZ_AP022332.1|WP_161914367.1|3281334_3282054_+|molybdate-ABC-transporter-permease-subunit
MNLSDFTPSVYFSPQELTAIVLSLKVAATATAFSLPLAVFVAYALARWRFPGHAALNAFIHLPLVMPPVVTGFALLLLLGRKTPLGHFLAEYFGVVFAFRWTGAALAAAVMSFPLMIRPIRLSFESIDERLALASRSLGADPLWTFFVVTLPLAAPGVIVGSILGFAKALGEFGATITFVSNIPGETQTIPSAIYSFTQTPDGDADALRLAAVSATIAVAALVVSEILQKRADATRAGK
>NZ_AP022332.1|WP_018264919.1|3280967_3281294_+|thioredoxin
MSAATVKVSDASFEAEVLKSDQPVVVDFWAEWCGPCRTIAPALEEIATELKDKLKIVKLNVDENPNVAGMLGIRSIPTLIIFKDGKAASQKVGAAPKGELLRWINGAI
>NZ_AP022332.1|WP_174242462.1|3279958_3280756_-|ABC-transporter-permease
MAYVAPFERAWHHRELIRAVVRRELTSRFRGSVLGPLWAVLAPLIMLLTYTVLFSITVPQLSAGMSTSDYAAGIFIGLIVFNLFSELAYRAPGLLHEHVTFVKKSIFPSETIAWVATIRAFVYGGISLGVYVVFRLLTAGELPMTIFFAPLLILPFACFMLGVVWFLMALGAFTRDVAHIMVSVVPVLMFATPIFYRLDQMPSHISIWLRLNLVGDYIEMLRGAALDGVLPNPIAYVALSLVSYGIFLFGYQFFMRYKSVIVDVI
>NZ_AP022332.1|WP_161914366.1|3279228_3279969_-|ATP-binding-cassette-domain-containing-protein
MSSEPIIRCESVGKAFQLYLHRNDQLKQILFGLWKKFYQEHWVLHDIGFEVAKGEKVGIIGRNGAGKTTLLQILCGITRPTRGSFEVKGRVAPILALGSGFDGLLTGRENAMIGGAILGLKRKEVEKRLPAIAAFADIGPFFDQPMRLYSSGMVARVAFAICANADADILIVDEALSVGDEVFQAKCEAFIADFAKKGTILMVSHDLRFLGDLCDRVIWIDEGAVRETGAPDVVIPHYREVVLAAA
>NZ_AP022332.1|WP_161914365.1|3278017_3279181_+|LptF/LptG-family-permease
MPRLLFLYLARRILFSTLVVQLALIVPVVLSYLLYTLTPAAIRAGLLAPALVGTMPTVGFITLPMAIGVATALEFARMSNEGMIAVLYALRLSVWSVCRPAIVCAGALVVLGYGLANLMAPYYASGLQDVINVVRNSLNHRMLDAAHFYTFDNGVKTLYLQRWETPDIAVNLFVRQISIEKRQEETITAARAEFRRQPSGVVVALSNGSIQTKPFDTDEVRIANFDEYAMALPMQGSESLPPRNWRGVYELTLPEFIANWQTAKLDRRQAGEWMAEAAKRFGVPSLAVAHTLLAMALVLTFGSVTGRRGGMSSLVIIAIPAAHIFFLVALESLLRADARFAFLLAGAAALEIGVSILLIHRRNRSTSPMRKLSAFEAIAAEPQTVAA
>NZ_AP022332.1|WP_161914364.1|3277036_3277936_+|hypothetical-protein
MSLRPANPDFSPPRAAPDQSGAAAGKRYGIAIVGNDKIIDWLLPFLESYAQTNAHLPLYLVPYDENVAQTRRAADIYGAHFIEEVPEAIDRLAAELYPGPFNGNRRRLRKLQALALPLDEVAYVDVDVVLYRDFSPIFGRLEAKKTEFIVASPSFEYVYNEKKANYPFLRDALLFNDGFWVTSNQYLKLDHFIETMREDAKLFHEVRKRGQLFAQPLVNFVTHRRGLAITLLPHCVERASHESFYQAPGITFSDGKPLDPDGKEIYFCHWAGATALPSTGVFDASWKEFSKAAWAKFRK
>NZ_AP022332.1|WP_161914363.1|3275600_3276788_-|glycosyltransferase
MVHAAWHSCGSYQVNVSQLEAYRALGARTISVALMDAPAPRPPRGPRWEAYFAASADLPADKRYFCGPSRLAALSPSFLAYAWWRLIHGDQATWLVELAKLVALPPGLADEKVDLVHANHYFTLPFVARLLRGRNTPVMVETQDIQARQYILRNQGGFFLPPYVTYDDMLSIELEWMRAADLCIHLNEEERAEFARLLPQARHRLVYPAIAPVPCGPGGERIIIVASDNYGNFVSLRWFLREVAPLAPSVEVEIYGNIDSGVKRLDKVLYESHRALFKGRIDDIGAVYAQAACVLLPTIEGHGLSVKAVEAMASGAPLIATRRAFRGMAIDPERLGNVILADEVADFAAALREIGQRREAGAREVSDTRRLYDDMFSPAAYARALHETAAPLLAQ
>NZ_AP022332.1|WP_161915043.1|3274341_3275586_-|glycosyltransferase
MKDAASLPLAGRHVAIVHPAWHSCGTYRVVLGQVAAYRALGARVAPVAICDLPGFTPDRAWRWRAFVEATPELSRGERWFGGASFHAFAAPRFLRDVLWPYLHGDQAIIRAGVAERAELPLGLMDRRFDLVHCNHFFLMSVAKRLARGAPIMLDSHDLQARQFALMNEHTPWLPPRVTYEQMLARELELMRGADLLLHLNAQEYDDFRALLPEKEHALLYPSAPEAPLGPGGEDILLVASNNSANVDSVCWFLREALGDTKIPHLRIVGNVDAGVKARDPALYAAHRACFVGRVDDPGAAYATARLVLLPTISGHGLSIKTVEALASGLPLVSTTHAFRGMHVDLARFADVTIADSAEDFARALKAAAADARVPSETQRAASEMRRVYDAHFSLDAYRANLAALAPTLIGARHT
>NZ_AP022332.1|WP_161915042.1|3273310_3274351_+|patatin-like-phospholipase-family-protein
