CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP028240	Lactobacillus plantarum strain SRCM101511 plasmid unnamed5, complete sequence	0 crisprs	csa3	0	0	2
NZ_CP028237	Lactobacillus plantarum strain SRCM101511 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028238	Lactobacillus plantarum strain SRCM101511 plasmid unnamed3, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP028235	Lactobacillus plantarum strain SRCM101511 chromosome, complete genome	1 crisprs	cas3,DinG,csa3,WYL,DEDDh	0	0	5
NZ_CP028239	Lactobacillus plantarum strain SRCM101511 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0	0
NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	1 crisprs	NA	9	6	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028235_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028235_1

1761793-1761990

Orphan

Consensus_repeat	Method
GGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP028235_1

>merge|NZ_CP028235|1|1761793-1761990|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACTGGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGTGGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

>NZ_CP028235|1|1|1761793-1761990|CRISPRCasFinder
GGTTACCGTTGTACTTTGACTAGCCGCACTTTTTACTGAACTAGCACT	GGCTTGACTAGTACTGCTTTGGCTAGCGGCCGACGTTGCACTCTGGCTCGTCGTGCTAGTGACTGAACTAGCACTGGCTTGACTAGTACTACTTTGGCTAGT
GGCCGACGTTGCACTCTGGCTCGTCGTACTAGTGACTGAACTAGCACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028235.1\|WP_024971690.1\|1764223_1765768_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340855
NZ_CP028235.1\|WP_021356835.1\|1755461_1755896_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP028235.1\|WP_003642132.1\|1754026_1755289_+\|ArgE/DapE-family-deacylase	unknown	unknown	gnl\|CDD\|181490
NZ_CP028235.1\|WP_003642127.1\|1757725_1758943_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224582
NZ_CP028235.1\|WP_003642124.1\|1760756_1761257_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|223427
NZ_CP028235.1\|WP_003642133.1\|1751354_1753946_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP028235.1\|WP_003642130.1\|1756068_1756467_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP028235.1\|WP_003644754.1\|1769395_1769959_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP028235.1\|WP_003642122.1\|1762970_1763915_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	unknown
NZ_CP028235.1\|WP_024971692.1\|1756500_1756821_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|223672
NZ_CP028235.1\|WP_024971691.1\|1758935_1759835_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226631
NZ_CP028235.1\|WP_003642116.1\|1770018_1770519_-\|DUF4811-domain-containing-protein	unknown	unknown	gnl\|CDD\|374344
NZ_CP028235.1\|WP_003642118.1\|1768301_1769312_+\|putative-sulfate-exporter-family-transporter	unknown	unknown	gnl\|CDD\|225411
NZ_CP028235.1\|WP_161573849.1\|1750659_1751361_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP028235.1\|WP_003642119.1\|1767357_1768185_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP028235.1\|WP_003644752.1\|1772994_1774182_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP028235.1\|WP_003642115.1\|1770515_1772000_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP028235.1\|WP_003642128.1\|1756834_1757578_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP028235.1\|WP_003642120.1\|1765764_1767273_+\|accessory-Sec-system-glycosyltransferase-Asp1	unknown	unknown	gnl\|CDD\|340855
NZ_CP028235.1\|WP_161573850.1\|1772213_1772876_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319787

Protein	Function_ID	Function_description	E-value
NZ_CP028235.1\|WP_024971690.1\|1764223_1765768_+\|glycosyltransferase	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.18923e-92
NZ_CP028235.1\|WP_021356835.1\|1755461_1755896_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.09879e-48
NZ_CP028235.1\|WP_003642132.1\|1754026_1755289_+\|ArgE/DapE-family-deacylase	gnl\|CDD\|181490	PRK08588, PRK08588, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP028235.1\|WP_003642127.1\|1757725_1758943_-\|ABC-transporter-permease	gnl\|CDD\|224582	COG1668, NatB, ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism].	8.34886e-34
NZ_CP028235.1\|WP_003642124.1\|1760756_1761257_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|223427	COG0350, Ada, Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair].	1.17829e-47
NZ_CP028235.1\|WP_003642133.1\|1751354_1753946_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.85225e-14
NZ_CP028235.1\|WP_003642130.1\|1756068_1756467_+\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	9.00976e-52
NZ_CP028235.1\|WP_003644754.1\|1769395_1769959_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.10921e-26
NZ_CP028235.1\|WP_024971692.1\|1756500_1756821_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	1.79175e-25
NZ_CP028235.1\|WP_024971691.1\|1758935_1759835_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226631	COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only].	2.62955e-136
NZ_CP028235.1\|WP_003642116.1\|1770018_1770519_-\|DUF4811-domain-containing-protein	gnl\|CDD\|374344	pfam16069, DUF4811, Domain of unknown function (DUF4811). This family of proteins is found in bacteria. Proteins in this family are typically between 188 and 241 amino acids in length. There is a single completely conserved residue Y that may be functionally important.	4.84282e-43
NZ_CP028235.1\|WP_003642118.1\|1768301_1769312_+\|putative-sulfate-exporter-family-transporter	gnl\|CDD\|225411	COG2855, COG2855, Predicted membrane protein [Function unknown].	3.10527e-67
NZ_CP028235.1\|WP_161573849.1\|1750659_1751361_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	4.42213e-102
NZ_CP028235.1\|WP_003642119.1\|1767357_1768185_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.66516e-33
NZ_CP028235.1\|WP_003644752.1\|1772994_1774182_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.54209e-66
NZ_CP028235.1\|WP_003642115.1\|1770515_1772000_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	6.00245e-95
NZ_CP028235.1\|WP_003642128.1\|1756834_1757578_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	3.11403e-96
NZ_CP028235.1\|WP_003642120.1\|1765764_1767273_+\|accessory-Sec-system-glycosyltransferase-Asp1	gnl\|CDD\|340855	cd04949, GT4_GtfA-like, accessory Sec system glycosyltransferase GtfA and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding. In general glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in bacteria.	1.93235e-80
NZ_CP028235.1\|WP_161573850.1\|1772213_1772876_+\|HAD-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.85263e-60

>NZ_CP028235.1|WP_003642124.1|1760756_1761257_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MHLTLTQTTINQQTYWLGTTPTGLAFVGRANGPRDEWQAFFKSANIHYDQQANQQACQELHDYLTGQRQHFDIPLDQTTGTPLQHQVWQALTRIPYGQTATYSQLATMINHPTAVRAVASAVGKNPLLIVIPCHRIRRKDGQLGGYRGGLPMKRALLALENARLPK
>NZ_CP028235.1|WP_024971691.1|1758935_1759835_-|ABC-transporter-ATP-binding-protein
MLSIAHIQKRFGTVQALNDVSFDVHDGEIMGLIGQNGAGKSTTFHSILNFLSFDGQITWNGQPLTADDYDQIGYLPEERSLMSKLTITQQIVYLARLKNQPARVTKGKIAAWMKRFAVKGQPTDKIDKLSKGNQQKVQLICTLIHDPKLIILDEPFSGLDPVNADLLKQAILDAKQRGAAIIFSSHDMSNVEAICDSLVMLRNGEAVLKGTVEDVRAQFGRTRLFLTTDWSQAQLADLPGVTTVTQQGARRFRLELADTSVGPAIFDQVTAGHYIEEFSQQPPTLDEIFRTEAGGVNHE
>NZ_CP028235.1|WP_003642127.1|1757725_1758943_-|ABC-transporter-permease
MNKTWIVTFETYLRQIKSWSFLSLVFMPFLFFGFVAAFSYFAAPSASKNDIAVVSTSPQLRTSFIKQSHVATANKYQTLASAKAATKRNDIAGYLVLTTKNQQLQAQFTGPNAVSSGDKAKIQQFLATAQSQRNVQRAQLSAKQTQALAVQPKFTEQLQKHAASDKTAKTVSFYIVVFFVYLILTTYSAITAQEIAADKGTKIMEVIFSSTTPRKYFNGKIYGVLLVIVTQLLVYLVGGFAVMQFVKRSSLTIDFWQQNTDLINQVIHNLVSINLLFALLAVLLYTVASAFCGALVTRVADASKAAQPVIYLSMLAFFMALAFQNTPTNLFVKIFSYIPFFSSYFMPLRLINGMATMPAAIVSLLILIATIIGSMIYIGRIYGGLMLQTDELGFWGNLKRGLRLK
>NZ_CP028235.1|WP_003642128.1|1756834_1757578_+|SDR-family-oxidoreductase
MTVKNKVVVITGASSGIGATTAKQLASNGAKVVLGARREERLAALVDEIKAAGGQAAYQVTDVTKSADVQALVKLAQTQFGGLDVILNNAGIMPTSPISALHTDEWDQMVDINIKGVLNGVAAVMPIFTAQKSGQIITTSSVAGIKSFAGSGVYGATKFAVRNLMEVIRMESAQEGTNIRTVSLYPAAINTELLHTITDKTAKQNMTDFYQQVGISPAAVANVVNFAIDQPEDVNVNEFTIYPTKQA
>NZ_CP028235.1|WP_024971692.1|1756500_1756821_+|carboxymuconolactone-decarboxylase-family-protein
MTVKQTAGRDNLGKLAPQFAALNDDVLFGEVWARESALSLHDRSMITIACLMTSGDFPQLKAHFKMGKDHGISKDEAVEIVTHLAFYAGWPKAWSAMTLIKEVYGE
>NZ_CP028235.1|WP_003642130.1|1756068_1756467_+|cupin-domain-containing-protein
MTTTNNSGLFGLGVKNEAYQQYFIGQSYLNALAGDEQVDVNVSNVTFEPGCRNNWHIHHNGYQILLVTSGEGWYQEAGKPVQLLHPGDVVTIHPGVKHWHGATKDSWFAHIAITKGTSEWLEPVDDEAYAKL
>NZ_CP028235.1|WP_021356835.1|1755461_1755896_-|MerR-family-transcriptional-regulator
MVRTTTERYSIGDFAKAVGLSAPTLRYYEKAGLIEPHRLDNGRRYYETADINWVKFLLHLKGTGMSISELQQYVTWRAAGDNTIPQRLALLKHVKEDFLVQFNEVQHHLQILNDKINWYEEKEAGITQDHEDFSSYLQRFGHHE
>NZ_CP028235.1|WP_003642132.1|1754026_1755289_+|ArgE/DapE-family-deacylase
MNGMAETAQLEAAVQALSDIVKMNTVNNHEQLVADYLVTLLKQHGIEAQSIEYAPGRVNLVAEIGDGHGPVVALDGHEDTVALGDADKWHTDPLAATIKDNRLYGRGVTDMKAGLMAEVFAMIALHDQDAPLHGTVRLLATVGEEVDHLGAEQLTELGYADDIQTLICAEPSGADKQLLLTKSIQAMLGVDGDTAQRMADANPTTEQHFIELAHKGSLTYTIKAQGVAAHSSMPAIGQNAIDMLMTYYQKQTAYFDSFKTIVNPVLGPTVPVVTLISGGEQVNTVPASAEMSVKIRTIPELRNDRLIKDLEAIIAECNADGANLTMDIASSFYPVHTPEDSQLVQLAKKVGEQVLQQRLPYFGAPGGTDASSYIVKSPDMQVIVFGPGNITAHQVNEYVDLDMYGRFIEIYQKMITELLA
>NZ_CP028235.1|WP_003642133.1|1751354_1753946_+|ABC-transporter-permease
MVGAAMTAAYFKTIMREIWSSKARFASILLIIFLGVAFYTGIRATGPDMSQAANDYYAKQKLATNSVQSTMGLTKADTRVLNQHRSQLTYQATRYADVNQLNNSQVVRVMALPTTQRLNRLRIVKGRLPRHANEIVLDAQAQRLQPKLKVGSTYRISSTAKRNAQFTRRTFKVVGFVNSPTYVENTNRGVTNVGKGTLDYLVYVRPQVIKSSVITRIDVQFKNLRGVTPYTAKYRRLNRENTAQLKRWLKPQARKRQQALQAQAQAKLKPLQQATQQLASQVPAGTAQLVKLQSQLKRAQAQVAAITMPTYLYTDRTDNPGYTEYHENTQRVVALSTVFPLFFIAIAALICLTTMTRMVEELRLQMGTLKALGYTNTAVGSEFMIYGGLAALIGTALGVLFGVNFFPRFIAQAYGSMYNLPAINVQYIWMDIGIALAIALLCTLGTALVVLRVDLNSLPAQLLQPRSPKAGKTLLLERWQWLWHRLSFNHKITLRNLFRYKQRLLMTVLGIAGCMAMMITGFGLKDSIGDISVKQFNELWHYDAVVTRSGNETDQQRQALSRGQLYQASLKLQAKQVTVKQSGVAEQTATLGIPAPHQSLSKFVVLRHRQSHQAIHIGDRGAVIDEKLAKLYGVQAGDDLTIKLAGQTTKRIHISAVAENYVNHFIYMSPTYYRRVFKQAPVYNTNYVRFKQATKKQENAYADRLLKQAGVQNVTLMSTEKATNFKMLDSMNLVVLIFVISAGALALVVLYNLTNINVSERIRELSTIKVLGFYDGEVTMYIFRENLILTVLGIIAGCFLGNWLHAYILQTAETNALMFSPTIHPLSYVYAALLTLAFSLLVMGMMHRKLKRVNMLDALKSVD
>NZ_CP028235.1|WP_161573849.1|1750659_1751361_+|ABC-transporter-ATP-binding-protein
MAYIEVQQATRQFKNGEQVTVANRDISFEVDQGAVVVILGPSGAGKSTLLNILGGMDSPTSGRVLVDGVDIAQFNSRQLTTYRRQAVGFVFQFYNLVPNLTARENVELASQITKDARDVDETLTLVGLTHRSDNFPAQLSGGEQQRVAIARAVAKNPKLLLCDEPTGALDYQTGKQVLQVIQDAARQTQTTVIIVTHNSAIAQLGDQVIRINDAQVQSVEHNAHPTPLAEIEW
>NZ_CP028235.1|WP_003642122.1|1762970_1763915_-|LysM-peptidoglycan-binding-domain-containing-protein
MKIKNALLTSLAATGLLALGTTVANADTVVVKAGDTVSEIALTHKTTIKAIQKANHLKNVNLIYIGDKLEVNGKHHATTVTTQVPTSAASSTASSTSTASSTANSTSTQSASSASVSSSTSTSAASTATSSSTTSVASSSAASSSSTSAASSSVTSTSTASAASSSAASSSTSSATSSSATSQASTASSSTATSASMTKLSNTTASSAASTSTAASSSATTSSSTTTSTSSSSSTTSTSSSAEAAAKAWIANKESGGSYTASNGNYYGKYQLSKSLLNGDYSASNQETVADEYVASRYGSWVAAKAFWEANGYY
>NZ_CP028235.1|WP_024971690.1|1764223_1765768_+|glycosyltransferase
MYYFVNTSINPKKSGIEHAEMKRLALFNQHHVPAKMVTRFFSLSLHQTLTAAGIAAENQINLFDFIQHSSERPTTKMTIEDLHLAPDFRVQSVGRHYEVYQNDQLLMKVNTFLNTQKQLNNVQYYDQNGKLVKTDWYDTRGFKGLEQFYAADGQVASEQVFNPDGEVVYQTFHMADRQNQVQNSLYRFINYEGQDWSFAGETAMTTFFLDELNRRTPHAVFVIDRTYELAYAALHMRTKAFKVMHLHSNHVNDPAHPKTASLNFNYAYALNNLDQWNGVIASTKQQTADFQARFGNQPAVYTIPVGIVDDATLNAPKPSFDQRTAGKIIFVARLAEEKQQDQVIRAFKKVLAQVPNATLDFWGYANGDTGKQLHQLVEQLGLKAAVTFNDYTTDLTAVYNDAQLAMLTSRAEGFALALLEGQAHGVPQIAYDVKYGPRDIIRDGHDGQLVPVNDENALATAMIDLLTQPKKLAMYSQQAYQDAQRFSTTAVWQQWQPLMKAAADFYQVEGATQR
>NZ_CP028235.1|WP_003642120.1|1765764_1767273_+|accessory-Sec-system-glycosyltransferase-Asp1
MNFFVNQYLMALNSGVEHAEFKRLQLFKDHQAPAKLVTRQFDGLLHQNMRRFNIADDQMANLFDFFRETTSFSSRVIKMADLNWPTAYDIKPDPNVSEVRAGDRLVAKVHFVPSTVGHVYFIEIFDHFNNLVQRTDYDERGFKARDEFFSSAGEPITDIFYRPDGSRMAEQYYTHDNNGTNYVSLCHLINYHGRDYYFNGEQEWYRFFLDELNKQYDENNVFIADRPLAAQWPVVNMQTAAKKYLWLPTPHAVDPRDQVYSNLNNAYVYGLHEFLSAWDGVITSTEQQKQDLTQWLGGQPSVPILTISAAIVSKQQAQHAPISISERHAHEIIYTGRLDAERRVDQLVTAFDQVHHKITDATLVIYGYGGELDRLKQQVSQLHLETAVTFAGYQPNLTMAYDQAGAYVYTGESDAQPLSLIEALSHGVPAIAYDINYGPKDVLKDGKNGYLVTDGAVNQLVRALTRTLESPQRQQRLSKGAYRSSEQYSDEQVWQQWQPVVQ
>NZ_CP028235.1|WP_003642119.1|1767357_1768185_-|LysR-family-transcriptional-regulator
MFKQLETFCAVYETRNFSHAAEQLFISQPTVSTQIKQLEADLQTTLLTRNGRQEIVPTASGQLLYQQAQKLLTTWAATKTAVQSPRHLVKVPCRIGASHTTGRLILPTLLANLSAVSDRFDFQVTLANSAEILTAMSQHKLDFGLVEKPLVTDQLNRLPFGHDELVHAGDFASPLWLLREPNSGVRHYTNAFLKARNIQPAQVMVIHSNQIIADLLAHGIGQTIISRHVLSNEIPIEQLSAHYQRQFFLLTNTQPAAALRPVQTAITQYLTTWSD
>NZ_CP028235.1|WP_003642118.1|1768301_1769312_+|putative-sulfate-exporter-family-transporter
MKVKGILPGLVTSLVIAIISQGLAQFVPALGAATIAILLGIIGGNTFLKQPQLGRGTKFAESKLLEYSVMLLGATMTVQTIGKIGGFGVLFILCQMTITIVGALWLGRKLGFSQSVRMLMAGGNAVCGSSAIASIAPVIDADEDDKGTVITLVNLMGTVLMLTLPVLGMAVFGGSVILKGALIGGTLQSVGQVVAAASMINQTTVQFATIFKIMRIMMLVVVVLIFGRLHQRTIENELAEDAVVSGNGNGHWLPWYVAGFLILCALNSLISLPAIIGATAHTISSWFEIIALAAIGLRLNLVNFMKAGKRLALYGLGVGTIQVVSALILITLLLQH
>NZ_CP028235.1|WP_003644754.1|1769395_1769959_+|GNAT-family-N-acetyltransferase
MFMLTYRVTPAIELREPLPQSDAPALLALLTADRAQYQYYLPWVAKIQTVADEQRFLTFAQAQLQQAQALNLVIVVEQRVAGMVSCDHFDDNDHSANIGYWLGRPFQGRGVMTAAVRGVCDLGFNQYHRQCLRIRAAVDNQASNAVAQRAGFDFLIQHPGGQHLLDGDHDENVYQVSAVDWLAKRHK
>NZ_CP028235.1|WP_003642116.1|1770018_1770519_-|DUF4811-domain-containing-protein
MIIVLLILATLVFAGTMIFSPAGRNRLIAIIISGLIIAASLIALVLNDNYHWGMHEVTRTQIQDLAPLKSKQAALRVQQLGTGSERVISYRVAAATKVSHTVTATTTTTKLTSGSPAQVQLKTTTWQFKNHLTHVLFSLGNTKTKIVQRQYLFTIPKTWQVVTVKN
>NZ_CP028235.1|WP_003642115.1|1770515_1772000_-|multidrug-efflux-MFS-transporter
MPTQNSTLPLDANGQPYHRTWLVLTLLVGTFTTFITQTLLTTAFPTLMADFHISATAVQWLTTGFMLIMGIMIPVSAWLLTRINSKYLYLTAMLIFGLGTTLAYFAVNFQMLLIARMIQAMGVGISAPVFQTIMSSVYPPEKRGSAMGTAGIVIGLAPAIGPTLSGWIIDNYSWRALFLFILPINILVIIVSFFTLRKVLPTSKQPIDWWSVLISTIGFGSMLYGFSSVGNAGWGDPVVLTTLVIGLIFIGLFVWRQLHMDQPLLELRVFKIPAFTLSAILTALAYMAMMGVEMILPMYIQTVLGRSAMDSGLILLPGAIMMGIMSPITGRIFDHIGARRLAMTGMLLLTLGTAFFLSISATTPILWIIVVYAIRMFGLTMVTMPVTTTGINALPFRLISHGTAANNTLRQVAASMGTAVLISVYSSVAKWQMPGHQLLTQAPLKYRQDGITATLTGYHMAFVVSLIFCAIGFGITFFLKTNHSKTISQEDDAA
>NZ_CP028235.1|WP_161573850.1|1772213_1772876_+|HAD-family-hydrolase
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKVYATYEDDPASVNPYLDYSTLVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSSWDIMPANIAALKVSFTAVVTAEDIQAYKPALAFFETVQERFKLTADNHWHIARGYESDVVPASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAVKQWVN
>NZ_CP028235.1|WP_003644752.1|1772994_1774182_+|MFS-transporter
MNSKSLNKSTVLLMAISAAIVVANINYIQPIEADIAQQFNLPNAVIGAVAMLTQLGYAFGLLLIVPMGDIMNRRMLIMRLLVLAIISALLAFVAPNIWVYALASLLIGITSVAPQVIIPYAGFLAPRNQRGQVLGNVLSGLLVGVLLSRTVSGVLASYLSWQMVYLIAAILIAGLWLVLWRKLPHDPVTTHTTNYKAMIQTVPQLVKRYPVLRASAVNGFVLFGVSNIFWATLVFYLQHQYGWGSREAGLLALLGVTGVLAAPLIGRLADRFRPRTIIGLGLVLSTLAYVVFWLSGTHLVGLIIGIVILDLGTQFGQVANQTRIQSIDVHASSRFNSVFMFGYFMGGALGSFCGNVLWYLAGWNGVCGLAVVVLMIGFYAHFVHYPRVVTRQVQH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

636875 : 695969

uncultured_Mediterranean_phage(22.22%)

tRNA,bacteriocin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646511.1\|636875_638147_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
WP_003642042.1\|638613_640227_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|640399_641008_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|641052_641493_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_024971479.1\|641855_642788_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642038.1\|642802_644155_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003642037.1\|644174_644984_+	sugar-phosphatase	NA	NA	NA	NA
WP_024971609.1\|645152_646139_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|646221_647244_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|647532_648513_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003642032.1\|648878_649703_-	serine hydrolase	NA	NA	NA	NA
WP_003642031.1\|649938_651321_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|651389_652226_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|652718_652982_-	hypothetical protein	NA	NA	NA	NA
WP_003642028.1\|652996_653539_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003646500.1\|654617_655415_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|655407_656106_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|656374_657319_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642021.1\|657628_658495_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|658627_658879_-	Veg protein	NA	NA	NA	NA
WP_003642019.1\|658983_659874_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|659870_660434_-	ribonuclease M5	NA	NA	NA	NA
WP_003642017.1\|660420_661197_-	TatD family hydrolase	NA	NA	NA	NA
WP_161573812.1\|661319_662504_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|662736_664788_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003642014.1\|665109_665538_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_161573813.1\|666095_666938_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003642011.1\|666937_667642_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_003642010.1\|667663_668623_-	hypothetical protein	NA	NA	NA	NA
WP_003642009.1\|668615_669890_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|669935_670853_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003643820.1\|671021_671816_-	hypothetical protein	NA	NA	NA	NA
WP_024971613.1\|671820_672954_-	hypothetical protein	NA	NA	NA	NA
WP_003643818.1\|673407_674421_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642003.1\|675429_676326_-	ROK family protein	NA	NA	NA	NA
WP_161573814.1\|676446_677883_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	5.7e-31	25.5
WP_003643816.1\|677900_679256_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003642000.1\|679478_679901_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|679890_680079_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|680085_681447_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|681519_682230_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003643815.1\|682637_683654_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003643814.1\|684092_684869_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003641994.1\|685127_687437_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003641993.1\|687531_687735_-	hypothetical protein	NA	NA	NA	NA
WP_003641992.1\|687872_688559_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|688652_689333_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641990.1\|689419_690088_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641987.1\|690934_692311_-	HlyD family secretion protein	NA	NA	NA	NA
WP_041153507.1\|692326_694477_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|694743_694914_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|694938_695097_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646470.1\|695195_695969_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

699398 : 744732

Paramecium_bursaria_Chlorella_virus(50.0%)

protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641979.1\|699398_699545_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641977.1\|700422_701169_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641976.1\|701199_702399_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_003641975.1\|702516_702684_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003641974.1\|702811_703012_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641973.1\|703873_704041_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641972.1\|704071_704245_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641971.1\|704241_704910_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_161573815.1\|705321_705525_-	hypothetical protein	NA	NA	NA	NA
WP_011100995.1\|705909_707094_-	cation:proton antiporter	NA	NA	NA	NA
WP_024971607.1\|707138_708515_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_003641966.1\|709040_709856_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641965.1\|710015_710888_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_011100993.1\|710958_711750_+	HAD family hydrolase	NA	NA	NA	NA
WP_003641963.1\|711753_712908_+	MFS transporter	NA	NA	NA	NA
WP_003641962.1\|712911_713529_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641960.1\|713910_714186_-	hypothetical protein	NA	NA	NA	NA
WP_003641956.1\|715456_715864_-	hypothetical protein	NA	NA	NA	NA
WP_114071742.1\|715940_716087_-	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_003641952.1\|716930_717317_-	hypothetical protein	NA	NA	NA	NA
WP_003641950.1\|717606_717885_-	hypothetical protein	NA	NA	NA	NA
WP_003641949.1\|717996_718260_-	hypothetical protein	NA	NA	NA	NA
WP_024971428.1\|718303_719221_-	hypothetical protein	NA	NA	NA	NA
WP_033607791.1\|719217_719493_-	hypothetical protein	NA	NA	NA	NA
WP_003641946.1\|720982_724666_-	MucBP domain-containing protein	NA	NA	NA	NA
WP_021731937.1\|725252_725972_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_003641944.1\|725989_727819_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_003643773.1\|727833_729351_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_024971425.1\|729816_731148_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641941.1\|731225_732197_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003641940.1\|732197_733724_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641939.1\|733961_734408_+	hypothetical protein	NA	NA	NA	NA
WP_024971424.1\|735297_736209_-	oxidoreductase	NA	NA	NA	NA
WP_025015650.1\|736345_737266_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_003641936.1\|737431_738004_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_003641935.1\|738107_738563_-	hypothetical protein	NA	NA	NA	NA
WP_003641934.1\|738581_739052_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_003641933.1\|739161_740358_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|740388_740898_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_003643763.1\|741010_741379_-	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641930.1\|741643_743149_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003641929.1\|743306_743975_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003643762.1\|744168_744732_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_3

1868390 : 1876904

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642585.1\|1868390_1868876_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_003642586.1\|1868859_1869990_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1869992_1870724_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1870725_1870980_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_016511634.1\|1870982_1871660_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642590.1\|1871652_1873872_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.3
WP_003642591.1\|1873856_1875311_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642592.1\|1875307_1876333_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642593.1\|1876325_1876904_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0

DBSCAN-SWA_4

2065189 : 2083481

Lactobacillus_phage(33.33%)

portal,head,transposase,terminase,capsid,integrase

attL 2071214:2071235|attR 2085165:2085186

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161573862.1\|2065189_2066842_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.8e-92	41.3
WP_003642770.1\|2067826_2069803_+	hypothetical protein	NA	NA	NA	NA
WP_003642771.1\|2069857_2070343_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003642772.1\|2070391_2070664_-	hypothetical protein	NA	NA	NA	NA
WP_003642773.1\|2070688_2070922_-	hypothetical protein	NA	NA	NA	NA
2071214:2071235	attL	NA	NA	NA	NA
WP_024971518.1\|2071410_2072568_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	6.6e-54	34.3
WP_024971519.1\|2072642_2073323_-	helix-turn-helix transcriptional regulator	L0P7E1	Lactobacillus_phage	1.9e-13	56.7
WP_033620097.1\|2073474_2073651_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_024971520.1\|2073930_2074149_+	hypothetical protein	NA	NA	NA	NA
WP_024971521.1\|2074145_2074946_+	DNA replication protein	NA	NA	NA	NA
WP_024971522.1\|2074945_2076340_+	virulence protein	Q4ZD27	Staphylococcus_phage	1.1e-71	36.3
WP_024971523.1\|2076483_2076903_+	hypothetical protein	NA	NA	NA	NA
WP_024971524.1\|2076927_2077110_+	sporulation protein Cse60	NA	NA	NA	NA
WP_024971525.1\|2077119_2077458_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	5.5e-09	35.6
WP_024971526.1\|2077450_2077840_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	3.0e-19	44.3
WP_024971527.1\|2078514_2078988_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_161573863.1\|2078984_2080688_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	5.4e-121	40.5
WP_021356362.1\|2080641_2080842_+	hypothetical protein	NA	NA	NA	NA
WP_024971528.1\|2080842_2081943_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	7.2e-50	33.4
WP_024971529.1\|2081939_2083481_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	1.1e-43	25.4
2085165:2085186	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2929792 : 2940432

Lactobacillus_phage(90.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054605159.1\|2929792_2931487_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	1.8e-92	41.3
WP_003643091.1\|2931423_2931654_-	cell surface protein	A0A2P0ZL95	Lactobacillus_phage	1.4e-37	100.0
WP_003643092.1\|2931628_2932096_-	hypothetical protein	A0A2P0ZL91	Lactobacillus_phage	2.7e-83	100.0
WP_003643094.1\|2932440_2932881_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_003643095.1\|2932951_2933512_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_003643096.1\|2933599_2936038_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	100.0
WP_003643097.1\|2936040_2936655_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003643099.1\|2936998_2937946_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_024971568.1\|2938131_2939103_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	8.2e-183	99.1
WP_003644269.1\|2939193_2940432_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	5.7e-221	99.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP028240

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12468

Streptomyces_phage(25.0%)

integrase

attL 2806:2821|attR 18489:18504

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063487539.1\|31_391_+	hypothetical protein	NA	NA	NA	NA
WP_027821993.1\|1709_2639_+	replication initiation protein	NA	NA	NA	NA
WP_001748066.1\|2631_3150_+	HTH domain-containing protein	NA	NA	NA	NA
2806:2821	attL	NA	NA	NA	NA
WP_003587210.1\|3494_3962_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_027822193.1\|4530_5175_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_008855846.1\|5300_5582_+	thioredoxin family protein	NA	NA	NA	NA
WP_015474701.1\|5595_5910_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.0e-13	41.0
WP_006844823.1\|5930_6254_+	thioredoxin family protein	NA	NA	NA	NA
WP_080280589.1\|6253_6388_+	hypothetical protein	NA	NA	NA	NA
WP_006844822.1\|6472_7417_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	7.7e-77	47.9
WP_006844821.1\|7435_8083_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_050340448.1\|8244_9576_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.2e-20	24.7
WP_161573946.1\|9700_10912_-	hypothetical protein	NA	NA	NA	NA
WP_161573947.1\|11074_11377_-	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_161573948.1\|11366_11645_-	RelB	NA	NA	NA	NA
WP_161573949.1\|11880_12468_+\|integrase	site-specific integrase	D2XR58	Bacillus_phage	1.3e-21	32.6
18489:18504	attR	NA	NA	NA	NA

DBSCAN-SWA_2

16941 : 18750

Enterococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161573950.1\|16941_18048_-	SH3 domain-containing protein	A0A249Y0X5	Enterococcus_phage	1.5e-34	47.6
WP_080241820.1\|18468_18750_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.6e-06	42.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP028236

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP028236_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP028236_1

21526-22311

Orphan

Consensus_repeat	Method
TGAGCCCGTCGTACTACC	CRT

17 spacers

The CRISPR arrays of NZ_CP028236_1

>merge|NZ_CP028236|1|21526-22311|CRT
TGAGCCTGTCGTACTACCAGTTGTCGAACCAGTCGTCGAGCCAGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTCGTCGAGCCAGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCAGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAGCCAGTTGTTGAACCAGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAGCCGGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAACCGGTTGTTGAACCCGTCGTACTACCAGTTGTTGAGCCGGTTGTTGAACCCGTCGTACTACCAGTTGTTGAGCCGGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAACCGGTTGTTGAACCCGTCGTACTACCAGTCGTCGAGCCAGTTGTTGAGCCCGTCGTACTACCAGTCGTCGAGCCAGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAGCCGGTTGTTGAGCCCGTCGTACTACCGGTTGTTGAACCCGTCGTACTACCAGTTGTTGAGCCGGTTGTTGAACCCGTCGTACTACCAGTTGTTGAGCCGGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAACCGGTTGTTGAACCCGTCGTACTACCAGTTGTCGAACCGGTTGTTGAGCCCGTCGTACTACC

>NZ_CP028236|1|1|21526-22311|CRT
TGAGCCTGTCGTACTACC	AGTTGTCGAACCAGTCGTCGAGCCAGTTGT
TGAGCCCGTCGTACTACC	AGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTTGTTGAACCCGTTGT
TGAGCCCGTCGTACTACC	AGTTGTTGAACCCGTTGTTGAGCCCGTCGTACTACCAGTCGTCGAGCCAGTTGT
TGAGCCCGTCGTACTACC	AGTTGTTGAACCAGTTGT
TGAGCCCGTCGTACTACC	AGTTGTCGAGCCAGTTGTTGAACCAGTTGT
TGAGCCCGTCGTACTACC	AGTTGTCGAGCCGGTTGT
TGAGCCCGTCGTACTACC	AGTTGTCGAACCGGTTGT
TGAACCCGTCGTACTACC	AGTTGTTGAGCCGGTTGT
TGAACCCGTCGTACTACC	AGTTGTTGAGCCGGTTGT
TGAGCCCGTCGTACTACC	AGTTGTCGAACCGGTTGT
TGAACCCGTCGTACTACC	AGTCGTCGAGCCAGTTGT
TGAGCCCGTCGTACTACC	AGTCGTCGAGCCAGTTGT
TGAGCCCGTCGTACTACC	AGTTGTTGAACCCGTTGT
TGAGCCCGTCGTACTACC	AGTTGTCGAGCCGGTTGT
TGAGCCCGTCGTACTACC	GGTTGTTGAACCCGTCGTACTACCAGTTGTTGAGCCGGTTGT
TGAACCCGTCGTACTACC	AGTTGTTGAGCCGGTTGTTGAGCCCGTCGTACTACCAGTTGTCGAACCGGTTGT
TGAACCCGTCGTACTACC	AGTTGTCGAACCGGTTGT
TGAGCCCGTCGTACTACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP028236.1\|WP_057704827.1\|31152_31584_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP028236.1\|WP_057704855.1\|28716_29628_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP028236.1\|WP_057704823.1\|34939_36784_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341046
NZ_CP028236.1\|WP_057704842.1\|10961_11834_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
NZ_CP028236.1\|WP_057704825.1\|33299_33953_+\|metal-dependent-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224240
NZ_CP028236.1\|WP_096587937.1\|10772_10901_+\|putative-metal-homeostasis-protein	unknown	unknown	unknown
NZ_CP028236.1\|WP_161573835.1\|16583_17504_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP028236.1\|WP_076636276.1\|14545_15448_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
NZ_CP028236.1\|WP_161573896.1\|18339_20295_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|132997
NZ_CP028236.1\|WP_057704852.1\|24650_25376_-\|antiholin-like-protein-LrgB	unknown	unknown	gnl\|CDD\|179810
NZ_CP028236.1\|WP_076636277.1\|15534_16167_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP028236.1\|WP_161573902.1\|11947_12799_+\|zinc-ABC-transporter-solute-binding-protein	unknown	unknown	gnl\|CDD\|238502
NZ_CP028236.1\|WP_057704849.1\|17713_18151_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP028236.1\|WP_057704853.1\|25377_25848_-\|CidA/LrgA-family-protein	unknown	unknown	gnl\|CDD\|235222
NZ_CP028236.1\|WP_161573897.1\|26729_28448_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225814
NZ_CP028236.1\|WP_057704824.1\|34454_34736_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028236.1\|WP_057704851.1\|20303_21215_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028236.1\|WP_057704848.1\|12973_14305_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP028236.1\|WP_057704826.1\|31583_33176_-\|divalent-metal-cation-transporter	unknown	unknown	gnl\|CDD\|234815
NZ_CP028236.1\|WP_022638723.1\|25983_26700_-\|response-regulator	unknown	unknown	gnl\|CDD\|184495

Protein	Function_ID	Function_description	E-value
NZ_CP028236.1\|WP_057704827.1\|31152_31584_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	2.37818e-20
NZ_CP028236.1\|WP_057704855.1\|28716_29628_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	4.04762e-69
NZ_CP028236.1\|WP_057704842.1\|10961_11834_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	2.4965e-62
NZ_CP028236.1\|WP_057704825.1\|33299_33953_+\|metal-dependent-transcriptional-regulator	gnl\|CDD\|224240	COG1321, TroR, Mn-dependent transcriptional regulator [Transcription].	6.27986e-21
NZ_CP028236.1\|WP_057704853.1\|25377_25848_-\|CidA/LrgA-family-protein	gnl\|CDD\|235222	PRK04125, PRK04125, antiholin-like protein LrgA.	3.64868e-32
NZ_CP028236.1\|WP_161573835.1\|16583_17504_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.86859e-71
NZ_CP028236.1\|WP_076636276.1\|14545_15448_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	8.10909e-80
NZ_CP028236.1\|WP_161573896.1\|18339_20295_-\|glycosyltransferase	gnl\|CDD\|132997	cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.	5.61414e-11
NZ_CP028236.1\|WP_057704852.1\|24650_25376_-\|antiholin-like-protein-LrgB	gnl\|CDD\|179810	PRK04288, PRK04288, antiholin-like protein LrgB; Provisional.	2.58735e-79
NZ_CP028236.1\|WP_076636277.1\|15534_16167_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	6.90141e-38
NZ_CP028236.1\|WP_161573902.1\|11947_12799_+\|zinc-ABC-transporter-solute-binding-protein	gnl\|CDD\|238502	cd01020, TroA_b, Metal binding protein TroA_b. These proteins are predicted to function as initial receptors in ABC transport of metal ions. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).	3.91502e-98
NZ_CP028236.1\|WP_057704849.1\|17713_18151_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	5.44204e-14
NZ_CP028236.1\|WP_057704823.1\|34939_36784_-\|MFS-transporter	gnl\|CDD\|341046	cd17503, MFS_LmrB_MDR_like, Bacillus subtilis lincomycin resistance protein (LmrB) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of multidrug resistance (MDR) transporters including Bacillus subtilis lincomycin resistance protein LmrB, and several proteins from Escherichia coli such as the putative MDR transporters EmrB, MdtD, and YieQ. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.38548e-71
NZ_CP028236.1\|WP_161573897.1\|26729_28448_-\|sensor-histidine-kinase	gnl\|CDD\|225814	COG3275, LytS, Putative regulator of cell autolysis [Signal transduction mechanisms].	7.21143e-176
NZ_CP028236.1\|WP_057704826.1\|31583_33176_-\|divalent-metal-cation-transporter	gnl\|CDD\|234815	PRK00701, PRK00701, divalent metal cation transporter MntH.	1.92508e-177
NZ_CP028236.1\|WP_022638723.1\|25983_26700_-\|response-regulator	gnl\|CDD\|184495	PRK14084, PRK14084, DNA-binding response regulator.	2.34213e-68

>NZ_CP028236.1|WP_057704851.1|20303_21215_-|hypothetical-protein
MANSKMLTILLYDIENDTAQLFKALATINNQVGLRLEEEVQVILLSNQMTASYDDLESYFPNLKLMFEYHDGWSLAKLLNLGLTNIVTPWMTILDSRDLLFADGALLDFFKLIWNPETKADVIVFKYVYPEFDKQHRVTSFGRADFLNMPFGKYWKRDFLAEQQLGFNEKLDQYVLTDFTSRAMEICPKPLWVDLNNYYLAPRPKIKQNVTEFITYRIDFLNFISHHQVTDEIYLRDLVWSIVYAWSLLVDLGYTNDSHKMGIFSQLLILIRSFGNYKAILNEECRQQGIVFEIPYDQLKKGW
>NZ_CP028236.1|WP_161573896.1|18339_20295_-|glycosyltransferase
MSERKLLTIIIPQHREKEAQLFKVLTSINNQVGIDLTTVAIKIIGDGGYRISEDFFDNFKFLDINYVYYYPAHGPGYARQIGLEQTRSKYLAYLDADDTLSNVNSLWQFVNVLRDTGDHQVIFSRYIEERSPQTLLDERYIIREFNPSAVYGKWLNVDYLRAYAFYWHPKLQHAYEDTFFLDSVLTFATDIYYLDIPTYMWLYHNDSIVRTNVDYNSNCLDQYVLESRLWIQEMEKRAPQRLKFDINNGLANIYIFYIQHPPVAAIERKFQEEIKEYVRENKDYIDLSYSQKLFNSKSFSTSLSKFIAFWQLYLSDNCGLQVKNQSKNQSKKMLSLVIPFRENSVTVLKRLFWSIINQVKVDLKQLEVIIVQDGGNKIDETAFKQCFPQLDQEWFYHKDVLGPGPSRSQGLQKAQGKYVMFCDADDQLHTITSLYNMCRAAKIHPDADILMAKYMNEQFDSEGQGELVEWSYNFGAVYPHWFNLNFLRSHRIDFHHALHSYYEDTFFCGIATRVAKNIIFTDEVVYTHRFNPYSLIHKELKKRQALFLEEYCRENYYWFQVARQRFPQKIRNDLNNFIITLYYMYTNYRLDSFKIDSQISYWTHKIKDHNSGDWHGWTPMIQQQANDRHTDDAIGVSSQGLKMFIEKFMTE
>NZ_CP028236.1|WP_057704849.1|17713_18151_-|MarR-family-transcriptional-regulator
MLNQQQTKIQFESLATLQAVQKQAYQMLMQGLATTGFSMREWGILVYLEQHGQATASELADAFMVTRTLISRNTWRLIQDNLIQSQVNQTDRRVVRLTLTTNGQERVQRSVRQVQANLKTFNQSHDLEKLTKQVETLSQQLAKIN
>NZ_CP028236.1|WP_161573835.1|16583_17504_-|IS30-family-transposase
MGTATLSRFQRGALAQLVSEGHHTYQDMADALGVAKSTISYELDRVKPYDPELAQQDADHKRRACGRHSILTPSLTILITNHLLLTWSPEAIATAFNLSTASIYNWLKLGWLPFNLADLPNRNVRQRRANEHRGTFTSGTSIEQRPKSVNQRLAFGHWEVDTVLSSRGQSRACLVTFVERKTRLLWAIKAPNRTAKTLNDTFGKFMGTFGSQVKSITVDHGKEFADYRSIEQDYQIKVYFCHPYSPWERGSNEYFNRRLRWFFPKKTNFDQITTDEILTALELINQRPLKIHHQQTAIESFRACSD
>NZ_CP028236.1|WP_076636277.1|15534_16167_-|recombinase-family-protein
MKIGYARVSSENQNLARQIEALKKSGVEKIFQEKVSGKSVQNRPELQKMLEFIREKDIVTVLDLDRLGRNAQDITDTINLIQQKEATLDVLSLPSFTDIQDVNLRGLLTNLVFEIYKYTAEEERNKIHARQNQGIQLAKERGEYKGRRRQYSPHGSKRYLYKGVVQMLRDGTNIAQIARSTGVQRRQIYRIKEYALKVGDLGTPKGEVNS
>NZ_CP028236.1|WP_076636276.1|14545_15448_-|YitT-family-protein
MFFKDWTKYNSFELVMITLGCSIYAFSLDLISIPNGLADGGLSGITLIIRHFFHINLGISTLFLNIPLILIGLRYLGKRMMAYTIYGTICLSLFLIIWSQQALIQPLPLRNDLLLSSLVAGVLSGLGIGLVFRYNGTTGGSDIIARVGQRSFGFSSGKGILIIDYVVLGLSLSYLDLYHIAYSLIVSFILSKVIDVVQEGPNRAKVLFIVSDKSQKISQLIDVSLNRGLTYLQAEGGYQHDQKQVIYLVVQPREIPQLKQLIKAIDERAFVTVLDAHEVIGEGFSYQRKRYHVNWQHGKE
>NZ_CP028236.1|WP_057704848.1|12973_14305_-|hypothetical-protein
MKRNIQSIGNTMLSIISSTVVVLPFMIFLKWGSSHTVVAVLPFVIFYTFRTTGIFFIRGIRTKINSYVLLKIAIYCGLLGSLFGLVGVSFLELELVSGSFLGLSAAWLPMANNTINYYKFENHLTDSKNMGITVLFLTFLGIVLLLPNNYSFVLFFVIYGLMYSLALSSLINIKNYAVQVHDLEDYSYRYLILFLFLFALVFLLRSSRLLLSTLQFDYFVYGTFLLVLCMLILSMFSHHRPQRRVPSDLSYLTILNGALGNYLFLFSSLYAAGYYGHNQLFARFYLPYVLGIAIAPIIGGLVGKESKKISLIGMTIGLILVLITPFFTSSVLILSTFKSVFNSWLTEIYRHQDELPKDKRIWVKYTIQSMGSIAHQFVLMIIGSLLVMGNQSSVKTFFVMTSQKIPTVESRTLMTNWNGIATGILLIGLIVYGLGSAIKINVK
>NZ_CP028236.1|WP_161573902.1|11947_12799_+|zinc-ABC-transporter-solute-binding-protein
MAGCSQSTSSTKNNKIAVTATTDFYEEVAKAVVGNKGHVTSVINNPSVDPHDYEPTSKIAKEVANSNVLVANGVGYDGWMSKLAKNAPKATYIKVGEDLLDKKDGDNPHLWYNPKTMPKLANDLAKHFSKLQPKNEAYFKANAKQYIKSLASINQQIKRINAVAKKTTNKEVYVSEPVFDYALQAAGFKVADHSFEEDTENGVDPSPKTIKTMQTSIKNHKIAFFVFNKQVDSKTVNNLVSLARKNNVPVLAVTETLPSGKTYKTWMLSQYQQLYKIISTTEN
>NZ_CP028236.1|WP_057704842.1|10961_11834_+|N-acetylmuramoyl-L-alanine-amidase
MIKDLSTLINNKIPFWKQPLFILRVIIIVGLVYIVGHLTIQYFCEPKVTAQTINLRDMPTPKGHIIEKLAYGTRLKVEKKNVHTKWWRVKVGHHQGWVASWLIHQTKYRAINSLAEATIVLDPGHGGIDSGTIGLHGAMEKTYTLPTALAVAQLLRSKHSRVILTRQSDQSVSLSKRPKIANMNKATLFISFHFNSAGKKNTAQGFEVFQYHQNARKLAQKLNNNFVNLPLVNRGIAFGDFEVLRDNQRPAVLIEMGFMDSTHDFKHIKSKIYQRLVARDVVRGITQYVH
>NZ_CP028236.1|WP_096587937.1|10772_10901_+|putative-metal-homeostasis-protein
MEKEDHSSACRHLKSPNIKTRKRALKTIKVIKKQRRLFTRAD
>NZ_CP028236.1|WP_057704852.1|24650_25376_-|antiholin-like-protein-LrgB
MVSLFTTPFFGIFLSVMVYLIGQWLFKKSHGLFICQPLFVAMILGIIILIILATILGTTTEKIYSHAYKPGGDLIFWFLSPATIAFAIPLYKRNDVIKKYWLDILASLFIGTVVSLMAIVGISKLMGLSTIGIKSMLPQAATTAIALPISTSIGGNSAVTAMACILNAVIIYALGDWLVKIFHLNSDPIGVGLGLGTAGHTIGSAYALELGSIQGSMAAIAVVVIGVVVDLIVPLFNKLLF
>NZ_CP028236.1|WP_057704853.1|25377_25848_-|CidA/LrgA-family-protein
MSNKKKPTPKRAAPLLVQFGIYTAILFVSNGISSFFPIGFPVPAPVIGLILLYLLLTLNIVKLEWISSVGTFLISIIGFLFVPSGISLAANLKIMQQQGSKLILVIILSTIILLVVTTYTAKLLIWGHRWLIKKYHQPSLKTDLTTVMNFESKERD
>NZ_CP028236.1|WP_022638723.1|25983_26700_-|response-regulator
MNVLIVDDEPLSRSELEYLLQQNNSVMTIYQASGLTDGLKLLVTKQIDLLFLDIDLNNENGFTLANEINQLAKPPLVVFATAYDNYAVDAFNINAIDYVLKPFEQVRIDQAIAKVASVLRGKQVSGDKPLSSFITVTKEEKTRVIKINDIVYAVINQGELTITTTQGKFIAHETLNWLKSHLDSQRFIQVHRNVLVNIEKIHEIQPWFNHTYQIIMIDKQKLPVGRSFIRGLRQRLQM
>NZ_CP028236.1|WP_161573897.1|26729_28448_-|sensor-histidine-kinase
MFTLLILLLQRLGIILALAFILVNVRFFRRLINQKSLRAKWAIIAIFATFTIISNLTGVEINRDGTLIQSTFLTALSPSDSIANTRTLTITVAGIIGGPFVGGMVGIFGGIHRVIQGNLSDFFYIPSSIIIGLFSGFTGRYFKKNITYASPWITALLGICSEGIQMIFIGAFSGLELLKLIFIPMIGLNSIGSFIFVSIINAYITNEQQLKAVQTHDVLNLTDKTLPYFRQGLTIHSATKVCEIIKRYTNFDAVGITDTTNVLAHVGAGHDHHLANQTVMTDLSKHVITSGTARLAYHKSEIGCPQVHCPLESAIVLPLKVNHRTIGALKMYFVNADRLASVEENLATGLSSIFSSQLALGIAEEQSKLASDAKIKALQAQINPHFFFNAINTVSALMRTDVNKARASLLQLSTFFRSTLQGVRENEIPLRLECEHVNSYVSLEQTRFPNKYDITYDVRTDDQIKVPPFCLQVLVENAIKHAFIGCKEHNKIIIVVKQQKQMLKITVSDNGIGIKPSLIKKLGRQVVPSSSGTGTALANLNQRLIGLYGEESRLKIDSDDTGTTIQMCIPYH
>NZ_CP028236.1|WP_057704855.1|28716_29628_+|IS30-family-transposase
MSSITYSERIKIETFCELGLSNIQMGVRLNRSPSTISYELSRCQPYQAELAQTDAEYKRSRCGQKTKLSDELKQKILNHLRLSWSPGMIAHEFKLATKSIYNWLNQGRIGFSLNDLPEHGVRQRSKYNQSLGRSIEQRPMMINQRNRIGDFELDTVVGPRGHSKAVLLTLIDRKSRFLWAYRLKDRTTATVNEALTKFLTTFNGPVHSFTVDRGTEFSGLVSLESQYGIKTYYCHAYTPAERGSNERFNRNLRYFYPKGTRFEHISAQDLTTTLLQINQRPLKILDWQTPYQVMLTNLSKNSD
>NZ_CP028236.1|WP_057704827.1|31152_31584_-|universal-stress-protein
MSTAFKRILVGVDDSADAKLAFKHAINQAIQDEVELVIVSVLEKDDMNVYQALSKDFVHGERTELEKHILEYQKEAQTAGVKNVRALVAEGEPGEVIVKDIIPHVEPDVLIIGSEAKRGIRRHFGSQAAYLAKYSPISVLVIR
>NZ_CP028236.1|WP_057704826.1|31583_33176_-|divalent-metal-cation-transporter
MSKEEKGSVKKHKLIEYANGPSLEEINGTIEVPKNMSFWKTLFAYSGPGALVAVGYMDPGNWSTSITGGQNFQYLLMSVILMSSLIAMLLQYMAAKLGIVSQMDLAQAIRARTSKSLGVVLWILTELAIMATDIAEVIGAAIALYLLFNIPLVIAVFVTVLDVLVLLLLTKIGFRKIEAIVVCLIIVILAVFVYQVALSNPDWGGVIKGLVPTADTFSGSKSVAGMTPLSGALGIIGATVMPHNLYLHSAVSQTRKVDHDDEEDIARTVKFSAWDSNIQLSFAFVVNSLLLIMGVAVFKTGAVKDPSFFGLYQALSNTSMLSNGVLIAVAKSGVLSVLFAVALLASGQNSTITGTLTGQVIMEGFVHMRMPLWLRRLVTRLISVIPVLICVVLTSGKSAIAEHTALNNLMNNSQVFLAFALPFSMLPLLMMTNSEVEMGKRFKNSLWVKVLGWFSVIALTLLNLKGLPDSILGFFGDNPSAAEQSLSSIIANILIIAILALLAWTIYDLYRGNKRYAAKLAAHQTESEAK
>NZ_CP028236.1|WP_057704825.1|33299_33953_+|metal-dependent-transcriptional-regulator
MKSRTSNYLKTIYETSYAQRWTCNKQLATMLGVLPGSVTEAVNRLISQKLVVKNKGQIKLTKRGYQLVTDLMYRYRLCEIWLADNIQLSLPEVPRQAWLMSAIDSSVVMAKLNQQMAYPKTSPFGGALKLESFSKYQHPTLLSLLSIPVGKEVKIISFLETPATIHYFQHSGLHLGQVLTINSKNTVLPNISITDVKDNEYLIDNSMAVYIYCELLS
>NZ_CP028236.1|WP_057704824.1|34454_34736_-|hypothetical-protein
MTPNETYSFLDSCRLLPPQIYFWKPFTKTTIYVDTAQRSLLYHVDLYAMTISIFAGDRRSELSEHFIPVRTIDLNSAQTKMLKSYEYVENVTH
>NZ_CP028236.1|WP_057704823.1|34939_36784_-|MFS-transporter
MSKATKIISFIGLTIAMFMGTLDSTIVNIALPKIMTHFNASLTDTSWVATIYTLALAVFMITGSKIADRYGRKKIMLLGLALFGGFSAACMLATSLPELIAFRFFQGLGGAIITPIVLPMGIEIFGKAHMSKIASVVGAVTALAAAGGPPIGGVIIEYASWRWVFGINVPLTIVAFLIIAMGVRESYDESLAGRIDLPGTVLLTLGLGGLTFGLLEGRQYGWQSGIILGTLIGGVLAIGLFIFIESKVKHPLLELDLFREKTLTASSLVYFLTGFALVSPTLILNYFLQDVLNDTALHAALIIIPVSLTIMVAMPLGTKLFDQVGAVPVTLIGLLVMAASLLLLSFITTTTPKVVIITFLVINGVGFGFSSVSLVASVKHLPKNKSGIGSGIVNAARQIGTCLGIAILVTVLDNNVNTAKQHIQQDAIQIVDRQQLSPKVNKVAHQQLNSLFSTTGSAKLTTKNKQTNLRRALKQAAKSQVDLPQPQKGTDLHQVYQAQKKLALATDNLKAGNQQLALTLTKLENQNTAISKLSVASQKINLGNQKISQGQKKLLVGLKQLAQKEALTTALRKIKHTKNRQTSQAFSHTYLVGAVIVLILSPIALLTDRKPLKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP028236_1	1.13\|22072\|18\|NZ_CP028236\|CRT	22072-22089	18	NZ_CP028236.1	21508-21525	0	1.0
NZ_CP028236_1	1.4\|21736\|18\|NZ_CP028236\|CRT	21736-21753	18	NZ_CP028236.1	21508-21525	1	0.944
NZ_CP028236_1	1.4\|21736\|18\|NZ_CP028236\|CRT	21736-21753	18	NZ_CP028235.1	1390779-1390796	2	0.889
NZ_CP028236_1	1.7\|21856\|18\|NZ_CP028236\|CRT	21856-21873	18	NZ_CP028235.1	457114-457131	2	0.889
NZ_CP028236_1	1.8\|21892\|18\|NZ_CP028236\|CRT	21892-21909	18	NZ_CP028236.1	21508-21525	2	0.889
NZ_CP028236_1	1.8\|21892\|18\|NZ_CP028236\|CRT	21892-21909	18	NZ_CP028235.1	1390779-1390796	2	0.889
NZ_CP028236_1	1.9\|21928\|18\|NZ_CP028236\|CRT	21928-21945	18	NZ_CP028236.1	21508-21525	2	0.889
NZ_CP028236_1	1.9\|21928\|18\|NZ_CP028236\|CRT	21928-21945	18	NZ_CP028235.1	1390779-1390796	2	0.889
NZ_CP028236_1	1.10\|21964\|18\|NZ_CP028236\|CRT	21964-21981	18	NZ_CP028235.1	457114-457131	2	0.889
NZ_CP028236_1	1.11\|22000\|18\|NZ_CP028236\|CRT	22000-22017	18	NZ_CP028235.1	390850-390867	2	0.889
NZ_CP028236_1	1.12\|22036\|18\|NZ_CP028236\|CRT	22036-22053	18	NZ_CP028235.1	390850-390867	2	0.889
NZ_CP028236_1	1.13\|22072\|18\|NZ_CP028236\|CRT	22072-22089	18	NZ_CP028235.1	1390779-1390796	2	0.889
NZ_CP028236_1	1.13\|22072\|18\|NZ_CP028236\|CRT	22072-22089	18	NZ_CP028235.1	2112494-2112511	2	0.889
NZ_CP028236_1	1.17\|22276\|18\|NZ_CP028236\|CRT	22276-22293	18	NZ_CP028235.1	457114-457131	2	0.889

1. spacer 1.13|22072|18|NZ_CP028236|CRT matches to position: 21508-21525, mismatch: 0, identity: 1.0

agttgttgaacccgttgt	CRISPR spacer
agttgttgaacccgttgt	Protospacer
******************

2. spacer 1.4|21736|18|NZ_CP028236|CRT matches to position: 21508-21525, mismatch: 1, identity: 0.944

agttgttgaaccagttgt	CRISPR spacer
agttgttgaacccgttgt	Protospacer
************ *****

3. spacer 1.4|21736|18|NZ_CP028236|CRT matches to position: 1390779-1390796, mismatch: 2, identity: 0.889

agttgttgaaccagttgt	CRISPR spacer
agttgttgaaccgcttgt	Protospacer
************. ****

4. spacer 1.7|21856|18|NZ_CP028236|CRT matches to position: 457114-457131, mismatch: 2, identity: 0.889

agttgtcgaaccggttgt	CRISPR spacer
agttgtcgtaccgtttgt	Protospacer
******** **** ****

5. spacer 1.8|21892|18|NZ_CP028236|CRT matches to position: 21508-21525, mismatch: 2, identity: 0.889

agttgttgagccggttgt	CRISPR spacer
agttgttgaacccgttgt	Protospacer
*********.** *****

6. spacer 1.8|21892|18|NZ_CP028236|CRT matches to position: 1390779-1390796, mismatch: 2, identity: 0.889

agttgttgagccggttgt	CRISPR spacer
agttgttgaaccgcttgt	Protospacer
*********.*** ****

7. spacer 1.9|21928|18|NZ_CP028236|CRT matches to position: 21508-21525, mismatch: 2, identity: 0.889

agttgttgagccggttgt	CRISPR spacer
agttgttgaacccgttgt	Protospacer
*********.** *****

8. spacer 1.9|21928|18|NZ_CP028236|CRT matches to position: 1390779-1390796, mismatch: 2, identity: 0.889

agttgttgagccggttgt	CRISPR spacer
agttgttgaaccgcttgt	Protospacer
*********.*** ****

9. spacer 1.10|21964|18|NZ_CP028236|CRT matches to position: 457114-457131, mismatch: 2, identity: 0.889

agttgtcgaaccggttgt	CRISPR spacer
agttgtcgtaccgtttgt	Protospacer
******** **** ****

10. spacer 1.11|22000|18|NZ_CP028236|CRT matches to position: 390850-390867, mismatch: 2, identity: 0.889

agtcgtcgagccagttgt	CRISPR spacer
agtcgtcgaatcagttgt	Protospacer
*********..*******

11. spacer 1.12|22036|18|NZ_CP028236|CRT matches to position: 390850-390867, mismatch: 2, identity: 0.889

agtcgtcgagccagttgt	CRISPR spacer
agtcgtcgaatcagttgt	Protospacer
*********..*******

12. spacer 1.13|22072|18|NZ_CP028236|CRT matches to position: 1390779-1390796, mismatch: 2, identity: 0.889

agttgttgaacccgttgt	CRISPR spacer
agttgttgaaccgcttgt	Protospacer
************  ****

13. spacer 1.13|22072|18|NZ_CP028236|CRT matches to position: 2112494-2112511, mismatch: 2, identity: 0.889

agttgttgaacccgttgt	CRISPR spacer
agttattggacccgttgt	Protospacer
****.***.*********

14. spacer 1.17|22276|18|NZ_CP028236|CRT matches to position: 457114-457131, mismatch: 2, identity: 0.889

agttgtcgaaccggttgt	CRISPR spacer
agttgtcgtaccgtttgt	Protospacer
******** **** ****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21544-21573	0	1.0
NZ_CP028236_1	1.2\|21592\|54\|NZ_CP028236\|CRT	21592-21645	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21592-21645	0	1.0
NZ_CP028236_1	1.2\|21592\|54\|NZ_CP028236\|CRT	21592-21645	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21628-21681	0	1.0
NZ_CP028236_1	1.3\|21664\|54\|NZ_CP028236\|CRT	21664-21717	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21664-21717	0	1.0
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21772-21801	0	1.0
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21868-21909	0	1.0
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21904-21945	0	1.0
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22144-22185	0	1.0
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22180-22221	0	1.0
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21928-21981	0	1.0
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22204-22257	0	1.0
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57368-57409	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57512-57553	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57584-57625	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57656-57697	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57728-57769	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57848-57889	1	0.976
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57956-57997	1	0.976
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21820-21873	1	0.981
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57536-57589	1	0.981
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57608-57661	1	0.981
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57680-57733	1	0.981
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57872-57925	1	0.981
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57980-58033	1	0.981
NZ_CP028236_1	1.3\|21664\|54\|NZ_CP028236\|CRT	21664-21717	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21736-21789	2	0.963
NZ_CP028236_1	1.3\|21664\|54\|NZ_CP028236\|CRT	21664-21717	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22072-22125	2	0.963
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22252-22293	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57188-57229	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57224-57265	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57332-57373	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57404-57445	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57476-57517	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57548-57589	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57620-57661	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57692-57733	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57776-57817	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57812-57853	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57884-57925	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57920-57961	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57992-58033	2	0.952
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	58028-58069	2	0.952
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57464-57517	2	0.963
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21796-21837	3	0.929
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22084-22125	3	0.929
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	57764-57817	3	0.944
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21688-21717	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21988-22017	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22024-22053	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	AP012539	Stx2-converting phage Stx2a_WGPS6 proviral DNA, complete genome	520-549	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	FM180578	Enterobacteria phage 2851, complete genome	520-549	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	FJ188381	Stx2-converting phage 1717, complete genome	1176-1205	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	JQ086374	Enterobacteria phage HK544, complete genome	21663-21692	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NC_019710	Enterobacteria phage HK140, complete genome	21665-21694	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NC_049944	Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome	520-549	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	AP012538	Stx2-converting phage Stx2a_WGPS4 proviral DNA, complete genome	520-549	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NC_011357	Stx2-converting phage 1717, complete prophage genome	1176-1205	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	AP012530	Stx2-converting phage Stx2a_F349 proviral DNA, complete genome	520-549	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	KJ832078	Enterobacteria phage Sf101, complete genome	18692-18721	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	18356-18385	5	0.833
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	21760-21789	6	0.8
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4228103-4228132	6	0.8
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	309723-309752	6	0.8
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NC_019715	Enterobacterial phage mEp234, complete genome	21617-21646	6	0.8
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	NZ_CP013108	Sinorhizobium americanum strain CFNEI 73 plasmid A, complete sequence	130037-130066	6	0.8
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	NZ_CP006843	Corynebacterium glyciniphilum AJ 3170 plasmid pCgly1, complete sequence	1047-1076	6	0.8
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	58052-58105	6	0.889
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	CP000619	Burkholderia vietnamiensis G4 plasmid pBVIE03, complete sequence	140867-140896	7	0.767
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_CP006993	Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence	115480-115509	7	0.767
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	MN693761	Marine virus AFVG_250M219, complete genome	24881-24910	7	0.767
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22288-22329	7	0.833
NZ_CP028236_1	1.15\|22144\|42\|NZ_CP028236\|CRT	22144-22185	42	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	58064-58105	7	0.833
NZ_CP028236_1	1.16\|22204\|54\|NZ_CP028236\|CRT	22204-22257	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22276-22329	7	0.87
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4318771-4318800	8	0.733
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	MN693785	Marine virus AFVG_250M536, complete genome	11258-11287	8	0.733
NZ_CP028236_1	1.1\|21544\|30\|NZ_CP028236\|CRT	21544-21573	30	MN694771	Marine virus AFVG_250M352, complete genome	24400-24429	8	0.733
NZ_CP028236_1	1.2\|21592\|54\|NZ_CP028236\|CRT	21592-21645	54	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	22276-22329	8	0.852
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	NZ_CP054607	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed8, complete sequence	46629-46658	8	0.733
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	NZ_CP045408	Roseovarius sp. THAF9 plasmid pTHAF9_d, complete sequence	43560-43589	8	0.733
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	MH572475	Microviridae sp. isolate SD_MF_24, complete genome	2219-2248	8	0.733
NZ_CP028236_1	1.5\|21772\|30\|NZ_CP028236\|CRT	21772-21801	30	MN582058	Caudovirales sp. ctOwN3, complete genome	27110-27139	8	0.733

1. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtcgtcgagccagttgt	Protospacer
******************************

2. spacer 1.2|21592|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgttgaacccgttgttgagcccgtcgtactaccagttgttgaacccgttgt	CRISPR spacer
agttgttgaacccgttgttgagcccgtcgtactaccagttgttgaacccgttgt	Protospacer
******************************************************

3. spacer 1.2|21592|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgttgaacccgttgttgagcccgtcgtactaccagttgttgaacccgttgt	CRISPR spacer
agttgttgaacccgttgttgagcccgtcgtactaccagttgttgaacccgttgt	Protospacer
******************************************************

4. spacer 1.3|21664|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgttgaacccgttgttgagcccgtcgtactaccagtcgtcgagccagttgt	CRISPR spacer
agttgttgaacccgttgttgagcccgtcgtactaccagtcgtcgagccagttgt	Protospacer
******************************************************

5. spacer 1.5|21772|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
agttgtcgagccagttgttgaaccagttgt	Protospacer
******************************

6. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgttgagccggttgt	Protospacer
******************************************

7. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgttgagccggttgt	Protospacer
******************************************

8. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgttgagccggttgt	Protospacer
******************************************

9. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgttgagccggttgt	Protospacer
******************************************

10. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************************************

11. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************************************

12. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagtcgttgagccggttgt	Protospacer
***************************.**************

13. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

14. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

15. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

16. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

17. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

18. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.976

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgttgagccggttgt	Protospacer
*********.********************************

19. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgtcgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******.***********************************************

20. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
*********************.********************************

21. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
*********************.********************************

22. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
*********************.********************************

23. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
*********************.********************************

24. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agttgttgagccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
*********************.********************************

25. spacer 1.3|21664|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.963

agttgttgaacccgttgttgagcccgtcgtactaccagtcgtcgagccagttgt	CRISPR spacer
agttgttgaaccagttgttgagcccgtcgtactaccagttgtcgagccagttgt	Protospacer
************ **************************.**************

26. spacer 1.3|21664|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.963

agttgttgaacccgttgttgagcccgtcgtactaccagtcgtcgagccagttgt	CRISPR spacer
agttgttgaacccgttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
***************************************.********.*****

27. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

28. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactgccagtcgttgagccggttgt	Protospacer
*********************.*****.**************

29. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtgctaccagtcgttgagccggttgt	Protospacer
******************.********.**************

30. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtgctaccagtcgttgagccggttgt	Protospacer
******************.********.**************

31. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactgccagtcgttgagccggttgt	Protospacer
*********************.*****.**************

32. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
*********.********************.***********

33. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

34. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

35. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

36. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

37. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
*********.********************.***********

38. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

39. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagtcgttgagccggttgt	Protospacer
*********.*****************.**************

40. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
******************************.**.********

41. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.952

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagtcgttgagccggttgt	Protospacer
*********.*****************.**************

42. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.963

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
agtcgttgagccggttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
***.*****************************************.********

43. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.929

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
agttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
.********.********************.***********

44. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.929

ggttgttgaacccgtcgtactaccagttgttgagccggttgt	CRISPR spacer
cgttgttgagcccgtcgtactaccagttgtcgagccggttgt	Protospacer
 ********.********************.***********

45. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.944

agttgttgagccggttgttgagcccgtcgtactaccagttgtcgaaccggttgt	CRISPR spacer
ggttgttgaaccggttgttgaacccgtcgtactaccagttgtcgaaccggttgt	Protospacer
.********.***********.********************************

46. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cgtcgtactaccagtcgtcgagccagttgt	Protospacer
 **.**   *********************

47. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cgtcgtactaccagtcgtcgagccagttgt	Protospacer
 **.**   *********************

48. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cgtcgtactaccagtcgtcgagccagttgt	Protospacer
 **.**   *********************

49. spacer 1.1|21544|30|NZ_CP028236|CRT matches to AP012539 (Stx2-converting phage Stx2a_WGPS6 proviral DNA, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

50. spacer 1.1|21544|30|NZ_CP028236|CRT matches to FM180578 (Enterobacteria phage 2851, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

51. spacer 1.1|21544|30|NZ_CP028236|CRT matches to FJ188381 (Stx2-converting phage 1717, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

52. spacer 1.1|21544|30|NZ_CP028236|CRT matches to JQ086374 (Enterobacteria phage HK544, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

53. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NC_019710 (Enterobacteria phage HK140, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

54. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NC_049944 (Stx2-converting phage Stx2a_WGPS8 proviral DNA, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

55. spacer 1.1|21544|30|NZ_CP028236|CRT matches to AP012538 (Stx2-converting phage Stx2a_WGPS4 proviral DNA, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

56. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NC_011357 (Stx2-converting phage 1717, complete prophage genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

57. spacer 1.1|21544|30|NZ_CP028236|CRT matches to AP012530 (Stx2-converting phage Stx2a_F349 proviral DNA, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

58. spacer 1.1|21544|30|NZ_CP028236|CRT matches to KJ832078 (Enterobacteria phage Sf101, complete genome) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtagtcgagacactggg	Protospacer
*************** ****** ** * *

59. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.833

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaacctgccgtcgagcctgcggt	Protospacer
************ *.********* *. **

60. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cgtcgtactaccagttgtcgagccagttgt	Protospacer
 **.**   ******.**************

61. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.8

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
gaccgtcgaaccagtcgtcgagccagctga	Protospacer
....**********************.**

62. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 6, identity: 0.8

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
gctttgcgaaccagtcgtcgcgccagttct	Protospacer
. **  ************** ******* *

63. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NC_019715 (Enterobacterial phage mEp234, complete genome) position: , mismatch: 6, identity: 0.8

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
aattgtcgaaccagtagtcgagacactggg	Protospacer
*.************* ****** ** * *

64. spacer 1.5|21772|30|NZ_CP028236|CRT matches to NZ_CP013108 (Sinorhizobium americanum strain CFNEI 73 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.8

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
agttgtcgagcaagttgttgaaaaggttta	Protospacer
*********** **********  .***

65. spacer 1.5|21772|30|NZ_CP028236|CRT matches to NZ_CP006843 (Corynebacterium glyciniphilum AJ 3170 plasmid pCgly1, complete sequence) position: , mismatch: 6, identity: 0.8

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
agttgtcgagcgagttgttgaggaagtagc	Protospacer
*********** *********.  *** *.

66. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.889

agttgttgagccggttgttgagcccgtcgtactaccagttgt-cgaaccggttgt	CRISPR spacer
agtcgttgagccggttgttgagcccgtcgtactaccagttgtgctaccttgttg-	Protospacer
***.************************************** * * *. ****

67. spacer 1.1|21544|30|NZ_CP028236|CRT matches to CP000619 (Burkholderia vietnamiensis G4 plasmid pBVIE03, complete sequence) position: , mismatch: 7, identity: 0.767

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
agttgtcgaaccagtcggcgagcagcgggc	Protospacer
***************** ***** .   *.

68. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_CP006993 (Methylobacterium sp. AMS5 plasmid pAMS5a, complete sequence) position: , mismatch: 7, identity: 0.767

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cgtcgtcgaaccagtcgtcgagctcgccgc	Protospacer
 **.*******************. *..*.

69. spacer 1.1|21544|30|NZ_CP028236|CRT matches to MN693761 (Marine virus AFVG_250M219, complete genome) position: , mismatch: 7, identity: 0.767

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cggccttgaaccagttgtcgagccagttgc	Protospacer
 * . *.********.*************.

70. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.833

ggttgttgaacccgtcgtactaccagttgt-tgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgtgctaccttgttg-	Protospacer
*********.******************** . * *. ****

71. spacer 1.15|22144|42|NZ_CP028236|CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.833

ggttgttgaacccgtcgtactaccagttgt-tgagccggttgt	CRISPR spacer
ggttgttgagcccgtcgtactaccagttgtgctaccttgttg-	Protospacer
*********.******************** . * *. ****

72. spacer 1.16|22204|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.87

agttgttgagccggttgttgagcccgtcgtactaccagttgt-cgaaccggttgt	CRISPR spacer
agttgtcgaaccggttgttgagcccgtcgtactaccagttgtgctaccttgttg-	Protospacer
******.**.******************************** * * *. ****

73. spacer 1.1|21544|30|NZ_CP028236|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.733

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
ggtggtcgaaccagtcgacgagccgagcgc	Protospacer
.** ************* ******.. .*.

74. spacer 1.1|21544|30|NZ_CP028236|CRT matches to MN693785 (Marine virus AFVG_250M536, complete genome) position: , mismatch: 8, identity: 0.733

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cggccctgaaccagttgtcgagccagttgc	Protospacer
 * . ..********.*************.

75. spacer 1.1|21544|30|NZ_CP028236|CRT matches to MN694771 (Marine virus AFVG_250M352, complete genome) position: , mismatch: 8, identity: 0.733

agttgtcgaaccagtcgtcgagccagttgt	CRISPR spacer
cggccctgaaccagttgtcgagccagttgc	Protospacer
 * . ..********.*************.

76. spacer 1.2|21592|54|NZ_CP028236|CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.852

agttgttgaacccgttgttgagcccgtcgtactaccagttgt-tgaacccgttgt	CRISPR spacer
agttgtcgaaccggttgttgagcccgtcgtactaccagttgtgctaccttgttg-	Protospacer
******.***** ***************************** . * *..****

77. spacer 1.5|21772|30|NZ_CP028236|CRT matches to NZ_CP054607 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed8, complete sequence) position: , mismatch: 8, identity: 0.733

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
ggaattcgagccagatgttgaaccaggtca	Protospacer
.*   ********* *********** *

78. spacer 1.5|21772|30|NZ_CP028236|CRT matches to NZ_CP045408 (Roseovarius sp. THAF9 plasmid pTHAF9_d, complete sequence) position: , mismatch: 8, identity: 0.733

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
ggaattcgagccagatgttgaaccaggtca	Protospacer
.*   ********* *********** *

79. spacer 1.5|21772|30|NZ_CP028236|CRT matches to MH572475 (Microviridae sp. isolate SD_MF_24, complete genome) position: , mismatch: 8, identity: 0.733

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
cgccgtcgagccaattgttgaaccaatccc	Protospacer
 *..*********.***********.*. .

80. spacer 1.5|21772|30|NZ_CP028236|CRT matches to MN582058 (Caudovirales sp. ctOwN3, complete genome) position: , mismatch: 8, identity: 0.733

agttgtcgagccagttgttgaaccagttgt	CRISPR spacer
ctatgttgaaccagttgttgaaccagaact	Protospacer
   ***.**.****************   *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 4340

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020923829.1\|1226_1781_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
WP_057704847.1\|2681_2924_-	hypothetical protein	NA	NA	NA	NA
WP_003554871.1\|3172_3481_-	hypothetical protein	NA	NA	NA	NA
WP_016526732.1\|3473_4340_-	AAA family ATPase	F0PIG8	Enterococcus_phage	3.4e-55	44.4

DBSCAN-SWA_2

10961 : 17504

Vibrio_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057704842.1\|10961_11834_+	N-acetylmuramoyl-L-alanine amidase	A0A067ZJB6	Vibrio_phage	5.4e-16	34.8
WP_161573902.1\|11947_12799_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_057704848.1\|12973_14305_-	hypothetical protein	NA	NA	NA	NA
WP_076636276.1\|14545_15448_-	YitT family protein	M1Q1P6	Streptococcus_phage	2.2e-52	41.0
WP_076636277.1\|15534_16167_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.1e-13	33.2
WP_161573835.1\|16583_17504_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.3e-49	37.2

DBSCAN-SWA_3

25983 : 29628

Clostridioides_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022638723.1\|25983_26700_-	response regulator	A0A2R2ZGH8	Clostridioides_phage	1.0e-09	23.5
WP_161573897.1\|26729_28448_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.8e-47	27.1
WP_057704855.1\|28716_29628_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-24	30.1

DBSCAN-SWA_4

34939 : 41997

Mycobacterium_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_057704823.1\|34939_36784_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	2.7e-33	29.0
WP_057704822.1\|36948_37524_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_161573898.1\|38033_39749_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	3.4e-91	40.8
WP_041153624.1\|39851_40091_-	hypothetical protein	NA	NA	NA	NA
WP_161573899.1\|40161_40839_-	hypothetical protein	NA	NA	NA	NA
WP_057704803.1\|41190_41997_+	ParA family protein	A0A1V0DZZ0	Clostridioides_phage	5.1e-21	30.1

DBSCAN-SWA_5

49872 : 53427

Streptococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_161573901.1\|49872_51147_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	7.2e-78	39.3
WP_057138770.1\|51405_51510_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_057704828.1\|51793_52717_+	hypothetical protein	NA	NA	NA	NA
WP_020923832.1\|52830_53427_+	recombinase family protein	M9Q1K0	Clostridium_phage	3.5e-19	34.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP028235

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP028240

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP028236

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection