CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP048023	Lactobacillus plantarum strain CACC 558 plasmid p1CACC558, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP048022	Lactobacillus plantarum strain CACC 558 chromosome, complete genome	1 crisprs	DEDDh,cas3,DinG,csa3,WYL	0	0	7	0
NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	1 crisprs	csa3	3	1	5	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25925 : 33628

Enterococcus_phage(28.57%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033098919.1\|25925_28073_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.1e-255	60.5
WP_013356287.1\|28179_29106_+	ribonucleoside-diphosphate reductase subunit beta	A0A2H4P8A9	Corynebacterium_phage	2.0e-37	32.4
WP_033098914.1\|29120_30071_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	5.5e-99	54.6
WP_143142877.1\|30198_31011_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	2.5e-15	29.0
WP_013356284.1\|31124_31757_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	4.7e-14	33.2
WP_013356283.1\|31843_32746_+	YitT family protein	M1Q1P6	Streptococcus_phage	6.3e-52	40.3
WP_087613290.1\|32853_33628_+\|transposase	IS5-like element ISLpl3 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP048022

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048022_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048022_1

651720-651876

Orphan

Consensus_repeat	Method
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP048022_1

>merge|NZ_CP048022|1|651720-651876|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAATACTAGTCAGACAACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTGCGAAAAA

>NZ_CP048022|1|1|651720-651876|PILER-CR
AGAGTATTAATCAAGCGACCCGTACAAGCAATCAAGAATCCAGTAGTACGAAAAA	TACTAGTCAGAC
AACCAGTACAAGCAATCAAGAAGCTAACAGTGCCAAGAGTATTAATCAAGCGACC	CGTACAAGCAATC
AAGAATCCAGTAGTGCGAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048022.1\|WP_054519215.1\|648111_649191_+\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|226122
NZ_CP048022.1\|WP_024002857.1\|658964_659270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_013355415.1\|660185_660734_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP048022.1\|WP_065080323.1\|645801_647022_+\|polysaccharide-biosynthesis-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_065080322.1\|644052_645186_+\|polysaccharide-biosynthesis-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_046947456.1\|641458_642391_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133028
NZ_CP048022.1\|WP_003643204.1\|654990_655431_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP048022.1\|WP_047673126.1\|640464_641376_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133028
NZ_CP048022.1\|WP_003643208.1\|659371_659599_-\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP048022.1\|WP_003644190.1\|659628_659841_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_003644193.1\|660968_661727_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368849
NZ_CP048022.1\|WP_003643213.1\|661753_662563_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP048022.1\|WP_162044983.1\|649326_650103_+\|DUF4422-domain-containing-protein	unknown	unknown	gnl\|CDD\|379595
NZ_CP048022.1\|WP_027822090.1\|655560_656982_-\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP048022.1\|WP_063485825.1\|642903_644037_+\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NZ_CP048022.1\|WP_065080324.1\|647018_648128_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP048022.1\|WP_024002858.1\|659955_660150_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_027822092.1\|650227_650974_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP048022.1\|WP_011101319.1\|645182_645815_+\|polysaccharide-biosynthesis-protein	unknown	unknown	unknown
NZ_CP048022.1\|WP_003643206.1\|657419_658088_-\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775

Protein	Function_ID	Function_description	E-value
NZ_CP048022.1\|WP_054519215.1\|648111_649191_+\|acyltransferase-family-protein	gnl\|CDD\|226122	COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism].	2.29951e-15
NZ_CP048022.1\|WP_003643208.1\|659371_659599_-\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP048022.1\|WP_003643204.1\|654990_655431_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.5268e-13
NZ_CP048022.1\|WP_013355415.1\|660185_660734_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	3.09477e-08
NZ_CP048022.1\|WP_046947456.1\|641458_642391_+\|glycosyltransferase	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.25828e-82
NZ_CP048022.1\|WP_003643206.1\|657419_658088_-\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95
NZ_CP048022.1\|WP_047673126.1\|640464_641376_+\|glycosyltransferase	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	5.16281e-78
NZ_CP048022.1\|WP_003643213.1\|661753_662563_+\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	3.76318e-120
NZ_CP048022.1\|WP_162044983.1\|649326_650103_+\|DUF4422-domain-containing-protein	gnl\|CDD\|379595	pfam14393, DUF4422, Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.	2.54183e-120
NZ_CP048022.1\|WP_027822090.1\|655560_656982_-\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.42954e-41
NZ_CP048022.1\|WP_063485825.1\|642903_644037_+\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	1.38623e-179
NZ_CP048022.1\|WP_065080324.1\|647018_648128_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.000525743
NZ_CP048022.1\|WP_003644193.1\|660968_661727_+\|hypothetical-protein	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	1.74267e-05
NZ_CP048022.1\|WP_027822092.1\|650227_650974_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.68549e-18

>NZ_CP048022.1|WP_027822092.1|650227_650974_-|helix-turn-helix-transcriptional-regulator
MNIARFTPLRISSSEQEFILNFSLLEHDLIHFFKIRDFDHAISRINKFKEVHPINWIDAEILNQLLLGLIGSLTAASYTHNLNLNDFLKLRLYFFNFIKKSPCTSSTFWPLSNDIITTYFNLLDNFDFHVSYQNLSKQVALTAYYISAHPQELTNSHGVLHTLNLNNDYTQKLFKKELGFSINAYIQHIKLSEAKRLLLQRQLSVGKIASLLHFYDTPTFSKTFKKAVGLSPLKYRELNYLSLTSQSY
>NZ_CP048022.1|WP_162044983.1|649326_650103_+|DUF4422-domain-containing-protein
MKVQIYVAAHKPYQMPQDPTYRPIFVGAAIHGGAPQNYQPDDVGDNISVSNPNFNELTAMYWIWKNCHADVKGLNQYRRYLSEAPKRKLAGILSMTEIESLLQQYDVIVPKKRHYYIESNYSHYVHAHHREPLDMMRTVISERHAAYLDDFDQLMHRTSAHMFNMMIMSGPKFDDYAKWVFDILFAVRDRIDIADYDVQEARVFGYLSEFLLDVWINHNQLKYVEVPVMYMEKQQLPAKAYNLLKRKFFPQAAKRTHF
>NZ_CP048022.1|WP_054519215.1|648111_649191_+|acyltransferase-family-protein
MRKRIEWIDIAKGIAILAVVVGHTLGPYNGQFFGSLIFAFHMPIFFMLSGYLYHSRPARQECQRGIINLLLPYLATAVVLLVVSAIARLLPNPLLNAYFPSWRQGLIATAYGAGSAVFNPWHWQVQPIGAVWFLLSMFIALQLFNGVMLLTARRHQRWRQAIVRGGVFAIFAILGGWLGQVAYLPWAVNAALLAQLFLYAGYLVKQTALLSRISSAWYLLFTFMWLVSAFQGYFALTVPTSPNLLISVMGGVAGSLCIIRVSDWLSHYPNARPIKWLKRYGQLSLVVLCFHLIDLNVIGIEGWLTNHLITHMGPLVTTIIAISYRIGFVTVAMLAIPHLPGIRACFLPRQYLFRRLQRR
>NZ_CP048022.1|WP_065080324.1|647018_648128_+|polysaccharide-biosynthesis-protein
MNHQQAYRVQRLILIIALMLILFGDTGMNAVFSFSHQPQSIWFYPQLVIALITAAGPNLLLMALGAYQLRRTALTVPQLIRRVLWIMGGITLFSLAFYLEDLVTQGSLTSFNIAGFLTALAQAPVGFYDILYELLGFFVTLPLLRVIAHHASVAIQQYLFWAELVFIGMVPILAYFTGLTTISVNPPLAITAGCFFALMGYWLSQTEVLHRITREHLLVAWLLTCGCYAVMVSVTMYQVNLEKNFDLISSQPFAQTFQAIPCLTLWVTIATWMMNRPRSKAVRRYNFVQTGYGDMLVAGLLITPFMVINRLLTPIIGAWWSGWLWSIAVLIVSVELVWLLRYVRWLQRILPDLFGGSQLIGGSVNAQKN
>NZ_CP048022.1|WP_065080323.1|645801_647022_+|polysaccharide-biosynthesis-protein
MMRRRGASIQQHRNVLYLIIFGIYLASVTLQTTTFNEMIPHRVGVLIELATLAALLGLVVCLDTLTPGQIIGEVSLLVLVTVVTLTSGAHYLMPTIMLVIAAREVSFRQIIQVYLGVVGTILLLALVASEVGLIKNITFATADGLRQSFGVVYTTDFAAHIFYLCAAYLYLLARRFRLVALLPVLFGLAMIYQFTKTMTDVIALIVLISLYLVYIYRRQLRWLRPMIRYSFLMLPLASGLIIGLSNIFNYQDRLLVALNNTLSTRLALGNNALLAYGVKLFGQAPIPINGWGGDRFETFTNGVGDATYFFIDSSFLNMLISYGLLLTLIIIIGMTWFLYQRTRQHDYLLPVIFVAIAISSMFDQHFLEVTYNVFILMLFADLPNYQTAVGPTFDQPVVIRRGASCR
>NZ_CP048022.1|WP_011101319.1|645182_645815_+|polysaccharide-biosynthesis-protein
MRHMKVQPKERFSLAWRWLPLELLIIMLSVGLGWAGNRWLPKPVYQASVDIQIAQTPRSGLSTARLKRQRRQDIKAITQFNVMPHQSAVLTQASTYAYAHYGIWQPIQELSESVQAAPVARRPVLRVTATSSSRQVAQQNAQAFNVAIKANLTGLKNYRVKTVKRTVTRETNVIRGALWKLILVVGGGLALLSPYLVKYGQGWGRHDDET
>NZ_CP048022.1|WP_065080322.1|644052_645186_+|polysaccharide-biosynthesis-protein
MKMRKRLAIVWGSLALLALLLGYACYALSIQRGQDTVTRIYQTDQNGTPIISPGPITLVGKVNHRNLFQSGINGYVLTNRDPLSTLLPRRNQTVHLKYRSAQTTVELRKTLRQARYLQAGTQNTATPVFQNRQHRGDATTYGRISTSQDGRIWTKLPISYPHVQLSRPSVWYANGRLTLIDGKDRYWTTNFKDWQHQRLNFNGADFKQGRVQAVFPGTTRSAVVVVRGIDRQSSRAKLYYGQLTKTGRVKAWHALQLGKLPARQVAGMSLIDQHLYLFRQRGTQLAVYRANRLTRPVRLVGRVKLNHAQSQRVTAVNLIPTTKHRYRLIFDLTTAEKVQKQPRYRLLDRRFKAVGQQHLLVTDYLWSQFQISLRGSE
>NZ_CP048022.1|WP_063485825.1|642903_644037_+|UDP-galactopyranose-mutase
MNEQYDYLVVGAGLFGAVFAHEAALRGKRVKVIEKRDHIAGNIYTKEVAGIQVHQYGAHIFHTSDREIWDYVNQFAEFNRYTNSPVANYKGHMYNLPFNMNTFSELWGVRTPAEAAAKIAEQRAAANLGDHQPRNLEEQAIALIGTDIYKKLIKGYTEKQWGQKATDLPAFIIRRLPVRYTYDNNYFNDTYQGIPIGGYTQIVEKMLAHPEITVETNTDFFAHKAEYLAQYPKVVFTGMIDQFFDYQLGELAYRSLRFETETVPVDNYQGNAVVNYTDAETPYTRVIEHKHFEFGKGDADQTVITREFPANWQRGDEPYYPVNNQTNNTLYKQYAKLAAAEPQVIFGGRLGQYRYYDMHQVIHAALVTVASEFATTK
>NZ_CP048022.1|WP_046947456.1|641458_642391_+|glycosyltransferase
MQYGAIVVTFNRKQLLIESITALLNQTVPPAKIIIIDNHSTDGTKAELQTADILANPSVDYRYLTKNIGGAGGFARGMQIVAADPNLDWVSMSDDDAIFEPDYFEKLIAYQQDHPNRQILTGSVYIEDGRLQADQRNRFTNWSTFQAQAVPEREYRGNFEFDQYTFCGVFMSVAVIKQVGVADAGYFIWWDDCEYAVRTAKLSRPVNVSAAKLIHKTALPSLDFKSKFVPDWRLYYGQRNRLITIKRWRANSLVSLGWLLGFYARLAIQLCGPFYRGYRKMVIRVYLEALRDASREREGLNPNFMPGQKF
>NZ_CP048022.1|WP_047673126.1|640464_641376_+|glycosyltransferase
MAKIACVIVTYNRKQLLEEALNSVLIQAEAPEYVFVIDNASTDGTEKYINDKFNFDNRHWHYVRCSQNLGGSAGFAQGMRLALQTDCSWISISDDDALFEPGYFAALRKGIKQYPEQSVFSGSVLLPDGKHDMMHREVITNSATLTVRPVTDETYKHDFSYDIFSFVGILLSRQVIEAIGLPEQDYFIRFDDFEYAVRALKFGRFMNLSAAKVLHKTTYTRSAIAPWKEYYVMRNRIALLIKHRGNNHTVRWYCRRFLLRKLLAILLFSNRRRQARSLVNAYVKGYQDGWHARLGRQLAFLPS
>NZ_CP048022.1|WP_003643204.1|654990_655431_+|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGLVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP048022.1|WP_027822090.1|655560_656982_-|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFIFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQIATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFWAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP048022.1|WP_003643206.1|657419_658088_-|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP048022.1|WP_024002857.1|658964_659270_+|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAIRLSCDI
>NZ_CP048022.1|WP_003643208.1|659371_659599_-|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP048022.1|WP_003644190.1|659628_659841_-|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP048022.1|WP_024002858.1|659955_660150_-|hypothetical-protein
MHIWMHTHVLLTVTDSNQRQFHQHWLAGRELTDSDFTSLITILTPLFAEKIISITVRTITEFAD
>NZ_CP048022.1|WP_013355415.1|660185_660734_-|sigma-70-family-RNA-polymerase-sigma-factor
MHADRFDNQMAFDLLARPEHQHLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFRRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP048022.1|WP_003644193.1|660968_661727_+|hypothetical-protein
MLEINTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLIIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKQLAGELGLSKHKLPVIHGDAILMPLSTAKRGTTSWYNRHYLKHIEAQGFMTALVYDGQITIQVDMSERVATRQLAKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP048022.1|WP_003643213.1|661753_662563_+|recombination-regulator-RecX
MSLTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

616811 : 623878

Escherichia_phage(50.0%)

integrase

attL 612859:612872|attR 629307:629320

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
612859:612872	attL	NA	NA	NA	NA
WP_162044970.1\|616811_617675_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	6.5e-99	62.4
WP_085439099.1\|617697_618987_+	cellulase family glycosylhydrolase	A0A2K9VCN9	Lactobacillus_phage	4.5e-27	24.1
WP_085439100.1\|619046_619628_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.3e-38	45.1
WP_162044971.1\|619637_620666_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	5.4e-68	41.8
WP_162044972.1\|620735_621578_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.1e-34	37.2
WP_162044973.1\|623290_623878_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.4e-33	42.5
629307:629320	attR	NA	NA	NA	NA

DBSCAN-SWA_2

829828 : 839667

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044430313.1\|829828_831067_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	1.4e-216	97.4
WP_015825455.1\|831157_832129_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	1.8e-182	99.4
WP_003643099.1\|832314_833262_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
WP_003643097.1\|833605_834220_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_046810985.1\|834222_836661_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.8
WP_044430320.1\|836748_837309_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	8.5e-100	98.4
WP_033608589.1\|837379_837820_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.5e-75	97.3
WP_162044993.1\|838671_839667_+	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	1.4e-52	38.8

DBSCAN-SWA_3

1357337 : 1442529

Lactobacillus_phage(78.57%)

tRNA,tail,portal,head,capsid,integrase,holin,protease,terminase

attL 1382919:1382936|attR 1449466:1449483

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027821256.1\|1357337_1358261_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_162045027.1\|1358745_1359267_-	shikimate kinase	NA	NA	NA	NA
WP_015825650.1\|1359269_1360367_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_162045028.1\|1360369_1361668_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_003644492.1\|1361681_1362209_-	amino acid biosynthesis protein	NA	NA	NA	NA
WP_013355607.1\|1362217_1363387_-	chorismate synthase	NA	NA	NA	NA
WP_061871736.1\|1363379_1364834_-	MFS transporter	NA	NA	NA	NA
WP_003640723.1\|1365482_1365836_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_024002734.1\|1365858_1368435_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
WP_061871738.1\|1368449_1368755_-	hypothetical protein	NA	NA	NA	NA
WP_003640726.1\|1368744_1369044_-	YlxR family protein	NA	NA	NA	NA
WP_061871739.1\|1369088_1370306_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640728.1\|1370326_1370803_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640729.1\|1371098_1375412_-	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640732.1\|1375905_1377615_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_162045029.1\|1377654_1378932_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_003640734.1\|1378969_1379755_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_046039550.1\|1379770_1380550_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	6.9e-23	42.3
WP_160230929.1\|1380669_1381233_-	ribosome recycling factor	NA	NA	NA	NA
WP_003640737.1\|1381234_1381957_-	UMP kinase	NA	NA	NA	NA
WP_003644498.1\|1382156_1383035_-	elongation factor Ts	NA	NA	NA	NA
1382919:1382936	attL	NA	NA	NA	NA
WP_003640739.1\|1383137_1383941_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_003640740.1\|1384165_1384888_+	HAD family hydrolase	NA	NA	NA	NA
WP_003640741.1\|1385176_1386175_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
WP_003640742.1\|1386259_1386565_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003644499.1\|1386548_1387307_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_065080367.1\|1387418_1388054_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_013355613.1\|1388110_1388341_-	YneF family protein	NA	NA	NA	NA
WP_003644501.1\|1388444_1388684_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_003640747.1\|1388835_1389468_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_157262971.1\|1389627_1389720_-	hypothetical protein	NA	NA	NA	NA
WP_003644502.1\|1390093_1390723_+	hypothetical protein	NA	NA	NA	NA
WP_003640749.1\|1390772_1391942_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_003640750.1\|1391977_1392370_-	hypothetical protein	NA	NA	NA	NA
WP_003644503.1\|1392533_1392926_+	hypothetical protein	NA	NA	NA	NA
WP_003644504.1\|1393370_1394312_+	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	2.4e-78	49.0
WP_031275254.1\|1395063_1395636_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162045030.1\|1395787_1396972_-	LCP family protein	NA	NA	NA	NA
WP_003644506.1\|1396952_1397744_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-30	36.8
WP_003644507.1\|1397762_1399505_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003644508.1\|1399983_1401195_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
WP_013355618.1\|1402434_1402965_-\|holin	holin	E9LUS0	Lactobacillus_phage	6.3e-36	98.8
WP_060417952.1\|1402977_1403241_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.8e-37	97.7
WP_060417951.1\|1403240_1404401_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	6.8e-192	89.5
WP_060417950.1\|1404412_1404625_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.4e-17	73.9
WP_060417949.1\|1404621_1405632_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	1.8e-63	89.8
WP_060417948.1\|1405780_1406032_-	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
WP_162045031.1\|1409155_1411513_-	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	93.7
WP_063733638.1\|1411582_1413352_-\|tail	phage tail protein	E9LUR2	Lactobacillus_phage	0.0e+00	93.5
WP_063733637.1\|1413428_1418165_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	73.6
WP_162045032.1\|1418196_1418382_-	hypothetical protein	NA	NA	NA	NA
WP_060417943.1\|1418426_1418801_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	2.7e-57	95.2
WP_162045033.1\|1418867_1419533_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	3.8e-107	91.9
WP_060417941.1\|1419547_1419928_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.7e-59	92.1
WP_013355628.1\|1419927_1420335_-	hypothetical protein	A0A2P0ZLE6	Lactobacillus_phage	2.9e-65	93.8
WP_016511016.1\|1420337_1420685_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	2.0e-43	73.0
WP_013355629.1\|1420674_1421007_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	3.4e-48	91.7
WP_013355630.1\|1421079_1422312_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.5e-210	92.6
WP_013355631.1\|1422311_1423067_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	1.5e-123	93.2
WP_013355632.1\|1423044_1424238_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	1.3e-222	98.0
WP_003644528.1\|1424240_1424435_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	7.4e-27	98.4
WP_016511012.1\|1424424_1426323_-\|terminase	terminase large subunit	E9LUP9	Lactobacillus_phage	0.0e+00	92.6
WP_016511011.1\|1426332_1426788_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	3.0e-79	96.7
WP_013355635.1\|1426978_1427230_-	hypothetical protein	NA	NA	NA	NA
WP_162045034.1\|1427247_1427517_-	hypothetical protein	NA	NA	NA	NA
WP_033098962.1\|1427522_1428035_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	4.0e-80	91.0
WP_060417938.1\|1428333_1429146_-	hypothetical protein	NA	NA	NA	NA
WP_013355640.1\|1429815_1430244_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.9e-63	82.4
WP_013355641.1\|1430518_1430827_-	hypothetical protein	E9LUN7	Lactobacillus_phage	3.2e-48	94.1
WP_013355642.1\|1430962_1431748_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	2.7e-144	98.1
WP_013355643.1\|1431747_1432545_-	hypothetical protein	Q9AZA0	Lactobacillus_prophage	4.2e-52	69.0
WP_033098960.1\|1432646_1432904_-	hypothetical protein	NA	NA	NA	NA
WP_003641371.1\|1433359_1433560_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_016511003.1\|1433562_1433811_-	hypothetical protein	E9LUT6	Lactobacillus_phage	2.3e-28	75.0
WP_003641369.1\|1433823_1434027_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641368.1\|1434192_1434483_+	hypothetical protein	NA	NA	NA	NA
WP_003644548.1\|1435076_1435337_-	hypothetical protein	NA	NA	NA	NA
WP_003644549.1\|1435394_1435751_+	hypothetical protein	NA	NA	NA	NA
WP_003644550.1\|1435747_1435951_-	hypothetical protein	NA	NA	NA	NA
WP_003644551.1\|1435961_1436714_-	phage repressor protein/antirepressor Ant	E9LUT0	Lactobacillus_phage	9.8e-59	97.3
WP_003644552.1\|1436726_1436942_-	hypothetical protein	NA	NA	NA	NA
WP_003641361.1\|1437198_1437525_+	helix-turn-helix transcriptional regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
WP_003641360.1\|1437555_1437945_+	ImmA/IrrE family metallo-endopeptidase	D6PSS8	Lactobacillus_phage	4.6e-36	54.3
WP_016511000.1\|1438007_1438886_+	hypothetical protein	A0A2H4J549	uncultured_Caudovirales_phage	3.0e-06	34.8
WP_003644554.1\|1438900_1439101_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.2e-25	97.0
WP_003644557.1\|1440442_1440700_+	hypothetical protein	A0A2P0ZL96	Lactobacillus_phage	1.0e-31	76.2
WP_003644558.1\|1440883_1441198_+	hypothetical protein	NA	NA	NA	NA
WP_016510998.1\|1441365_1442529_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	9.2e-56	36.5
1449466:1449483	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1724599 : 1769410

Lactobacillus_phage(75.68%)

portal,tail,capsid,holin,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644665.1\|1724599_1726330_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
WP_162045045.1\|1726553_1726946_-	YxeA family protein	NA	NA	NA	NA
WP_003644667.1\|1727168_1728020_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_104795830.1\|1729115_1729499_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	9.9e-15	83.7
WP_162045046.1\|1729485_1729782_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	1.5e-39	77.6
WP_162045047.1\|1729782_1730961_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	5.1e-195	87.8
WP_162045048.1\|1730972_1731218_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	4.7e-18	78.5
WP_162045049.1\|1731214_1732273_-	collagen-like protein	A0A2P0ZLF6	Lactobacillus_phage	6.7e-53	76.3
WP_162045050.1\|1732330_1734496_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_162045051.1\|1734473_1734767_-	hypothetical protein	NA	NA	NA	NA
WP_162045052.1\|1734759_1735878_-	hypothetical protein	O03938	Lactobacillus_phage	5.3e-194	91.4
WP_162045053.1\|1735890_1736700_-\|tail	phage tail family protein	D2KRB8	Lactobacillus_phage	1.3e-51	41.2
WP_162045054.1\|1736699_1741568_-	peptidoglycan DD-metalloendopeptidase family protein	O03937	Lactobacillus_phage	0.0e+00	64.4
WP_162045055.1\|1741571_1742195_-	hypothetical protein	O03936	Lactobacillus_phage	1.6e-102	94.9
WP_162045056.1\|1742200_1742632_-	hypothetical protein	O03935	Lactobacillus_phage	6.8e-73	96.5
WP_162045057.1\|1742684_1743200_-\|capsid	capsid protein	O03972	Lactobacillus_phage	2.5e-82	91.2
WP_162045058.1\|1743234_1743639_-\|capsid	minor capsid protein	O03934	Lactobacillus_phage	5.3e-67	97.0
WP_162045059.1\|1743638_1743986_-\|capsid	capsid protein	O03933	Lactobacillus_phage	7.5e-46	79.7
WP_162045060.1\|1743985_1744339_-\|capsid	capsid protein	O03932	Lactobacillus_phage	6.9e-55	89.7
WP_053339012.1\|1744335_1744764_-	hypothetical protein	NA	NA	NA	NA
WP_053339013.1\|1744790_1745846_-	hypothetical protein	O03966	Lactobacillus_phage	9.8e-198	99.1
WP_162045061.1\|1745862_1746477_-	hypothetical protein	O03931	Lactobacillus_phage	7.2e-68	86.3
WP_162045062.1\|1746578_1747721_-\|capsid	capsid protein	O03929	Lactobacillus_phage	5.3e-173	95.9
WP_162045063.1\|1747717_1749244_-\|portal	phage portal protein	O03928	Lactobacillus_phage	1.4e-250	83.9
WP_162045064.1\|1750341_1750851_-	hypothetical protein	Q37951	Lactococcus_phage	7.9e-52	61.2
WP_162045065.1\|1751414_1751933_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	1.2e-79	93.0
WP_064522742.1\|1751986_1752244_-	hypothetical protein	A0A0N9SKC5	Staphylococcus_phage	1.3e-15	47.6
WP_015380624.1\|1752366_1752564_-	hypothetical protein	NA	NA	NA	NA
WP_015380625.1\|1753458_1754076_+	hypothetical protein	NA	NA	NA	NA
WP_003642805.1\|1754340_1754802_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_162045066.1\|1755088_1755520_-	DUF1642 domain-containing protein	E9LUP3	Lactobacillus_phage	6.1e-37	57.6
WP_162045067.1\|1755879_1756371_-	class I SAM-dependent methyltransferase	O03918	Lactobacillus_phage	7.5e-84	89.3
WP_105316119.1\|1756455_1756671_-	helix-turn-helix transcriptional regulator	D2IZX1	Enterococcus_phage	6.1e-06	39.1
WP_064505709.1\|1756804_1756969_+	YjzC family protein	A0A0A7RTS6	Clostridium_phage	3.0e-13	66.0
WP_033611989.1\|1757235_1757619_-	endodeoxyribonuclease	NA	NA	NA	NA
WP_033611990.1\|1757615_1758134_-	hypothetical protein	O03915	Lactobacillus_phage	2.0e-34	50.0
WP_033611991.1\|1758130_1758418_-	hypothetical protein	NA	NA	NA	NA
WP_162045069.1\|1758414_1759323_-	DnaD domain protein	NA	NA	NA	NA
WP_033611993.1\|1759401_1760154_-	phage protein	A0A0P0IZH9	Lactobacillus_phage	2.4e-73	51.4
WP_162045070.1\|1760185_1761073_-	recombinase RecT	E9LUM3	Lactobacillus_phage	2.5e-61	47.4
WP_162045072.1\|1761069_1761507_-	hypothetical protein	NA	NA	NA	NA
WP_114693044.1\|1761784_1762072_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	4.3e-23	50.0
WP_162044941.1\|1762049_1762211_-	hypothetical protein	NA	NA	NA	NA
WP_162045073.1\|1762321_1762834_-	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	2.7e-28	43.5
WP_162045074.1\|1762900_1763206_-	DUF771 domain-containing protein	NA	NA	NA	NA
WP_011101083.1\|1763400_1763631_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162045076.1\|1763803_1764166_+	helix-turn-helix domain-containing protein	A0A0U4KKM4	Exiguobacterium_phage	2.0e-09	32.0
WP_003642784.1\|1764177_1764591_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_162045078.1\|1764616_1765963_+	DUF4041 domain-containing protein	A0A1B0Y697	Lactobacillus_phage	2.3e-82	52.9
WP_162045079.1\|1766012_1766546_+	hypothetical protein	NA	NA	NA	NA
WP_022638156.1\|1766609_1766807_-	hypothetical protein	NA	NA	NA	NA
WP_162045080.1\|1766789_1767362_+	hypothetical protein	NA	NA	NA	NA
WP_162045082.1\|1767348_1767780_+	hypothetical protein	A0A1Q1PVT2	Staphylococcus_phage	2.1e-05	25.9
WP_076636271.1\|1768447_1769410_+	AAA family ATPase	E9LUK9	Lactobacillus_phage	2.6e-35	38.7

DBSCAN-SWA_5

1971378 : 1979892

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065080107.1\|1971378_1971957_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.8e-21	33.9
WP_013355836.1\|1971949_1972975_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.4e-60	40.7
WP_003642591.1\|1972971_1974426_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003645864.1\|1974410_1976630_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_016511634.1\|1976622_1977300_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642588.1\|1977302_1977557_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_003642587.1\|1977558_1978290_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_011101896.1\|1978292_1979423_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642585.1\|1979406_1979892_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

DBSCAN-SWA_6

2823382 : 2883844

Streptococcus_phage(18.75%)

portal,tRNA,head,capsid,integrase,terminase

attL 2871673:2871712|attR 2876686:2876725

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011102289.1\|2823382_2825293_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_003641622.1\|2825311_2826703_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_011102290.1\|2826934_2827903_-	KH domain-containing protein	NA	NA	NA	NA
WP_011102291.1\|2828388_2829642_-	amidohydrolase family protein	NA	NA	NA	NA
WP_015826199.1\|2829774_2831412_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003641627.1\|2832126_2832960_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_003640224.1\|2832975_2833320_-	ribonuclease P protein component	NA	NA	NA	NA
WP_003640225.1\|2833430_2833565_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_003641628.1\|2834070_2835438_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003641629.1\|2835615_2836755_+	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	4.3e-13	29.9
WP_003641630.1\|2837279_2837513_+	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_003641631.1\|2837513_2838638_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003641632.1\|2838634_2840581_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	5.5e-146	46.7
WP_003641633.1\|2840745_2843307_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.8e-113	37.4
WP_003637271.1\|2843929_2844229_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_065080092.1\|2844265_2844868_+	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.8e-40	68.0
WP_003641635.1\|2844906_2845143_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_003643610.1\|2845323_2847336_+	DHH family phosphoesterase	NA	NA	NA	NA
WP_003641637.1\|2847348_2847801_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_003641638.1\|2847816_2849241_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	9.7e-124	53.1
WP_003641639.1\|2849462_2850686_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	2.4e-54	33.6
WP_003643611.1\|2850707_2851505_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-45	39.2
WP_003641641.1\|2851523_2852762_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.1e-110	52.9
WP_003641642.1\|2853222_2854839_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_162045182.1\|2855169_2857074_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_003641645.1\|2857063_2858203_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_162045183.1\|2858199_2859372_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_046947477.1\|2859364_2860804_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_003643612.1\|2860823_2863220_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.6e-09	42.9
WP_003641650.1\|2865386_2866154_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641651.1\|2866305_2866977_-	beta-phosphoglucomutase	NA	NA	NA	NA
WP_011100855.1\|2866994_2869715_-	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_003641653.1\|2870102_2870552_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_003643615.1\|2870749_2870950_+	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.6
WP_003641655.1\|2871041_2871266_+	hypothetical protein	NA	NA	NA	NA
2871673:2871712	attL	NA	NA	NA	NA
WP_162045184.1\|2871733_2872888_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	1.4e-59	36.7
WP_162045185.1\|2872949_2873654_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_041153480.1\|2873791_2873971_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162045186.1\|2874239_2874470_+	hypothetical protein	NA	NA	NA	NA
WP_162045187.1\|2874483_2875284_+	DNA replication protein	NA	NA	NA	NA
WP_162045188.1\|2875283_2876678_+	virulence protein	A0A1W6JQD6	Staphylococcus_phage	7.4e-68	40.0
WP_162045189.1\|2876778_2877258_+	hypothetical protein	NA	NA	NA	NA
2876686:2876725	attR	NA	NA	NA	NA
WP_162045190.1\|2877273_2877465_+	hypothetical protein	NA	NA	NA	NA
WP_162045191.1\|2877451_2877793_+\|head	phage head closure protein	NA	NA	NA	NA
WP_162045192.1\|2877785_2878175_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	44.7
WP_162045193.1\|2878889_2879363_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_162045194.1\|2879359_2881063_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	3.7e-122	40.7
WP_162045195.1\|2881217_2882318_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.6e-49	34.0
WP_162045196.1\|2882314_2883844_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	3.4e-42	25.1

DBSCAN-SWA_7

3177351 : 3226501

Bacillus_virus(50.0%)

bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643762.1\|3177351_3177915_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_024002428.1\|3178108_3178777_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
WP_003641930.1\|3178934_3180440_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_003643763.1\|3180704_3181073_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_003641932.1\|3181185_3181695_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_011100975.1\|3181725_3182922_-	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_003646440.1\|3183031_3183502_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011100976.1\|3183520_3183976_+	hypothetical protein	NA	NA	NA	NA
WP_003641936.1\|3184079_3184652_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
WP_011100977.1\|3184817_3185738_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
WP_162045213.1\|3185874_3186774_+	oxidoreductase	NA	NA	NA	NA
WP_011100979.1\|3187213_3189094_+	hypothetical protein	NA	NA	NA	NA
WP_011100980.1\|3189265_3189712_-	ribonuclease H	NA	NA	NA	NA
WP_003643770.1\|3189951_3191478_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
WP_003641941.1\|3191478_3192450_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
WP_003646444.1\|3192527_3193859_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003643773.1\|3194324_3195842_+	glycerol kinase GlpK	NA	NA	NA	NA
WP_003643774.1\|3195856_3197686_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
WP_021731937.1\|3197703_3198423_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
WP_044428967.1\|3200068_3203764_+	MucBP domain-containing protein	NA	NA	NA	NA
WP_162045223.1\|3205358_3205553_+	hypothetical protein	NA	NA	NA	NA
WP_011100983.1\|3205567_3205987_+	hypothetical protein	NA	NA	NA	NA
WP_011100984.1\|3206035_3206299_+	hypothetical protein	NA	NA	NA	NA
WP_011100985.1\|3206400_3206679_+	hypothetical protein	NA	NA	NA	NA
WP_015639936.1\|3207761_3207968_+	hypothetical protein	NA	NA	NA	NA
WP_074161480.1\|3208348_3208465_+	hypothetical protein	NA	NA	NA	NA
WP_011100986.1\|3208588_3209506_+	hypothetical protein	NA	NA	NA	NA
WP_016526893.1\|3209512_3209686_+	hypothetical protein	NA	NA	NA	NA
WP_011100987.1\|3210230_3210773_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011100988.1\|3210787_3211051_+	hypothetical protein	NA	NA	NA	NA
WP_003643788.1\|3211167_3211371_+	hypothetical protein	NA	NA	NA	NA
WP_003646452.1\|3211495_3211735_+	hypothetical protein	NA	NA	NA	NA
WP_003646453.1\|3211752_3212139_+	hypothetical protein	NA	NA	NA	NA
WP_157951538.1\|3212982_3213129_+	glycohydrolase toxin TNT-related protein	NA	NA	NA	NA
WP_011100990.1\|3213205_3213613_+	hypothetical protein	NA	NA	NA	NA
WP_011100991.1\|3214883_3215162_+	hypothetical protein	NA	NA	NA	NA
WP_003641962.1\|3215488_3216106_-	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003641963.1\|3216109_3217264_-	MFS transporter	NA	NA	NA	NA
WP_011100993.1\|3217267_3218059_-	HAD family hydrolase	NA	NA	NA	NA
WP_003641965.1\|3218129_3219002_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_162045214.1\|3219161_3219977_+	HAD family phosphatase	NA	NA	NA	NA
WP_011100994.1\|3220502_3221879_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
WP_011100995.1\|3221923_3223108_+	cation:proton antiporter	NA	NA	NA	NA
WP_003641969.1\|3223492_3223696_+	hypothetical protein	NA	NA	NA	NA
WP_003641971.1\|3224107_3224776_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641972.1\|3224772_3224946_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
WP_003641973.1\|3224976_3225144_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
WP_003641974.1\|3226005_3226206_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003641975.1\|3226333_3226501_+\|bacteriocin	bacteriocin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP048024

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048024_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048024_1

5302-5439

Orphan

Consensus_repeat	Method
ATTACTGGCTGTATTACT	CRT

3 spacers

csa3

The CRISPR arrays of NZ_CP048024_1

>merge|NZ_CP048024|1|5302-5439|CRT
ATTACTGGCTGTATTACTGGCTGTATTACTGACTGTATTACTGGCTGTATTACTGGCTGTATTACTGGCTGTATTACTGACTGTATTACTGGCTGTATTACTGGCTGTATTACTGGCTGTATTACTGGCTGTATTACT

>NZ_CP048024|1|1|5302-5439|CRT
ATTACTGGCTGTATTACT	GGCTGTATTACTGACTGT
ATTACTGGCTGTATTACT	GGCTGTATTACTGGCTGTATTACTGACTGT
ATTACTGGCTGTATTACT	GGCTGTATTACTGGCTGT
ATTACTGGCTGTATTACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048024.1\|WP_015474755.1\|14179_15778_-\|APC-family-permease	unknown	unknown	gnl\|CDD\|223605
NZ_CP048024.1\|WP_027822610.1\|1354_2017_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238089
NZ_CP048024.1\|WP_046811125.1\|17298_17886_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP048024.1\|WP_027822949.1\|5927_6257_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048024.1\|WP_024002725.1\|6293_7139_-\|PTS-system-mannose/fructose/sorbose-family-transporter-subunit-IID	unknown	unknown	gnl\|CDD\|377079
NZ_CP048024.1\|WP_027822950.1\|7141_7990_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|377077
NZ_CP048024.1\|WP_072534732.1\|9201_11730_+\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226443
NZ_CP048024.1\|WP_004271307.1\|13048_13972_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP048024.1\|WP_022638613.1\|8023_8518_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|377139
NZ_CP048024.1\|WP_022638614.1\|8533_8968_-\|phosphotransferase-system,-mannose/fructose-specific-component-IIA	unknown	unknown	gnl\|CDD\|237978
NZ_CP048024.1\|WP_027822611.1\|934_1219_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP048024.1\|WP_072534733.1\|12327_12882_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737

Protein	Function_ID	Function_description	E-value
NZ_CP048024.1\|WP_015474755.1\|14179_15778_-\|APC-family-permease	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	3.63472e-47
NZ_CP048024.1\|WP_024002725.1\|6293_7139_-\|PTS-system-mannose/fructose/sorbose-family-transporter-subunit-IID	gnl\|CDD\|377079	pfam03613, EIID-AGA, PTS system mannose/fructose/sorbose family IID component.	4.6683e-106
NZ_CP048024.1\|WP_027822950.1\|7141_7990_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|377077	pfam03609, EII-Sor, PTS system sorbose-specific iic component.	2.49155e-58
NZ_CP048024.1\|WP_072534732.1\|9201_11730_+\|PRD-domain-containing-protein	gnl\|CDD\|226443	COG3933, COG3933, Transcriptional antiterminator [Transcription].	9.10965e-39
NZ_CP048024.1\|WP_004271307.1\|13048_13972_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	9.31909e-77
NZ_CP048024.1\|WP_022638613.1\|8023_8518_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|377139	pfam03830, PTSIIB_sorb, PTS system sorbose subfamily IIB component.	1.19632e-42
NZ_CP048024.1\|WP_022638614.1\|8533_8968_-\|phosphotransferase-system,-mannose/fructose-specific-component-IIA	gnl\|CDD\|237978	cd00006, PTS_IIA_man, PTS_IIA, PTS system, mannose/sorbose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIA PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation. IIA subunits receive phosphoryl groups from HPr and transfer them to IIB subunits, which in turn phosphorylate the substrate.	1.17271e-18
NZ_CP048024.1\|WP_046811125.1\|17298_17886_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	2.38795e-44
NZ_CP048024.1\|WP_027822611.1\|934_1219_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	6.56657e-14
NZ_CP048024.1\|WP_027822610.1\|1354_2017_-\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	8.28982e-21
NZ_CP048024.1\|WP_072534733.1\|12327_12882_-\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	6.90975e-54

>NZ_CP048024.1|WP_027822610.1|1354_2017_-|metalloregulator-ArsR/SmtB-family-transcription-factor
MYEEAIEYKDSLYKELSRIGKSLGSDRRLEILDLLIQAPKSVEEISKELKISVANTSRHLQVLRDSHLVKTERDGNRIIYSLSSPLITKLIQLLTDIGENELSEMKVIQHKATTSENVKSISLEQALKSYKNGLLLDVRPQDEYQEGHINSAINIPLDTLSDHLTELPKNRQIIVYCRGRLCGNSNIATQLLNNNGYNALSLNYSYYDWKRALKCINEKK
>NZ_CP048024.1|WP_027822611.1|934_1219_-|thioredoxin-family-protein
MVKLDIPKLKMLVFENDWCAQCYTERPIIHRLAIKYHDQLEVEVLNADNNPLMVKKYNVLTAPSIILIKNDEMVERISRFIDQNQLETVIRYYL
>NZ_CP048024.1|WP_027822949.1|5927_6257_-|hypothetical-protein
MTIQEMKTGYEEEVAYQKHMLKNLGYWIQLGTVTSGIGIVISYLYHQNLWLYILGISLFILGALLTITFSYVGWKGQQNIRAVVDDYDQKIKYFQKKVRQQTGITPKVK
>NZ_CP048024.1|WP_024002725.1|6293_7139_-|PTS-system-mannose/fructose/sorbose-family-transporter-subunit-IID
MDKINSHNQLDQKTLTKSFHRWFWGALTCFSQEHMQTFGYMASMLPILRKLYPKHEDQVKAIKAYTAFFNTNPMLGTVIVGITASMEQARADGKEIDGETINDMRAGLMGPIAGIGDSLIDGTLIPILLGISLGMSSGGSPLGAIFYIIAWVLIAYFGQRFLYFRGYKFGDQAVSFLVGKQGAAVRHAIGTVGSMVVGGVLASWVSVTTSLKLTGANGKVFLNLQDKLDSIYPGLLTVAVTFFCWWLMTKKHVSAIWTMLILVVIALVGVLVGFFNPGLSY
>NZ_CP048024.1|WP_027822950.1|7141_7990_-|PTS-sugar-transporter-subunit-IIC
MTISWLQAALLGLFACLCSNSCMAGQAVGNYTIGRPLVGGLVCGIILGNLQLGIACGVAMQLVYIALVTPGGTVSADVRAISYIGIPLAMVAIASQGLNPLGGSAANLAKSVGTLVGTVGTVLYYAVATMNLVWQSFGWKDVHSGKLDKLTAVNFGWPWISHAIFSFLPTMLLTYYGATAVTALRNALPMDGIAMKTLFTVGGMLPCVGIAILLRQIIGRAADFIPFLVGFTLAASLKLNLVSVTVISLLFAVIMYEVEMAKTSGSEAVTDGPSNSDDEEDI
>NZ_CP048024.1|WP_022638613.1|8023_8518_-|PTS-sugar-transporter-subunit-IIB
MAISFVRIDDRMIHGLITVRWGKEYPCDGIIAVNDKAANNAILAEAYKAASDKKTFVWTLDHFNQVRDKVLSSETKYFLITKNPQDMKTILVDMNFKPGDIKTIIVGPGNDREGAIKLGDNQSFTQSEGDAFEAIEKNGYNVEFALLPDQRLGGWNKFKSRFGY
>NZ_CP048024.1|WP_022638614.1|8533_8968_-|phosphotransferase-system,-mannose/fructose-specific-component-IIA
MKYLLLISHGDFSNGLKQTLSMFAGDATNTVISIGLKPDEAIDTLDKRIDTTMKPIPENSQFVILADIIGGSPLTTVCNVLNRQKKFNDSIIIGGMNFPMALTAMMFKDSLDNIELKSKLLSEATKAIRPLDMNGILKPSDEDI
>NZ_CP048024.1|WP_072534732.1|9201_11730_+|PRD-domain-containing-protein
MNAIEKLYAVIAQQFPNVRITTNQAAHAIGLTRGVTSSYLSKLEKQGRLEKSGSRPVYWQIKHRKNAFDNLIGSYGSLKSNIKNAIGAIVYPSHGLPVLITGSHGTGKLLFAHAIYNEAIRRKILTEKAIFKLIDCEDYQNQLNVLKRELKTISAQSNKIKSEDSYVCIKNLQTFKPVDQHGLFTYIMQQPDSTVRYIFSTTNTNLSLQDNIYLKNAMVRIDLLDLDSRPFHEKVAFIIMFLQQQADQINKKILISPSELIKLAKLRQADNIRGLQNTIKLLVASAYARSLKMNQLVIGLDVNHAISIIPNQNLLQTSITRVVNNILQLNSNSHTLLAKLTDSLGHSESITEQNFYVLKVLKQVSVITNEPVLISLAPTFQEAVQKYITTPYGINFPQNSNFWNQVALAFIYANLCSINLPDDEQSSKLQEALRNHYPRSYYLFKKLLTKIEPQYVKNSYHYLPFFILMASSTDKIESVHYNAILLAHGEQTASSIQQIANTLCGNYFFEAFNMPIDISLGEINTYVCNYLSEQGDSAKGNIVLFDMGSLHQMFKEIKKVSDQELLVVNNITTAMALDIGLQIQRNEPFLAIAEASQKYGATTDSQYYEGLSNKQNIIVSCMSGVGLSKELKKLIQTTLSSSLEIIALDYKQLHNLLINQDHQFFSKTKLILTTTDINHDLDIEIINVYSIFDKNTSLKLQSILLSIGESYEACKLLIDRLLQFLSIEGIRGRLQILNPNIVIEDSQDIVTHYENFYDVKFNPRLKLNLYMHLSLMIERMIMNHTSSDNLIKKMAMTSQERDFFTLSNGIFKPIEKKFNIEIQPYEIELIYQLIKDFIKNKN
>NZ_CP048024.1|WP_072534733.1|12327_12882_-|recombinase-family-protein
MKYGYARVSTTDQKLANQIELLKLAGAEKIFQEKFTGTTTERPEFQKLLRVLKTGDTLIVTKLDRFARNTREALAIIQELFKENVKVNILNMGLIDNTPTGQLVFTIFSAFAQFERDMIVTRTQEGKLYAKQHDPLFREGRPKTYSEEQIKFAYELRQQGMTYKMIERKTGISKRTQQRRFKLI
>NZ_CP048024.1|WP_004271307.1|13048_13972_-|IS30-family-transposase
MSTTILSFQNRVVIETLHNEGRSLRYIANYLGFSKTTIFNELHRLNSEYQAGLAQTDFERKVSQRGRKSSLTKNLKHLIEEKIQVQKWSPEQVAHVVGIAYKTVYNWIDQGWLDIQLPDLPDHGIRRHRAKEKRGTFNHGRSIEERPHKVETRQEFGHFEADTVLSGKRKGQAVATFVERKSRLTIVKRLHGRDSQSMTQAVLELASQLQDKLKTLTVDHGKEFANYQTIERRTGTQVYFAHAYSPHERGSNENRNRVLRRFIPKGQAIEELSDHQLVQINWYLNSRPLKCLNWHTPIEIFLLNLRH
>NZ_CP048024.1|WP_015474755.1|14179_15778_-|APC-family-permease
MDSDKTTKIGLFQLVMLTLGSLIGSGWLFGSWEASKIAGPAAIISWVIGGAVIAAIAYDYVELGAMFPEAGGMSRYAQYSHGPLLGFISSWANWISLITLIPIEAVAAVQYMSSWPWSWANWTHQFLKNGTITTAGLMVVFLFMLVFTLLNFWSVKILTSFTSLISVFKIGVPTLTIIMLTIASFHPENYGHSLHEFMPYGSAPIFAATSSAGIIFSFNAFQTVINMGSEIENPNKNIGHGIFISLLISGIIYIVLQSVFITAIKPSAVAAHGWSGINFNSPFADLAIMLGIRWLSVLLYMDAFVSPVGTGVSFAASTGRALYAMESNQRIPSFVGKINQKYGIPRVAMIVNLVLSMLMVSVFRSWATLATVICTSTLIAYLTGPVTAVAFRKLAPDFKRPVKLKHLNWMAPLSFVLASLAVYWAMWPTTVEVILVILLGLPFYFYYEYRAGYVNTRKAFWSSMWMIFYLIFISIMSYIGSHQFNGINWIPYPWDFVVIIIASLGFYYWGIKSAHVFPDFYQAKELNDTVKE
>NZ_CP048024.1|WP_046811125.1|17298_17886_-|recombinase-family-protein
MAKIGYARVSSKEQHLDRQLAALKDVDKLFTDKLSGANTNRPELQKMLAYIREGDIVLVTELDRLGRNNHDLTKIMNSIQNKGATLDVLNLPSMTGIADPNLRQLMTNLIIELYKYQAESERKRIIERQQQGISLAKQQGKYHGRKPQYTQDDPRLQHAFKLYRAGMSDIDVSRNTGIKRTTFIRYRVKYGIKRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP048024_1	1.3\|5404\|18\|NZ_CP048024\|CRT	5404-5421	18	NZ_CP048024.1	5296-5313	0	1.0
NZ_CP048024_1	1.3\|5404\|18\|NZ_CP048024\|CRT	5404-5421	18	NZ_CP048024.1	5428-5445	0	1.0
NZ_CP048024_1	1.1\|5320\|18\|NZ_CP048024\|CRT	5320-5337	18	NZ_CP048024.1	5296-5313	1	0.944
NZ_CP048024_1	1.1\|5320\|18\|NZ_CP048024\|CRT	5320-5337	18	NZ_CP048024.1	5428-5445	1	0.944
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024.1	5296-5325	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024.1	5416-5445	1	0.967

1. spacer 1.3|5404|18|NZ_CP048024|CRT matches to position: 5296-5313, mismatch: 0, identity: 1.0

ggctgtattactggctgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
******************

2. spacer 1.3|5404|18|NZ_CP048024|CRT matches to position: 5428-5445, mismatch: 0, identity: 1.0

ggctgtattactggctgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
******************

3. spacer 1.1|5320|18|NZ_CP048024|CRT matches to position: 5296-5313, mismatch: 1, identity: 0.944

ggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
*************.****

4. spacer 1.1|5320|18|NZ_CP048024|CRT matches to position: 5428-5445, mismatch: 1, identity: 0.944

ggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
*************.****

5. spacer 1.2|5356|30|NZ_CP048024|CRT matches to position: 5296-5325, mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

6. spacer 1.2|5356|30|NZ_CP048024|CRT matches to position: 5416-5445, mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47187-47216	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26602-26631	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36733-36762	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	340-369	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9557-9586	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45395-45424	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35286-35315	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	79-108	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	127-156	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58157-58186	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	801-830	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16156-16185	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16204-16233	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76611-76640	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76659-76688	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21645-21674	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21717-21746	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5308-5337	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5356-5385	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61350-61379	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48802-48831	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37917-37946	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23050-23079	0	1.0
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47163-47192	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47175-47204	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47223-47252	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47235-47264	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47247-47276	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47259-47288	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47271-47300	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47283-47312	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47295-47324	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47307-47336	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26590-26619	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26638-26667	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26650-26679	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26662-26691	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26674-26703	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26686-26715	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26698-26727	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26710-26739	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26722-26751	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36721-36750	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36769-36798	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36781-36810	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36793-36822	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36805-36834	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36817-36846	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36829-36858	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36841-36870	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36853-36882	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	292-321	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	304-333	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	352-381	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	364-393	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9436-9465	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9485-9514	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9509-9538	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9521-9550	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9569-9598	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9581-9610	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45383-45412	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45431-45460	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45443-45472	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45455-45484	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45467-45496	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45479-45508	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45491-45520	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45503-45532	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45515-45544	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35226-35255	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35238-35267	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35250-35279	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35298-35327	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35310-35339	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35322-35351	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35334-35363	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35346-35375	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	31-60	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	43-72	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	55-84	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	67-96	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	115-144	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	57989-58018	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58001-58030	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58013-58042	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58025-58054	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58037-58066	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58049-58078	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58061-58090	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58073-58102	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58085-58114	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58097-58126	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58109-58138	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58121-58150	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58169-58198	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	741-770	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	753-782	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	765-794	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	813-842	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	825-854	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	837-866	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	849-878	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	861-890	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16144-16173	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16192-16221	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76599-76628	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76647-76676	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21597-21626	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21609-21638	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21621-21650	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21633-21662	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21669-21698	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21705-21734	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21753-21782	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5296-5325	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5344-5373	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5392-5421	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5404-5433	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5416-5445	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61362-61391	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48694-48723	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48706-48735	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48718-48747	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48730-48759	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48742-48771	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48754-48783	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48766-48795	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48814-48843	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48826-48855	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37893-37922	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37929-37958	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37941-37970	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37953-37982	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23062-23091	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23074-23103	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23086-23115	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19441-19470	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19453-19482	1	0.967
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47151-47180	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47199-47228	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47211-47240	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26578-26607	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26614-26643	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26626-26655	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36709-36738	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36745-36774	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36757-36786	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	280-309	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	316-345	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	328-357	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	376-405	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	400-429	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9448-9477	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9497-9526	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9533-9562	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9545-9574	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45371-45400	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45407-45436	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45419-45448	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35262-35291	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35274-35303	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35358-35387	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	163-192	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	19-48	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	91-120	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	103-132	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	139-168	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	151-180	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58133-58162	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58145-58174	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	58181-58210	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	777-806	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	789-818	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	873-902	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16240-16269	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76695-76724	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16108-16137	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16132-16161	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16168-16197	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16180-16209	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16216-16245	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16228-16257	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76563-76592	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76587-76616	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76623-76652	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76635-76664	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76671-76700	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76683-76712	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21585-21614	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21657-21686	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21681-21710	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21693-21722	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21729-21758	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21741-21770	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5284-5313	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5320-5349	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5332-5361	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5368-5397	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5380-5409	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61314-61343	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61326-61355	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61338-61367	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61374-61403	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48778-48807	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48790-48819	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48838-48867	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37881-37910	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37905-37934	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37965-37994	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23038-23067	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23098-23127	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19429-19458	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19405-19434	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19417-19446	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19465-19494	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP015919	Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence	32332-32361	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP015919	Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence	32344-32373	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP015919	Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence	32356-32385	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24445-24474	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24457-24486	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24481-24510	2	0.933
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028227	Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence	47319-47348	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	26734-26763	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP025691	Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence	36865-36894	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	388-417	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9424-9453	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	9473-9502	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP024060	Lactobacillus plantarum strain KACC 92189 plasmid unnamed2	45527-45556	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35214-35243	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	35370-35399	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	7-36	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023303	Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence	57977-58006	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	729-758	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	885-914	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	16120-16149	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	76575-76604	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21765-21794	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	21573-21602	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP048024	Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence	5428-5457	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	61386-61415	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028276	Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence	48682-48711	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035152	Pediococcus acidilactici strain SRCM103367 plasmid unnamed1	19393-19422	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP015919	Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence	32368-32397	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24433-24462	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24469-24498	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	24493-24522	3	0.9
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	37869-37898	4	0.867
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	23026-23055	4	0.867
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP023040	Komagataeibacter saccharivorans strain CV1 plasmid unnamed4, complete sequence	34579-34608	7	0.767
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	KF302035	UNVERIFIED: Pseudoalteromonas phage HS6, complete genome	7303-7332	7	0.767
NZ_CP048024_1	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	NZ_CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	1-24	9	0.7

1. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

2. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

3. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

4. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

5. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

6. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

7. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

8. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

9. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

10. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

11. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

12. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

13. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

14. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

15. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

16. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

17. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

18. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

19. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

20. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

21. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

22. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

23. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgactgt	Protospacer
******************************

24. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

25. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

26. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

27. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

28. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

29. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

30. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

31. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

32. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

33. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

34. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

35. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

36. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

37. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

38. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

39. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

40. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

41. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

42. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

43. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

44. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

45. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

46. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

47. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

48. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

49. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

50. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

51. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

52. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

53. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

54. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

55. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

56. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

57. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
gtctgtattactggctgtattactgactgt	Protospacer
* ****************************

58. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactgtctgt	Protospacer
************************* ****

59. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

60. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

61. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

62. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

63. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

64. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

65. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

66. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

67. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

68. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

69. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

70. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

71. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

72. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

73. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

74. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

75. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

76. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

77. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

78. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

79. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

80. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

81. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

82. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

83. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

84. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

85. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

86. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

87. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

88. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

89. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

90. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

91. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

92. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

93. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

94. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

95. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

96. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

97. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

98. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

99. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

100. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

101. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

102. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

103. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

104. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

105. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

106. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

107. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

108. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

109. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

110. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

111. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

112. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

113. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactgactgt	Protospacer
*.****************************

114. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

115. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

116. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

117. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

118. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

119. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

120. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

121. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

122. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

123. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

124. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

125. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

126. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

127. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

128. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

129. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

130. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

131. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactgactgt	Protospacer
*.****************************

132. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

133. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

134. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

135. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

136. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

137. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

138. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

139. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 1, identity: 0.967

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

140. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

141. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

142. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

143. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

144. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

145. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

146. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

147. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

148. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

149. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctga	Protospacer
*************************.***

150. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

151. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

152. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

153. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactgactgt	Protospacer
*.***********.****************

154. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
tgctgtattactggctgtattactggctgt	Protospacer
 ************************.****

155. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgtctgtattactggctgt	Protospacer
************* ***********.****

156. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

157. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

158. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

159. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

160. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

161. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

162. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

163. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

164. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctga	Protospacer
*************************.***

165. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

166. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

167. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

168. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

169. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

170. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

171. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

172. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

173. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

174. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

175. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

176. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctga	Protospacer
*************************.***

177. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctga	Protospacer
*************************.***

178. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactgactgt	Protospacer
*.***********.****************

179. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

180. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

181. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

182. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

183. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

184. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactgactgt	Protospacer
*.***********.****************

185. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

186. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

187. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

188. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

189. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

190. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

191. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

192. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

193. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

194. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

195. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

196. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

197. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

198. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

199. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

200. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

201. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctga	Protospacer
*************************.***

202. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

203. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

204. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

205. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

206. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

207. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

208. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

209. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

210. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

211. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactgactgtattactggctgt	Protospacer
*************.***********.****

212. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

213. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgc	Protospacer
*************************.***.

214. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgcattactggctgtattactggctgt	Protospacer
*****.*******************.****

215. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgcattactggctgt	Protospacer
*****************.*******.****

216. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggctgt	Protospacer
*.***********************.****

217. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP015919 (Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgc	Protospacer
*************************.***.

218. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP015919 (Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgcattactggctgt	Protospacer
*****************.*******.****

219. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP015919 (Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgcattactggctgtattactggctgt	Protospacer
*****.*******************.****

220. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgcattactggctgtattactggctgt	Protospacer
*****.*******************.****

221. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgcattactggctgt	Protospacer
*****************.*******.****

222. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 2, identity: 0.933

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgcattactggctgt	Protospacer
*****************.*******.****

223. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028227 (Lactobacillus plantarum strain SRCM101187 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

224. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

225. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP025691 (Lactobacillus plantarum strain IRG1 plasmid pIRG101, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

226. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

227. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

228. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactg-actgt	CRISPR spacer
ggctgtattactgactgtattactgtgctg-	Protospacer
*************.*********** .***

229. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP024060 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed2) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

230. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

231. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

232. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

233. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023303 (Lactobacillus plantarum strain pc-26 plasmid p.pc-2602, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

234. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

235. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

236. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

237. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

238. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

239. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

240. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 (Lactobacillus plantarum strain CACC 558 plasmid p2CACC558, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

241. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactgactgtattactggctgt	Protospacer
*.***********.***********.****

242. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028276 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

243. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035152 (Pediococcus acidilactici strain SRCM103367 plasmid unnamed1) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

244. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP015919 (Pediococcus pentosaceus strain wikim20 plasmid pKPP01, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

245. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggatga	Protospacer
*************************. **

246. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgcattactggctgtattactggctgc	Protospacer
*****.*******************.***.

247. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 3, identity: 0.9

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgcattactggctgtattactggctgc	Protospacer
*****.*******************.***.

248. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.867

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggatga	Protospacer
*.***********************. **

249. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 4, identity: 0.867

ggctgtattactggctgtattactgactgt	CRISPR spacer
gactgtattactggctgtattactggatga	Protospacer
*.***********************. **

250. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP023040 (Komagataeibacter saccharivorans strain CV1 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtatgactggctgtattgcccgatgg	Protospacer
******** ************.*. . **

251. spacer 1.2|5356|30|NZ_CP048024|CRT matches to KF302035 (UNVERIFIED: Pseudoalteromonas phage HS6, complete genome) position: , mismatch: 7, identity: 0.767

ggctgtattactggctgtattactgactgt	CRISPR spacer
tgctgtgttactggttgtattactttgtga	Protospacer
 *****.*******.*********   **

252. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP035159 (Lactobacillus plantarum strain SRCM103362 plasmid unnamed3) position: , mismatch: 9, identity: 0.7

ggctgtattactggctgtattactgactgt	CRISPR spacer
------ttgactgactgtattactgactgt	Protospacer
       * ****.****************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5736

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822611.1\|934_1219_-	thioredoxin family protein	NA	NA	NA	NA
WP_027822610.1\|1354_2017_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_162045227.1\|2367_5736_-	beta-fructosidase	F8WPR5	Bacillus_phage	7.6e-34	26.7

DBSCAN-SWA_2

12327 : 13972

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072534733.1\|12327_12882_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.5e-32	44.6
WP_004271307.1\|13048_13972_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-33	31.9

DBSCAN-SWA_3

17298 : 17886

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046811125.1\|17298_17886_-	recombinase family protein	M4QQC6	Vibrio_phage	5.9e-19	42.4

DBSCAN-SWA_4

24698 : 26834

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162045228.1\|24698_26834_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	2.9e-108	46.4

DBSCAN-SWA_5

34652 : 44662

Enterococcus_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027822893.1\|34652_35555_+	AAA family ATPase	F0PIG8	Enterococcus_phage	4.1e-27	32.1
WP_016526748.1\|35541_35811_+	hypothetical protein	NA	NA	NA	NA
WP_027822894.1\|36048_36360_-	hypothetical protein	NA	NA	NA	NA
WP_027822895.1\|36473_37775_+	Y-family DNA polymerase	M1Q231	Streptococcus_phage	6.4e-82	40.0
WP_027822896.1\|37767_38088_+	hypothetical protein	NA	NA	NA	NA
WP_027822897.1\|38080_38479_+	hypothetical protein	NA	NA	NA	NA
WP_027822898.1\|38551_38875_-	hypothetical protein	NA	NA	NA	NA
WP_080280605.1\|39228_40263_+\|transposase	IS30 family transposase	A0A2K9V2S9	Faecalibacterium_phage	1.8e-42	34.4
WP_111443464.1\|40645_41062_-	OsmC family protein	NA	NA	NA	NA
WP_010495033.1\|41079_41517_-	OsmC family protein	NA	NA	NA	NA
WP_027822617.1\|41653_42094_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_027822616.1\|42120_42483_+	hypothetical protein	NA	NA	NA	NA
WP_027822615.1\|42988_44326_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-19	23.5
WP_064972126.1\|44347_44662_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.8e-15	32.7

Anti-CRISPR protein detection

Acr_ID: NZ_CP048024.1|WP_027822611.1|934_1219_-|thioredoxin-family-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP048024.1|WP_027822611.1|934_1219_-|thioredoxin-family-protein

934_1219_-

94 aa aa

0-5736

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP048024_1	Orphan	1.1\|5320\|18\|NZ_CP048024\|CRT	5320-5337	18	5296-5313	1
NZ_CP048024_1	Orphan	1.3\|5404\|18\|NZ_CP048024\|CRT	5404-5421	18	5296-5313	0
NZ_CP048024_1	Orphan	1.1\|5320\|18\|NZ_CP048024\|CRT	5320-5337	18	5428-5445	1
NZ_CP048024_1	Orphan	1.3\|5404\|18\|NZ_CP048024\|CRT	5404-5421	18	5428-5445	0
NZ_CP048024_1	Orphan	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	5296-5325	1
NZ_CP048024_1	Orphan	1.2\|5356\|30\|NZ_CP048024\|CRT	5356-5385	30	5416-5445	1

1. spacer 1.1|5320|18|NZ_CP048024|CRT matches to NZ_CP048024 position: 5296-5313, mismatch: 1

ggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
*************.****

2. spacer 1.3|5404|18|NZ_CP048024|CRT matches to NZ_CP048024 position: 5296-5313, mismatch: 0

ggctgtattactggctgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
******************

3. spacer 1.1|5320|18|NZ_CP048024|CRT matches to NZ_CP048024 position: 5428-5445, mismatch: 1

ggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
*************.****

4. spacer 1.3|5404|18|NZ_CP048024|CRT matches to NZ_CP048024 position: 5428-5445, mismatch: 0

ggctgtattactggctgt	CRISPR spacer
ggctgtattactggctgt	Protospacer
******************

5. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 position: 5296-5325, mismatch: 1

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

6. spacer 1.2|5356|30|NZ_CP048024|CRT matches to NZ_CP048024 position: 5416-5445, mismatch: 1

ggctgtattactggctgtattactgactgt	CRISPR spacer
ggctgtattactggctgtattactggctgt	Protospacer
*************************.****

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048023

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP048022

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP048024

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information