MVVGGTGAMRDEILVDLALQGGGAHGAFTWGVLDRLIEEPWLRIDGVSGTSAGAMNAAALIHGFSQGGVEGARAAMEEFWRRVAAVARFSPLQRSPLDMLLGRWTLDNSPAFLAMDLSSRLVSPYDLNPAGANPLRDILCETIDFERLARSPIKLFVTATNVRTGRARVFRNADLSAEALLASACLPTMFQAIEIDGEAYWDGGYAGNPTITPLVRECASQDTILVQVNPIERKETPRSAIDILNRLNEISFNSPLLKELRMIALLREVADPGHSEGPRWASMRIHAIATDMAAELSASSKLIAEWDFLLMLREEGRRRAEAFLERNGDALGKRSSFDLAAMLNYV
>NZ_AP022332.1|WP_174242414.1|3292109_3294140_+|glycosyl-transferase
MTTQPNESETALALFQAAIEKSYSRKLTIADLFTAAAQLKALGLDRRAAELYKHWIAFNADDPVVYAAYFNYATALADSGDRPGAINALREAIRIQPDFQPPYINLGRLLEDSGLVGAAVAQWMALVERTAAVNGESVAHKLSALQQTGRVLESLNKDEAAEDALRQILEIDPKRQEVVQHWIALRQRQCKWPVVQPSERVSLADLANGISSLSLANHSDDPMFQLAKAHHYEKRSIGRPKRGLCPAEPKRAREQRLRIGYVSSDLREHAVGFAMTDVLESHDRAHFEIYAYYCGIARNDPTRERIAAAIDRWTDINGMDDETAAKKIAEDEIDILVDLNGYTKDARTKVFSLRPAPIIVNWFGFPGTMGSPYHHYIIADPVIIPEGAELYYSEKVARLACYQPNDRKRVVAPQRPTRAEAGLPEDAFVYCSLNGMQKLTALTFDRWARILTAVPGSVLWLLTGTEQTNARVREEAKARGVAPERIIFAEKMANPHHLARYPLADLFLDNFPYGAHTTAADSLWMGVPIVTYPGRSFASRVCASLVRAAGVGELACASAEDYVALAIELGKDRRKLAGLRDRLANVRETSLLFDTPRLVGDLEQLYRDMWRDYENGELPRPDLRNLDIYHEIGLDLDLEKIELLSDADYRALYQRKLAEWDAAYPIEPDARMWRPR
>NZ_AP022332.1|WP_161914371.1|3294162_3295650_-|chromosomal-replication-initiator-protein-DnaA
MSDNSDDQSNSSELSAEARQKWERVRGRLRAELGEAVYSSWFARLELEGLKDGAALLTVPTKFLKSWIQSHYADRIRTRLCAEFTSLEQIVIDVRSPTRRPRARDAETVSGAVVEKAPPASAAHVVERVEAPPAKAPMRHAARGDGESFGGSPLDRRLSFSTFLVGPSNQLAYAAACRVADARPGEHPLFNPLYTHAAVGLGKTHLLQAVARSANDNKRRVLYLTAEKFMSGFVSALSQQNSIAFKERLRNIDVLIIDDVQFLQGKSIQQEFCHTLNSLIDAGKQVVVAADRPPSDLETLDERVLSRFKGGLCVDIGPLDEELRMKILEARIAAAQEAQPNFHVPPAVMSYIAKTIVTNGRDLEGAVNRLLAHSTLNGAPLCVETAENAIRDLVRSAEPKRVKIDDIQKLVASHYNISRADILSSRRTANVVRPRQIAMYLSKVLTLRSLPEIGRRFGGRDHTTVLHAVRKVEELASKDKSLSEVIELLKRMLAE
>NZ_AP022332.1|WP_161914372.1|3296555_3296822_-|30S-ribosomal-protein-S20
MANTSSAKKAVRKIARRTAVNRARRSQLRTQVRKVEEAIASGDATTAAAVLKSVAPVVMRAAQHGVIHKNTASRKVSRLTARVKALSA
>NZ_AP022332.1|WP_161914373.1|3296960_3297734_-|enoyl-CoA-hydratase
MDYETIEIETHDRVALLRLNRPHALNALNERLIGEIADALAHFEADPQIGCVVLTGSAEAFAAGADIKELRDKTVAEAYLDDFLARWDGVARARKPVIAAVAGYALGGGCELAMMCDFILAADTAKFGQPEIKLGVIPGSGGTQRLVRSIGKSKAMELVLTGRLMGAEEAERCGLVARIVPADKLLEEALKSARTIAALSLPAVLMAKEAVERAYETPLSEGVRFERRLFYSLFATQDQKEGMTAFIEKRPPRFEHR
>NZ_AP022332.1|WP_161914374.1|3297767_3298214_-|Rrf2-family-transcriptional-regulator
MSLLPRPARLAVLAALDIALHARSRPVSSRALAARHDLPPRHLESMLQAMVRAGILKSVRGPAGGYELARERRRLNVGEIVRVALRAEEGAQDGETPPLLTLAVDPVFAEAERQALAKLDTITLDELHGRAVAAGLGESEANEGDFEI
>NZ_AP022332.1|WP_161914375.1|3298210_3298681_-|dUTP-diphosphatase
MTKIAIRRLSHGEGLPLPAYASAGAAGLDLRAAIAPGGKLVLKPGARDLVPTGLSLALPPGFEAQVRPRSGLALEFGVSVLNAPGTIDSDYRGEVKVLLVNFGTHPFEISRGMRIAQLVVARYEHVELIETMEALEETARGDGGFGSTGASEGGDA
>NZ_AP022332.1|WP_161914376.1|3298677_3299928_-|bifunctional-phosphopantothenoylcysteine-decarboxylase/phosphopantothenate--cysteine-ligase-CoaBC
MVSSDPQSLSGKRILLVVGGGVAAYKSLELVRRLRERGAFVRVVLTAAAARFVTPLSFASLSGERVYEDLFSLTDEQEMGHIRLSREADLVVVAPATAHLLARMAQGLADDLATTLLLATDKRALLAPAMNLRMWLHPATQRNVATLRGDGALFVGPDDGEMACGEYGPGRMAEPLAIVAALETALRGDTVLPLSLAGRGPLAGRHVLVTSGPTREPIDPARFLSNRSSGKQGHAIAAAAAQAGARVTLVSGPVEIADPTGVATRHVETAQQMLEAVEAALPADIFIGAAAVADWRVEPSADKIKKGASRAPPTLVLRENPDILASVAQRREGRPALVVGFAAETRDVLLHAQEKLARKGCDLIVANDVGVGVFGADSNEVHLVSRAGVASWPRLDKTEVAARLIAHIAETLGETP
>NZ_AP022332.1|WP_161914377.1|3300134_3300545_+|hypothetical-protein
MSDYLDKVNRIPISADLLGEVMDMLRALPVEERWASGSRSSRLYEMLERRGLTDTADIVAVAIDLRVTALLRLQSLDALRGWTTPGGGLRASLVHPDLLKAAAAEPLIEEAGGEASFDVASFRLRLLAGAEVYGRA
>NZ_AP022332.1|WP_161914378.1|3300572_3300848_-|hypothetical-protein
MAKLSQASSPSEQGDLFAVPEPQYRPDPDKVRRRLERILAEMRAEEKMVWDFSQRALYEKIFPDMTHYLPDEEGARYRADFEKEWERLATA
>NZ_AP022332.1|WP_161914379.1|3300872_3303893_-|N-6-DNA-methylase
MVARAGMILGYVEVKEIGENLDKILKTDQIKRYCKLSDNIIVSDYLQFLWIDKTAKLRARAVLAFPSDLESRKLRVDPQKAAEVGKLLSAFFSTAPQGVAHSEQLAIELATRARLLRDFLEEELLRQSKEHREGRLHALYEVFRQQVFHELELKEFADAFAQMLAYGLFLARLNADANEKVTLENVRRFIPGSFRLIRELVRFLEEMNEAEYEEARWVVDEILSIVNGLDLTAVHSDLSFRRRKAISRKVRAQDEEEHRLFERDPFIYFYEDFLKAYDKETRKARGVYYTPPPIVNFIVRAVDDILKSEFGIADGLADHERVTVLDFACGTGTFLLEVFERIFETIGGADVGKAKKVVREHILRNIFGFEYLIAPYTIAHLKLSQYLKDKGHELHADERLQVFLTNTLEPVEPQANLLLPAITEEVKAAQQVKDQKILVITGNPPYSGHSRNKGAWISQEINSYKFTIEADADGREFKKPLGERNLKWLNDDYVKFIRFAQAKMDAVDEGVVGIITNHSWLDNPTFRGMRQSLMRSFNRIIVIDLHGSIKPKELPPGGARNENVFDIQKGVALSFFIKRSGMERGIWRSDIWGTRLEKYSALAIGTLESAHLSRLHPTCESYLFAYQNAEIRTQYECFTSVREIFETASVGVATARDALTIHFQRKELLQTIDDFSSRETEDARETYRLGTDAEDWKVMWAQQDIRSATEKEKHIVHILYRPFDVRWTFYTGKSNGFHCRPRAEAMRHMRQISNLALITSRLTKGENFRHVQITEHISEVICMSPETSNNGFLFPLYKANDAKTGVENFKPDFRDDLDARYRHHYSPEEILGYIYAVLHAPTYRTRYAEFLRLDFPRIPFPEKAVHFEALSALGWALVQVHLLRDLPRRKLGQLVGKGEDAVEFVRYSEAEKAVAINGRQSFRPVPEEVWNFHIGGYQVIDKYLKSRKGRTLSLDEIRQVERICDALSFTIDQMAAIDRAYLAAFPDAETGGKPAPAPRARKPRKV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3284941-3284989	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3285268-3285316	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3285595-3285643	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3285922-3285970	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3286249-3286297	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3286576-3286624	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3287230-3287278	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3287557-3287605	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3287884-3287932	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3288211-3288259	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3288538-3288586	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3288865-3288913	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3289192-3289240	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3289519-3289567	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3289846-3289894	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3290173-3290221	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3290500-3290548	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3290827-3290875	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3291154-3291202	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3291481-3291529	0	1.0
NZ_AP022332_3	3.2\|3284287\|49\|NZ_AP022332\|CRISPRCasFinder	3284287-3284335	49	NZ_AP022332.1	3284614-3284662	1	0.98

1. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3284941-3284989, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

2. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3285268-3285316, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

3. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3285595-3285643, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

4. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3285922-3285970, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

5. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3286249-3286297, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

6. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3286576-3286624, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

7. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3287230-3287278, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

8. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3287557-3287605, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

9. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3287884-3287932, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

10. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3288211-3288259, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

11. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3288538-3288586, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

12. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3288865-3288913, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

13. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3289192-3289240, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

14. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3289519-3289567, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

15. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3289846-3289894, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

16. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3290173-3290221, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

17. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3290500-3290548, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

18. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3290827-3290875, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

19. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3291154-3291202, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

20. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3291481-3291529, mismatch: 0, identity: 1.0

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	Protospacer
*************************************************

21. spacer 3.2|3284287|49|NZ_AP022332|CRISPRCasFinder matches to position: 3284614-3284662, mismatch: 1, identity: 0.98

gcagatcggcaagctcaccaccaccgcgatctcgaacctctccaccacc	CRISPR spacer
gcagatcggcaagctcaccaccaccgcgatctccaacctctccaccacc	Protospacer
********************************* ***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	MN586020	Microbacterium phage Megan, complete genome	4069-4093	2	0.92
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	KU998238	Gordonia phage Splinter, complete genome	24827-24851	2	0.92
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NC_030911	Gordonia phage Vendetta, complete genome	24827-24851	2	0.92
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP011044	Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI1, complete sequence	5329-5353	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP021035	Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI1, complete sequence	5329-5353	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP021039	Clavibacter michiganensis subsp. insidiosus strain ATCC 10253 plasmid pCI1, complete sequence	5329-5353	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	627479-627503	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1544155-1544179	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	101110-101134	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_KY000069	Agrobacterium deltaense strain Tun176 plasmid pTi_Tun176, complete sequence	13620-13644	3	0.88
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP017943	Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence	173273-173297	3	0.88
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	693252-693276	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	260861-260885	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NC_013531	Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence	680-704	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP006368	Aureimonas sp. AU20 plasmid pAU20a, complete sequence	39759-39783	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP037914	Sphingomonas sp. AAP5 plasmid p213, complete sequence	167103-167127	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	156739-156763	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP024308	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence	241034-241058	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	MN234192	Streptomyces phage Animus, complete genome	30950-30974	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	MF766047	Streptomyces phage SqueakyClean, complete genome	30882-30906	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	MK392366	Streptomyces phage Janus, complete genome	30791-30815	4	0.84
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	19732-19756	4	0.84
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	5978-6002	4	0.84
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	432274-432298	4	0.84
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP015322	Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence	58288-58312	4	0.84
NZ_AP022332_2	2.3\|3283792\|25\|NZ_AP022332\|CRISPRCasFinder	3283792-3283816	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1228950-1228974	5	0.8
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NC_014718	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence	209525-209549	5	0.8
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	728181-728205	5	0.8
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	786266-786290	5	0.8
NZ_AP022332_2	2.4\|3283840\|25\|NZ_AP022332\|CRISPRCasFinder	3283840-3283864	25	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	745313-745337	5	0.8

1. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to MN586020 (Microbacterium phage Megan, complete genome) position: , mismatch: 2, identity: 0.92

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgtcggcctcgcgctcgcg	Protospacer
********.******* ********

2. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to KU998238 (Gordonia phage Splinter, complete genome) position: , mismatch: 2, identity: 0.92

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcctgtggctcgcg	Protospacer
*************** * *******

3. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NC_030911 (Gordonia phage Vendetta, complete genome) position: , mismatch: 2, identity: 0.92

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcctgtggctcgcg	Protospacer
*************** * *******

4. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP011044 (Clavibacter michiganensis subsp. insidiosus strain R1-1 plasmid pCI1, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gggcatcgccggccactcgctcgcg	Protospacer
 * *********** **********

5. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP021035 (Clavibacter michiganensis subsp. insidiosus strain R1-3 plasmid pCI1, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gggcatcgccggccactcgctcgcg	Protospacer
 * *********** **********

6. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP021039 (Clavibacter michiganensis subsp. insidiosus strain ATCC 10253 plasmid pCI1, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gggcatcgccggccactcgctcgcg	Protospacer
 * *********** **********

7. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccgggctgtcgctcgcc	Protospacer
************ ** ********

8. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cggcatcgccggcctctcgatcgcc	Protospacer
** **************** ****

9. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccgggctgtcgctcgcc	Protospacer
************ ** ********

10. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_KY000069 (Agrobacterium deltaense strain Tun176 plasmid pTi_Tun176, complete sequence) position: , mismatch: 3, identity: 0.88

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcatctcggtcgtg	Protospacer
************* ***** ***.*

11. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP017943 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

gcaggcggacgaattcaccgccact	CRISPR spacer
gcaggaggacgaattcatcgccacc	Protospacer
***** ***********.******.

12. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcatcccgctcgac	Protospacer
************* **.******

13. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccctcgccggcctcgcgctcggc	Protospacer
**** *********** ******

14. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NC_013531 (Xylanimonas cellulosilytica DSM 15894 plasmid pXCEL01, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
ggccaccgccgccctctcgctcgca	Protospacer
 ****.***** ************.

15. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP006368 (Aureimonas sp. AU20 plasmid pAU20a, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcctgacgctcggt	Protospacer
***************  ******

16. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP037914 (Sphingomonas sp. AAP5 plasmid p213, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccaacgccggcctgtcgctcggt	Protospacer
***** ********* *******

17. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccatcgccggcatcccgctcgac	Protospacer
************* **.******

18. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP024308 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
cgccgtcgacggcctctcgctcgaa	Protospacer
****.*** ************** .

19. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to MN234192 (Streptomyces phage Animus, complete genome) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gtcgatcgccggcctctcgcttgcg	Protospacer
  * *****************.***

20. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to MF766047 (Streptomyces phage SqueakyClean, complete genome) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gtcgatcgccggcctctcgcttgcg	Protospacer
  * *****************.***

21. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to MK392366 (Streptomyces phage Janus, complete genome) position: , mismatch: 4, identity: 0.84

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gtcgatcgccggcctctcgcttgcg	Protospacer
  * *****************.***

22. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.84

gcaggcggacgaattcaccgccact	CRISPR spacer
cgaggcggacgaatacaccgccacc	Protospacer
  ************ *********.

23. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 4, identity: 0.84

gcaggcggacgaattcaccgccact	CRISPR spacer
cgaggcggacgaatacaccgccacc	Protospacer
  ************ *********.

24. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 4, identity: 0.84

gcaggcggacgaattcaccgccact	CRISPR spacer
gcaggcggacgaattcacctgtacc	Protospacer
*******************  .**.

25. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP015322 (Mesorhizobium amorphae CCNWGS0123 plasmid pM0123d, complete sequence) position: , mismatch: 4, identity: 0.84

gcaggcggacgaattcaccgccact	CRISPR spacer
cgagtcggacgaatacaccgccact	Protospacer
  ** ********* **********

26. spacer 2.3|3283792|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 5, identity: 0.8

cgccatcgccggcctctcgctcgcg	CRISPR spacer
gcagatcgccggcgtctcgctcgcg	Protospacer
    ********* ***********

27. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NC_014718 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH01, complete sequence) position: , mismatch: 5, identity: 0.8

gcaggcggacgaattcaccgccact	CRISPR spacer
ctaggcggacgaattcaccgcggcc	Protospacer
 .******************* .*.

28. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 5, identity: 0.8

gcaggcggacgaattcaccgccact	CRISPR spacer
gcaggcggacgaattcacctgttat	Protospacer
*******************  .  *

29. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 5, identity: 0.8

gcaggcggacgaattcaccgccact	CRISPR spacer
cgaggcggacgaattcaccgcggcc	Protospacer
  ******************* .*.

30. spacer 2.4|3283840|25|NZ_AP022332|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.8

gcaggcggacgaattcaccgccact	CRISPR spacer
cgaggcggacgaattcaccgcggcc	Protospacer
  ******************* .*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1414863 : 1430687

Paracoccus_phage(27.27%)

head,portal,capsid,protease,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161912888.1\|1414863_1416081_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	4.5e-69	38.6
WP_161914922.1\|1416226_1416631_+	hypothetical protein	NA	NA	NA	NA
WP_161912889.1\|1416650_1416935_+	hypothetical protein	NA	NA	NA	NA
WP_024878868.1\|1417036_1417222_+	hypothetical protein	NA	NA	NA	NA
WP_157198924.1\|1417222_1417396_+	hypothetical protein	NA	NA	NA	NA
WP_161912890.1\|1417395_1418013_+\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	1.8e-18	39.6
WP_161912891.1\|1418137_1419367_+\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	3.2e-75	41.4
WP_161912892.1\|1419453_1420035_+\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_161912893.1\|1420031_1420358_+\|head	phage head closure protein	NA	NA	NA	NA
WP_161912894.1\|1420368_1420779_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_161912895.1\|1420803_1421214_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_161912896.1\|1421224_1421575_+	gene transfer agent family protein	NA	NA	NA	NA
WP_161914923.1\|1421604_1421775_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_161912897.1\|1421771_1422359_+\|tail	phage tail tape measure protein	G9JXH3	Shigella_phage	9.5e-09	60.7
WP_161912898.1\|1422369_1423008_+	TIGR02217 family protein	A0A0B5A2K3	Paracoccus_phage	2.0e-44	46.0
WP_161912899.1\|1423023_1423914_+	DUF2163 domain-containing protein	A0A0K0PVK1	Roseobacter_phage	1.4e-59	42.2
WP_161912900.1\|1423910_1424348_+	C40 family peptidase	A0A1V0DYB6	Dinoroseobacter_phage	1.9e-25	44.8
WP_161912901.1\|1424363_1428230_+	glycoside hydrolase TIM-barrel-like domain-containing protein	A0A0B5A7K5	Paracoccus_phage	8.5e-223	40.4
WP_161912902.1\|1428236_1429646_+	DUF2793 domain-containing protein	A0A0K1LM04	Rhodobacter_phage	5.6e-31	38.7
WP_161912903.1\|1429662_1430187_+	DUF4376 domain-containing protein	A0A1S5R1J2	Pseudomonas_phage	1.0e-14	41.8
WP_161912904.1\|1430228_1430687_+	M15 family metallopeptidase	A0A2P0PAE7	Pectobacterium_phage	3.1e-31	51.1

DBSCAN-SWA_2

2577827 : 2586243

Pseudomonas_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_174242403.1\|2577827_2579648_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.9e-47	27.9
WP_161913818.1\|2579958_2580948_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.5e-18	53.6
WP_161913819.1\|2581035_2582289_+	serine hydrolase	B6DZZ7	Stx2-converting_phage	4.0e-49	34.6
WP_161913820.1\|2582285_2583005_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	3.5e-29	38.2
WP_161913821.1\|2583001_2584075_+	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	1.2e-14	30.4
WP_174242404.1\|2584084_2584600_+	DNA-deoxyinosine glycosylase	NA	NA	NA	NA
WP_161915000.1\|2584689_2586243_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	5.5e-96	39.8

DBSCAN-SWA_3

2683766 : 2693059

uncultured_Mediterranean_phage(87.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161913891.1\|2683766_2685308_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	1.6e-15	42.7
WP_161913892.1\|2685479_2686166_-	methyltransferase domain-containing protein	A0A1B1IU40	uncultured_Mediterranean_phage	7.2e-16	39.0
WP_161913893.1\|2686173_2686938_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.7e-38	38.9
WP_161913894.1\|2687142_2688462_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-108	49.9
WP_161913895.1\|2688663_2689446_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.0e-50	44.1
WP_161913896.1\|2689442_2689916_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_161913897.1\|2689961_2690210_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_161913898.1\|2690379_2691120_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.2e-42	47.1
WP_161913899.1\|2691158_2691992_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.1e-33	36.7
WP_161913900.1\|2692051_2693059_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	5.8e-22	45.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_AP022335

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

49634 : 100557

uncultured_Caudovirales_phage(28.57%)

integrase,transposase

attL 78410:78427|attR 100416:100433

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161915495.1\|49634_50663_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	8.5e-13	25.8
WP_161915200.1\|51449_51710_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_161915199.1\|51706_52132_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_161915496.1\|52456_53572_+	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_161915497.1\|53816_55607_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_161915498.1\|55655_57134_+	glucan 1,4-alpha-glucosidase	NA	NA	NA	NA
WP_161915499.1\|57170_60557_-	hypothetical protein	NA	NA	NA	NA
WP_161915500.1\|60755_63629_+	discoidin domain-containing protein	NA	NA	NA	NA
WP_161915501.1\|63644_66026_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.1e-164	36.1
WP_161915584.1\|66138_66813_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_161915502.1\|66821_67472_-	nitroreductase family protein	NA	NA	NA	NA
WP_161915503.1\|67865_68588_+	SIMPL domain-containing protein	NA	NA	NA	NA
WP_161915585.1\|68637_70098_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_161915504.1\|70094_70541_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_161915505.1\|70537_70822_+	AtpZ/AtpI family protein	NA	NA	NA	NA
WP_161915506.1\|70818_71100_+	hypothetical protein	NA	NA	NA	NA
WP_161915507.1\|71096_71777_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_003611173.1\|71793_72039_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_161915508.1\|72052_72799_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_161915509.1\|72788_74312_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_161915510.1\|74308_75190_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_161915586.1\|75186_75582_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_161915511.1\|75988_76261_+	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
WP_161915512.1\|76157_76424_+	alpha/beta hydrolase fold domain-containing protein	NA	NA	NA	NA
78410:78427	attL	NA	NA	NA	NA
WP_161915587.1\|78629_79247_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_161915513.1\|79765_81787_+	EAL domain-containing protein	G3MA91	Bacillus_virus	8.3e-20	34.4
WP_161915514.1\|82031_82268_-\|transposase	transposase	NA	NA	NA	NA
WP_161915515.1\|82498_82717_+	hypothetical protein	NA	NA	NA	NA
WP_161915516.1\|82743_82986_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_161915517.1\|82985_83402_+	PIN domain-containing protein	NA	NA	NA	NA
WP_161915518.1\|83398_84532_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_161915519.1\|85717_86020_+	STAS domain-containing protein	NA	NA	NA	NA
WP_161915520.1\|86139_86505_+	response regulator	NA	NA	NA	NA
WP_161915521.1\|86564_88544_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_161915588.1\|88543_88993_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_161915522.1\|89027_91124_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-07	64.0
WP_161915523.1\|91208_93425_+	MCP four helix bundle domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.1e-08	64.7
WP_161915524.1\|93512_93998_+	chemotaxis protein CheW	NA	NA	NA	NA
WP_161915525.1\|94004_94910_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_161915526.1\|94906_95986_+	chemotaxis-specific protein-glutamate methyltransferase CheB	NA	NA	NA	NA
WP_161915527.1\|96015_97743_+	hypothetical protein	NA	NA	NA	NA
WP_161914412.1\|98150_98591_+\|transposase	transposase	NA	NA	NA	NA
WP_161914411.1\|98587_98944_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.3e-10	33.6
WP_161915093.1\|98994_100557_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.7e-76	37.0
100416:100433	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_AP022336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

472 : 9507

Brucella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161915615.1\|472_3187_-	Ti-type conjugative transfer relaxase TraA	A0A0K2FLP8	Brevibacillus_phage	5.0e-12	25.8
WP_161915600.1\|3470_3791_+	mobilization protein	NA	NA	NA	NA
WP_161915601.1\|3882_4149_+	hypothetical protein	NA	NA	NA	NA
WP_162561596.1\|4222_4426_+	hypothetical protein	NA	NA	NA	NA
WP_161915602.1\|4771_5275_-	hypothetical protein	NA	NA	NA	NA
WP_161915603.1\|5443_5701_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161915604.1\|5816_6587_-	hypothetical protein	A0A0A8IK91	Aurantimonas_phage	1.5e-22	42.4
WP_142863164.1\|7550_8192_-	AAA family ATPase	A0A0K1Y6H3	Rhodobacter_phage	7.4e-31	39.6
WP_142863163.1\|8351_8645_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	8.3e-22	51.0
WP_142863162.1\|8644_8947_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.0e-15	48.9
WP_161915605.1\|8955_9507_-	recombinase family protein	A0JC18	Ralstonia_phage	6.2e-26	43.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_AP022334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

111055 : 220148

Escherichia_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161915356.1\|111055_116104_-	DEAD/DEAH box helicase family protein	I6NW45	Burkholderia_virus	0.0e+00	41.6
WP_161915357.1\|116205_116532_-	hypothetical protein	A0A160DEI6	Gordonia_phage	6.4e-07	37.3
WP_161915358.1\|116749_117184_-	hypothetical protein	NA	NA	NA	NA
WP_161915359.1\|117249_118311_-	phosphoadenosine phosphosulfate reductase family protein	H7BVI4	unidentified_phage	1.6e-17	35.2
WP_161915360.1\|118307_119285_-	DUF1738 domain-containing protein	A0A1B1IWW8	uncultured_Mediterranean_phage	1.7e-34	33.0
WP_161915361.1\|119640_120126_+	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	7.3e-23	45.4
WP_161915362.1\|120817_121855_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.4e-08	25.9
WP_161915449.1\|122169_122514_+	WGR domain-containing protein	NA	NA	NA	NA
WP_161915363.1\|123718_124309_+	hypothetical protein	NA	NA	NA	NA
WP_161915364.1\|124378_125560_-	ABC transporter permease	NA	NA	NA	NA
WP_161915365.1\|125570_126236_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.5e-34	41.6
WP_161915366.1\|126297_127722_+	TolC family protein	NA	NA	NA	NA
WP_161915367.1\|127732_129061_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_161915368.1\|129202_129676_+\|transposase	transposase	NA	NA	NA	NA
WP_161915369.1\|129675_129915_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_161915370.1\|129866_130916_+	cytochrome P450	NA	NA	NA	NA
WP_161915371.1\|130924_131098_+	hypothetical protein	NA	NA	NA	NA
WP_161915372.1\|131174_131519_-	hypothetical protein	NA	NA	NA	NA
WP_161915373.1\|131914_132214_-	hypothetical protein	NA	NA	NA	NA
WP_161915374.1\|132344_132698_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161915375.1\|132727_133351_-	hypothetical protein	NA	NA	NA	NA
WP_161915376.1\|134679_135537_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_161915377.1\|135684_135924_-	hypothetical protein	NA	NA	NA	NA
WP_161915378.1\|135920_136517_-	hypothetical protein	D5GVU5	Campylobacter_virus	2.1e-19	32.4
WP_161915379.1\|136525_136858_-	hypothetical protein	NA	NA	NA	NA
WP_161915450.1\|136897_138376_-	hypothetical protein	M4QT32	Loktanella_phage	7.9e-20	41.4
WP_161915451.1\|138567_140649_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	2.3e-81	31.6
WP_161915380.1\|141591_142533_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_161915381.1\|142790_143147_+	WGR domain-containing protein	NA	NA	NA	NA
WP_161915382.1\|143136_145323_+	ATP-dependent RecD-like DNA helicase	A0A0H3UZA5	Geobacillus_virus	3.1e-60	28.3
WP_161915383.1\|145410_145671_+	hypothetical protein	NA	NA	NA	NA
WP_161915384.1\|148875_149370_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161915385.1\|149366_149825_+\|transposase	transposase	NA	NA	NA	NA
WP_161915386.1\|149825_150889_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_161915387.1\|150984_151380_+\|transposase	transposase	NA	NA	NA	NA
WP_161915388.1\|153806_154136_-\|transposase	transposase	NA	NA	NA	NA
WP_161915389.1\|155015_155576_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_161915390.1\|155560_156133_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_161915391.1\|156310_157999_-	FkbM family methyltransferase	A0A1V0SAF0	Catovirus	5.0e-10	27.5
WP_161915392.1\|158056_160921_-	glycosyltransferase	NA	NA	NA	NA
WP_161915393.1\|160917_161928_-	hypothetical protein	NA	NA	NA	NA
WP_161915452.1\|163655_163940_+\|transposase	transposase	NA	NA	NA	NA
WP_161915394.1\|164327_165380_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	7.7e-94	50.9
WP_161915395.1\|165398_165956_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.6e-34	42.9
WP_161915453.1\|165958_166855_+	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	1.7e-33	36.3
WP_161915396.1\|166856_167723_+	glucose-1-phosphate thymidylyltransferase RfbA	A0A291LA53	Escherichia_phage	8.9e-96	58.6
WP_161915397.1\|168056_169421_+	hypothetical protein	NA	NA	NA	NA
WP_161915398.1\|170822_171905_+\|transposase	transposase	NA	NA	NA	NA
WP_161915399.1\|171918_173028_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.1e-50	43.5
WP_161915400.1\|174602_175685_+	Hint domain-containing protein	NA	NA	NA	NA
WP_161915401.1\|175775_176210_-	hypothetical protein	NA	NA	NA	NA
WP_161915402.1\|176365_176758_+\|transposase	transposase	NA	NA	NA	NA
WP_161915403.1\|176761_177109_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.2e-27	51.4
WP_161915404.1\|177179_178799_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	5.7e-104	42.7
WP_161915405.1\|179906_181172_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	7.5e-43	35.7
WP_161915406.1\|182821_183610_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_161915407.1\|183627_184275_+	hypothetical protein	NA	NA	NA	NA
WP_161915408.1\|184271_185411_+	DUF563 domain-containing protein	NA	NA	NA	NA
WP_161915454.1\|185584_185842_-\|transposase	transposase	NA	NA	NA	NA
WP_161915409.1\|186410_187100_+	HEAT repeat domain-containing protein	NA	NA	NA	NA
WP_161915410.1\|187188_187917_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.8e-34	38.0
WP_161915411.1\|189010_190519_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_161915412.1\|190515_191325_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	3.0e-37	37.3
WP_161915455.1\|192305_193508_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_161915413.1\|194725_195727_-	FkbM family methyltransferase	A0A0A0V284	uncultured_virus	4.4e-06	30.6
WP_161915414.1\|196005_196593_-\|transposase	transposase	NA	NA	NA	NA
WP_161915415.1\|198243_199307_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_161915456.1\|199857_200286_+	adenylyl-sulfate kinase	A0A1B0XTK9	Freshwater_phage	2.1e-26	46.9
WP_161915416.1\|204233_206447_+	glycosyltransferase	NA	NA	NA	NA
WP_161915417.1\|206483_207209_-	acetyltransferase	NA	NA	NA	NA
WP_161915418.1\|207550_208540_-	GDP-mannose 4,6-dehydratase	M1HVB5	Paramecium_bursaria_Chlorella_virus	3.6e-93	51.3
WP_161915419.1\|211722_212364_+	hypothetical protein	NA	NA	NA	NA
WP_161915457.1\|212894_216548_+	glycosyltransferase	NA	NA	NA	NA
WP_161915420.1\|216599_216725_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_161915458.1\|217195_217429_-	hypothetical protein	NA	NA	NA	NA
WP_159732895.1\|217733_218054_+\|transposase	transposase	NA	NA	NA	NA
WP_161915421.1\|218050_218404_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.0e-09	30.9
WP_161915422.1\|219476_220148_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.3e-50	50.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_AP022332

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_AP022335

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_AP022336

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_AP022334

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection