CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP048021	Virgibacillus sp. MSP4-1 chromosome, complete genome	2 crisprs	csa3,cas3,DEDDh,DinG	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048021_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048021_1

2309473-2309580

Orphan

Consensus_repeat	Method
AGATTAATTCTGTTATATTTGGATGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048021_1

>merge|NZ_CP048021|1|2309473-2309580|CRISPRCasFinder
AGATTAATTCTGTTATATTTGGATGAAATACTCTAATTCCGGCTGAATCAGGTCATTTCCGGATCAATCCTTCCCTCTTCCAGATGAATTCTGTTATATTTGGATGAA

>NZ_CP048021|1|1|2309473-2309580|CRISPRCasFinder
AGATTAATTCTGTTATATTTGGATGAA	ATACTCTAATTCCGGCTGAATCAGGTCATTTCCGGATCAATCCTTCCCTCTTCC
AGATGAATTCTGTTATATTTGGATGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048021.1\|WP_044162347.1\|2311347_2311671_-\|DNA-directed-RNA-polymerase-subunit-beta	unknown	unknown	gnl\|CDD\|378713
NZ_CP048021.1\|WP_044162362.1\|2320821_2321796_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NZ_CP048021.1\|WP_044162360.1\|2319345_2320584_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP048021.1\|WP_044162775.1\|2297292_2298171_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP048021.1\|WP_052330436.1\|2299632_2302038_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119353
NZ_CP048021.1\|WP_044162332.1\|2298167_2299508_-\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|223936
NZ_CP048021.1\|WP_044162329.1\|2295690_2296089_+\|glycerol-3-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|173922
NZ_CP048021.1\|WP_044162359.1\|2317356_2319021_+\|DASS-family-sodium-coupled-anion-symporter	unknown	unknown	gnl\|CDD\|273267
NZ_CP048021.1\|WP_162038878.1\|2308971_2309364_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227596
NZ_CP048021.1\|WP_044162338.1\|2306568_2307432_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP048021.1\|WP_044162350.1\|2311730_2312540_-\|flagellar-hook-basal-body-protein	unknown	unknown	gnl\|CDD\|227125
NZ_CP048021.1\|WP_044162780.1\|2310804_2311227_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	unknown	unknown	gnl\|CDD\|234568
NZ_CP048021.1\|WP_044162334.1\|2302156_2303263_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
NZ_CP048021.1\|WP_044162355.1\|2313410_2314409_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP048021.1\|WP_044162341.1\|2308161_2308665_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368849
NZ_CP048021.1\|WP_044162336.1\|2303466_2306568_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP048021.1\|WP_044162353.1\|2312553_2313381_-\|flagellar-hook-basal-body-protein	unknown	unknown	gnl\|CDD\|227125
NZ_CP048021.1\|WP_044162363.1\|2322065_2323031_-\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
NZ_CP048021.1\|WP_044162357.1\|2315271_2315538_-\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP048021.1\|WP_044162330.1\|2296081_2297287_+\|teichoic-acid-biosynthesis-protein-B	unknown	unknown	gnl\|CDD\|367953

Protein	Function_ID	Function_description	E-value
NZ_CP048021.1\|WP_044162347.1\|2311347_2311671_-\|DNA-directed-RNA-polymerase-subunit-beta	gnl\|CDD\|378713	pfam11772, EpuA, DNA-directed RNA polymerase subunit beta. This short 60-residue long bacterial family is the beta subunit of the DNA-directed RNA polymerase, likely to be EC:2.7.7.6. It is membrane-bound and is referred to by the name EpuA.	5.05085e-23
NZ_CP048021.1\|WP_044162362.1\|2320821_2321796_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	1.29893e-26
NZ_CP048021.1\|WP_044162360.1\|2319345_2320584_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.1797e-66
NZ_CP048021.1\|WP_044162775.1\|2297292_2298171_-\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	5.79911e-171
NZ_CP048021.1\|WP_052330436.1\|2299632_2302038_-\|SH3-domain-containing-protein	gnl\|CDD\|119353	cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.	7.64158e-74
NZ_CP048021.1\|WP_044162332.1\|2298167_2299508_-\|UDP-glucose/GDP-mannose-dehydrogenase-family-protein	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0
NZ_CP048021.1\|WP_044162329.1\|2295690_2296089_+\|glycerol-3-phosphate-cytidylyltransferase	gnl\|CDD\|173922	cd02171, G3P_Cytidylyltransferase, glycerol-3-phosphate cytidylyltransferase. Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase.	2.24506e-76
NZ_CP048021.1\|WP_044162359.1\|2317356_2319021_+\|DASS-family-sodium-coupled-anion-symporter	gnl\|CDD\|273267	TIGR00785, Uncharacterized_transporter_HI_0020, anion transporter. The Divalent Anion:Na+ Symporter (DASS) Family (TC 2.A.47) Functionally characterized proteins of the DASS family transport (1) organic di- and tricarboxylates of the Krebs Cycle as well as dicarboxylate amino acid, (2) inorganic sulfate and (3) phosphate. The animal NaDC-1 cotransport 3 Na+ with each dicarboxylate. Protonated tricarboxylates are also cotransported with 3Na+. [Transport and binding proteins, Anions, Transport and binding proteins, Cations and iron carrying compounds].	1.17732e-85
NZ_CP048021.1\|WP_162038878.1\|2308971_2309364_+\|hypothetical-protein	gnl\|CDD\|227596	COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only].	9.91683e-05
NZ_CP048021.1\|WP_044162338.1\|2306568_2307432_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	3.7772e-27
NZ_CP048021.1\|WP_044162350.1\|2311730_2312540_-\|flagellar-hook-basal-body-protein	gnl\|CDD\|227125	COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion].	4.24897e-65
NZ_CP048021.1\|WP_044162780.1\|2310804_2311227_-\|3-hydroxyacyl-ACP-dehydratase-FabZ	gnl\|CDD\|234568	PRK00006, fabZ, 3-hydroxyacyl-ACP dehydratase FabZ.	5.35135e-89
NZ_CP048021.1\|WP_044162334.1\|2302156_2303263_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	2.81327e-89
NZ_CP048021.1\|WP_044162355.1\|2313410_2314409_-\|rod-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP048021.1\|WP_044162341.1\|2308161_2308665_-\|hypothetical-protein	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	2.81247e-39
NZ_CP048021.1\|WP_044162336.1\|2303466_2306568_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP048021.1\|WP_044162353.1\|2312553_2313381_-\|flagellar-hook-basal-body-protein	gnl\|CDD\|227125	COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion].	7.53099e-70
NZ_CP048021.1\|WP_044162363.1\|2322065_2323031_-\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	2.36962e-20
NZ_CP048021.1\|WP_044162357.1\|2315271_2315538_-\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	8.1179e-37
NZ_CP048021.1\|WP_044162330.1\|2296081_2297287_+\|teichoic-acid-biosynthesis-protein-B	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	8.68705e-80

>NZ_CP048021.1|WP_162038878.1|2308971_2309364_+|hypothetical-protein
MDMSQKWLWKLGLSFMAFSLAAGCAQEDNNEPAEEETPMEEENGGTENGDQGTGTENDGTENGTENNGTDNGNGENGTEDDMLPDEEETNENGTTENGGETGENGTNGNGEGLNEGNDADLTGDKEEEDK
>NZ_CP048021.1|WP_044162341.1|2308161_2308665_-|hypothetical-protein
MDVTDTYRVNRKTMAIIPHSGPDYRSRIIETGKEIFCKKSVKQILEKACLEGGASLDGRRKSVEYILNTNIKLPIPVNPGMGAFFFPNKSPKEFNCSWFSFYHIEEYLKSNDKTTNLVFSNRTKAVIDTSFFAFRRQMYVTATVIAALSRDILWFSVQDNEEEKNRD
>NZ_CP048021.1|WP_044162338.1|2306568_2307432_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MKWKKGMVVLLAAAFLMTACTNESDQADEEEEELITPVETAQVEKGTLTIEQTFFGRVTADRMAQVIPANAGEISELNVENGDEVEEGEVMARTSPGNLAIEAPINGIVQDLTVNEDSLVSNQNPVASVIDLDSLNAGLQVTEEQLDLFKEDQEVTLNFSTLEKDVTATVESIAVKTDDTGLYPVTASFENKNHKIKPGMVAEITIPEEKISDALIVPTAAIVEENNASYIYVIKDNTAHYTEVEVLGAQTESTAIKGDIKKGAEVVTKGQLTLTDGGKVEVMKGEE
>NZ_CP048021.1|WP_044162336.1|2303466_2306568_-|efflux-RND-transporter-permease-subunit
MKLVNTSVRRPVGVIMIVAAIIALGIMSLRNLTIDLFPDIELPIAVVATTYEGAAPEDVEELVSRPIESAVSSIEGIDTVQSQSSQGSSLVVMMFNTGADLDSALLRVREQVSSVQGMLPETAGEPNVLRFDPQQMPVMWVGLTGDNVKELQNIADEDLVPYFERQDGVASVTVEGGTTDEIQVELNQAKLAQYGLNTQSIMQAIGAANQSGSAGVIAKGDQDLQIRIQGDYESLEDIKQTIVQTPNGATLHLEDIAKVSRETKDQSSVSYVNNQSSVVLSILKKTDGNTVEVADTMHAAVEDMQGELPDGVNLDVVFDNSTFIKMSIDSVVRNMLMGAVFSALILLLFLKSFRATLVIGLSIPIAIISTFSLMYFTGETVNVLTMGGLALGIGMMVDSSIVILENIVSYRQRGHTMKEAAKRGASELAPAVIASTTTTIVVFLPIIFVEGIAAEMFVPLALTISFALLASLVVSVTLIPMLASKLLTKSMQEEGRRYWFDQVLGKINAGYKRVLKFVLGHRKTTVFGTIAAIALSLALIPMIGAEFIPQSDQGQIQINVNTPTGTHLESTEEIADQVDEKLSNYEDVIETNFVTVGGSGGMVGGGGSSNQASYMIQLVPQEDRDVTTTEVVTQMDDDLQKIPGAEITVSAMGGSMGGLGSPVQLQISGPDYDVLKELGDQVVYMMEDVEGIHNPESSASEGSPQVNVNVDRERAAQYGLSYQQVMSQVQMGFTGQIASRYRTGGSELDVRVMLPEDQRTTIEDLETLPIQTQTGALIPLSTVAELEQIQGPSTISRQNQQRQISISSDIVDRDLGSIMTDVEEKLDTMKFPEGYSYSVGGQAQDMAESFGQLSLALIFSIFLVYAVMAVQFENFLHPFVIMFSLPATIVGVIVGLYITQTPLSIPAFIGFIMLAGIVVNNAIVLVDYINILRNRGQERYEAILNAGPSRMRPILMTTLTTVLGMIPLALGLGEGSESQQPLAIVIIFGLTVSAIFTLLLIPVVYTYFDDFSRKVVGWFSKDKKETKDKKKRI
>NZ_CP048021.1|WP_044162334.1|2302156_2303263_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MFNVSELVIAFFISFFASLTLTLPVKKFAEKVGAVDVPNQRKIHEKITPRMGGLSIYLGAVLGLLYIFPIHPQLEAIAIGSLIIVITGMIDDKYTLKPLIKLLAQITSAGILIAAGVIIDKITLPFLGVVYLDLFSIPVTLIWIVGITNAINLIDGLDGLASGVSTIALTSILVLAIIDYRLLAVYFCIVLIGSNLGFLVHNFYPAKIYMGDTGSLFLGYSIAVISILGLLKNVALLSFIIPILVLAVPIFDTLFAIIRRLYNKENIMMPDKKHIHYQLIEAGLSHRATVLIIYGFSAVFGILAILFSEGSVATPYIVGFFLLFFLHILAESAGLVGKGKKPVINFLCKKLKKEKNYLHKRDKVEQEP
>NZ_CP048021.1|WP_052330436.1|2299632_2302038_-|SH3-domain-containing-protein
MMESIYRYDLLSDDWGGYTLNVYISNSFLTEFAAESGEITEDSPVIKRNFLERVRKKFPKTAIKTINIIAGSIVLASIPFGHFQVSAHEADFNMSYLFVGGTTNFINDVNKSGDVLDTLAPSYFELNEDGTLKETWQLDQKFIDEMHARGKEVVPFVTNHWDKELGRAALANREELSTQIANSIKKYNLDGVNVDIENVTDIDRGNYTDFVRLLREKIPKDKEVSVAVAANPNNWSKGWHGSYDYKALSQYSDYLMIMAYDQSYPNGPEGPVASYGWVEKSIQYALNEGVPSDKIVLGLPFFGRYWEEGNTAAGQGGGKGISNNRVQQMLDKYQYELTFDEVSKSPKATVTIKETDPSFTFSGTTLGPGTYHVWYENEESIQAKMDLVHKYNLKGTGSWSLGQENPVIWNYYDTWTKVHSNELNNIINVEKKYAKTTGNVNFRSYGSTTSNIIKSIPPGETIKIVGQSFQNDNYSWVPVELGDGTNGYVAANYLQEIPSKNIYGSTRYETSVKVSQEGWTSGSEVVVLGRGDLPADALTGSVLAKKYNSPLLLTKTDKLPSVVENEIARLRPNKIYILGGENAVSPGIKNHLEEKGYQVERVNGTTRYETSAKVAEELTKSSEVFIATGDDRSPDALSIAPYAGMKESPIILSKKDKLPDETITYMKDNGITKVTIIGGEGAISKNVEEQLNEIGIHDIERVNGTDRHSTSVAIAKRYASEFSLTNIYFASGISFIDALPGSPLAAMSGQPVILANKSGEMHTSIKSYLQNLNQPVDTTFLGGYNPISENIRFQIVNEIHQ
>NZ_CP048021.1|WP_044162332.1|2298167_2299508_-|UDP-glucose/GDP-mannose-dehydrogenase-family-protein
MKVTVVGTGYVGLVTGAALAEIGHTVTCLDIDKDKVELLRSGKSPIYEPGLEELLQTNLKRRRLYFTYNEKKAYKQATIIIIAVGTPSRENGSANLSYIKDVAKTIGTYAVDDSIIVTKSTVPVGTNDYIDSLIKRFNNHRTNIEVVSNPEFLREGSAVHDTFHGDRMVIGSRTKWAAQVIEDMYKPLNIPIFKTDVRSAEMIKYAANAFLATKISFINEIANLCSKLDANINDVSTGMGLDHRIGEKFLKAGIGYGGSCFPKDTKALSQIAANLEHDFELLRSVIKVNNMQQRLLVDIAKSIFPSLRGVKIAILGLAFKPNTDDMREAPSIPIVNELINEGACIQAYDPVAINNANSVLPTQVQYVYRLEDALQGTHCAMIVTDWDEFKTMDLDLFPDKMATPIVLDGRNCFSLEAIEGIDMDYHSIGRPSIIGRNQKRRETIKW
>NZ_CP048021.1|WP_044162775.1|2297292_2298171_-|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKPIKKAIIPAAGLGTRFLPATKAMPKEMLPIVDRPTIQYIVEEAVESGIEDIIIVTGKGKRAIEDHFDHNFELEDNLIKKGKFELLEKVNYSASVDIHYIRQKEPLGLGHAVWCARKFIGDEPFGVLLGDDIVKADPPGLKQLMDKYKETGGPILGVQDVPDNETHRYGIVNPHKHHDGLYQIQSLVEKPNPGSAPSNLAIMGRYVLTPEIFSYLSLHKKGSGGEIQLTDAIQKLNEAKAVYAYSFKGRRYDVGEKLGFIKTTIEFALEDEEIGEDLEEFLRRIRLRKRPS
>NZ_CP048021.1|WP_044162330.1|2296081_2297287_+|teichoic-acid-biosynthesis-protein-B
MVREIAISVYLVIFRIMFSMLKLFPQRDKTTFVASFGDNVHYVAKELQKYNYGQLVILQESNCRTDFTELSNNNTVILDFETFNLVHFIKGIYHLATSKVVFVDNYFGFLSAVDFKENVTCVQLWHAAGAIKQFGLKDPSIHSRSDLAVKRFKKVYQRFHYVVVGSEKMASIFRKSFGLGNENILRTGVPRTDFFFETEKHKLIIQGLEQQYPILKNKKVLLYAPTFRDGKLNSFELALNLEKLYQELKSEYVILLRLHPAIKSRFNNAYSDFVIDVSSYEKLHDLLLVTDYVITDYSSIPFEFSLLGKPMIFFTYDLEDYKSLRGFYADYEANLPGPMVKTTEEIIRLIQNNDFDLDLIEEFASQWNEYSQGHSSETLIKTIYQKQVQLDEAIKRKRPSY
>NZ_CP048021.1|WP_044162329.1|2295690_2296089_+|glycerol-3-phosphate-cytidylyltransferase
MKKVITYGTFDLLHNGHINLLRRAKALGDHLTVAISTDEFNAIKDKKAYHSYENRKVILEAIRYVDKVIPENNWEQKIQDVKDHNIDIFVMGDDWEGKFDFLKDYCEVVYLPRTVGISTTKIKEDLFRIDNG
>NZ_CP048021.1|WP_044162780.1|2310804_2311227_-|3-hydroxyacyl-ACP-dehydratase-FabZ
MDNSQIKEVIPHRYPFLLVDKIEEVTPGEKAVGIKNVSANEPFFQGHFPDYPVMPGVLIVEAMAQVGATSILQKEENQGKIGFLAGIDKCRFKRQVKPGDVLRLEVDITRVKGPIGKGKGTATVDGEVACEAEITFAIEK
>NZ_CP048021.1|WP_044162347.1|2311347_2311671_-|DNA-directed-RNA-polymerase-subunit-beta
MVTEQKKSRTQTKEEARKRKRSARKEEKQTKRAEQKKQKSQKAEKKPKKPRKRIFPIWARIIVITILCVIALAGGLMVGYGIIGEGKPTDALDPSTWQHIIDIVKTE
>NZ_CP048021.1|WP_044162350.1|2311730_2312540_-|flagellar-hook-basal-body-protein
MRSSYLAATTMGQLQQKLNLIGHNLSNSSTTGYKARTANFSSLLHQQINQNGIDGEAPRQTPEGLRQGTGAKLGHTNVRMDAGTITQTERPLDVALSGEKHFFQVQVTENGAAETHYTRAGNFYLQPINNNQQVALVTAQGNPVIGENGPIVLQSDIDEISIQDNGNIMVRRGEQQQVEASLEVMEIDRPRSLETAGGNRYRIPDNVPAAGLTAVAPDPGLHVGALESSNVDMGEEMTNMLEMQRAYQMNSQSISMGDQMAGLINQLRS
>NZ_CP048021.1|WP_044162353.1|2312553_2313381_-|flagellar-hook-basal-body-protein
MLRGFYTAASGMMTQQNRQDVLSNNMANALTPGYKADQTTMRAFPEMLIERTDSKQLPVHHSVNIPNNKLIGSLNTGVYMQETIPDFGQGDLKETGMSTDLAIWNGQMPDDTGSLFYTIQNQDGGTSYTRNGNFTIDANGFLVTNSGHYVLDEGGNQIQVNNDEFNVTRNGEIQANGGVTPLGIVYHPNAAQDFTKGNNDLYNLEEDGEAPVNARNAGGVTFEIRQGMIERSNVDTTQTMTEMLQTYRNFEANQQVLKAYDKSMDMAVNQIGRLR
>NZ_CP048021.1|WP_044162355.1|2313410_2314409_-|rod-shape-determining-protein
MFSRDIGIDLGTANVLIHVKGKGIVLNEPAVVAMDRNTGKVLEVGEAARRMIGRTPGNIIAIRPLKDGVIADFDVTEAMLRYFIEKINVRGFLSKPRILVCCPTNITKVEQKAIKEAAEKSGGKKVYLEEEPKVAAIGAGMDIFQPSGNLVLDIGGGTTDIAVLSMGDIVTASSIKMAGDTFDNEIIQHIKRKYKLLIGDRTAEDIKVNVATVFPDNRYEEMDIRGRDLVTGLPRTITVNSKEINEALEESVSLIVQAARTVLERTPPELSADIIDRGAILTGGGALLNGLDQLLSEELKVPVIIAEEPMFCVAKGTGLMLEQIEKLPNVKN
>NZ_CP048021.1|WP_044162357.1|2315271_2315538_-|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGKYIVETRKTVRVIAKEFGVSKSTVHKDLTERLPEINPELWKEVKEILTYHKSIRHLRGGAATKQKYNDEDKKEPV
>NZ_CP048021.1|WP_044162359.1|2317356_2319021_+|DASS-family-sodium-coupled-anion-symporter
MMTAAWNWLWDMHNQAKDLLRFFARPSSSSLGSEGTNPNTIRRENNRGNGNNNGNGDRLFKPGQMIGLILGPVLFFLTLQFFHPDGLSDAGVAVLASTIWIAIWWITEAVPIPVTSLLPIVLFPLTGGLDIGATTSSYGDDTIFLFMGGFMIALAMEKWNLHRRIALSIISVIGTNSERIILGFMVATGFLSMWISNTATSMMMVPIGLAIIYQVADQLKDDHSIDTSQENFGFGKALMLGIAYSASVGGMATLIGTPPNTALAGVINNMYDIEITFAGWMLFGVPIAWIFIFIIWYYLVKVSYPLKFKHLPGGREVIKNEKEKLGSASFEEKGVMVIFVLAAFAWISRSFLLTQINENINDAIIAITAAVILFIIPSKNRKGDYLLDWNTAVKLPWGILLLFGGGLAIASGFSSSGLSEWIGSQLSILDGINIFLILLAVAAMVIFLTEVTSNTATANMMYPIMASLAVALGIHPYAVMIAAAVAASSAFMLPVATPPNAVVFGSGYLRIPDMAKAGLALNIIGVLLVALAIYFWLPVVWNIDLTEIPASMKN
>NZ_CP048021.1|WP_044162360.1|2319345_2320584_-|MFS-transporter
MEQTNHQHAYTVKDSQFWLITISLAVSSFFVFAAMYSTQPLLPLFVREFDVSVSVSSLSVSLTIIGLIIGLIVLGFLSDRNGRTMFIKLSLAGAAIPFLLIPLSESFLLFLIFRFLQGFALAGLPAAALAYLMEEMDKSSLPLATALYISSNALGGMVGRFMTGYVSDHLSWEMAFYLLGGLGFVVLVAVLFMLPRSRYFTPSQQTFSRDIKGFLYHLKNPGLLWIFGIGVVIQLSFTGIWTYLPFHLEGPPFSLSLEAISYLFLAYGLGVVGSPVAGWLSGRFGILTVRAAGIVVMTLGILMTLASSIWIVAIGLCITCLGFFTAHSITASSVGFEVTHHKGSASSLYLVFYYVGVSLGSSALGPLWNAAGWTGIVITLSCIPVVYTLTRYIVVRNRKQNEAESNFTNVHG
>NZ_CP048021.1|WP_044162362.1|2320821_2321796_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MNEEGKNPNSKNSGWRKLVRKKWFYPAVYLTFAALVLTGVIWYQNAAVDLPDEEAQDQTDQLDSENTDQVGERPEGDSVPVIEQDEQVMMPVANAKQTEIVTKFYDYNASEKEQEQALVLYNNKYYQSKGIDIASTNEEPFDVTAALSGKVTDVKDDPLLGMVVELTHENGVTTNYASLEDVTVDSGAKVEQGDVIGTAGQNLYGQANGIHVHFELRKDGTRVDPEDYFNKSLSEIKLPSDGNEEDGDQEDGNEEDGTEEDGASEDGASEDGATGDEASDEETSGQEENTDDQGDSDEEDNGSDDEEDDSTDVQPESSASSATA
>NZ_CP048021.1|WP_044162363.1|2322065_2323031_-|NERD-domain-containing-protein
MIVKQREMPLIIPQLQALDYRLPEQHLKRPIIRGELSKQIIGYQGEKSVDYQLSHLPLNKYYILHNLRLPDNKSFFQIDTLLLSYYYILNMEIKNFGGSIYFDDHFGQVIQTQNGKEKALPDPIYQINRQELQLEKWLRRHNFPFVPIESIVVFGNANTTIKAEPGSPAFEKVMHSAKILKKLEEFDQKYKYASLKRNQVQSISDTLIKEHTPKRQDILRKYSISESEVIKGTRCPRCSAVPIQRQKRKWICHKCGFSSKKAHLDSLQDYALLFSPTITNQQFREFFSIPSPSTASKMLANSEFKKNGHTKGTKYTIPLNF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048021_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048021_2

2772052-2772180

Unclear

Consensus_repeat	Method
ATGAAGGACAAAGGATGGGTGGATT	CRISPRCasFinder

2 spacers

cas3

The CRISPR arrays of NZ_CP048021_2

>merge|NZ_CP048021|2|2772052-2772180|CRISPRCasFinder
GTGAAGGCCAGAGGATGGGTGGATTTCCAGTGGAGTGGCCCTCATCAGACGAATGAAGGACAAAGGATGGGTGGATTTGCACTGGAATGTCCTTCATCGAGGCTATGAAGGACAAAGGATGGGTGGATT

>NZ_CP048021|2|2|2772052-2772180|CRISPRCasFinder
GTGAAGGCCAGAGGATGGGTGGATT	TCCAGTGGAGTGGCCCTCATCAGACGA
ATGAAGGACAAAGGATGGGTGGATT	TGCACTGGAATGTCCTTCATCGAGGCT
ATGAAGGACAAAGGATGGGTGGATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048021.1\|WP_044153565.1\|2765529_2766483_+\|ribose-phosphate-diphosphokinase	unknown	unknown	gnl\|CDD\|234929
NZ_CP048021.1\|WP_044153584.1\|2778081_2778480_+\|RNA-binding-protein-S1	unknown	unknown	gnl\|CDD\|236305
NZ_CP048021.1\|WP_044153560.1\|2762681_2763497_+\|pur-operon-repressor	unknown	unknown	gnl\|CDD\|236414
NZ_CP048021.1\|WP_044153568.1\|2767468_2768029_+\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|235457
NZ_CP048021.1\|WP_044153570.1\|2768101_2768332_+\|anti-sigma-F-factor-Fin-family-protein	unknown	unknown	gnl\|CDD\|371314
NZ_CP048021.1\|WP_044153581.1\|2777019_2777619_+\|spore-cortex-biosynthesis-protein-YabQ	unknown	unknown	gnl\|CDD\|131939
NZ_CP048021.1\|WP_044153586.1\|2779243_2781697_+\|stage-II-sporulation-protein-E	unknown	unknown	gnl\|CDD\|274328
NZ_CP048021.1\|WP_044153576.1\|2774804_2776277_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|226465
NZ_CP048021.1\|WP_044153572.1\|2768410_2771959_+\|transcription-repair-coupling-factor	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224118
NZ_CP048021.1\|WP_044153562.1\|2763637_2763925_+\|septation-protein-SpoVG	unknown	unknown	gnl\|CDD\|237321
NZ_CP048021.1\|WP_044153566.1\|2766726_2767368_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	unknown	unknown	gnl\|CDD\|235534
NZ_CP048021.1\|WP_044153563.1\|2764131_2765511_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	unknown	unknown	gnl\|CDD\|184643
NZ_CP048021.1\|WP_044153583.1\|2777626_2778007_+\|septum-formation-initiator-family-protein	unknown	unknown	gnl\|CDD\|225471
NZ_CP048021.1\|WP_044153587.1\|2782261_2783002_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238119
NZ_CP048021.1\|WP_044153558.1\|2761331_2761526_-\|small,-acid-soluble-spore-protein,-alpha/beta-type	unknown	unknown	gnl\|CDD\|365990
NZ_CP048021.1\|WP_044153579.1\|2776720_2777023_+\|sporulation-protein-YabP	unknown	unknown	gnl\|CDD\|274341
NZ_CP048021.1\|WP_044153578.1\|2776282_2776546_+\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|224109
NZ_CP048021.1\|WP_044153559.1\|2761764_2762613_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|234652
NZ_CP048021.1\|WP_044153575.1\|2773221_2774808_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
NZ_CP048021.1\|WP_044153573.1\|2772564_2773095_+\|stage-V-sporulation-protein-T	unknown	unknown	gnl\|CDD\|131898

Protein	Function_ID	Function_description	E-value
NZ_CP048021.1\|WP_044153565.1\|2765529_2766483_+\|ribose-phosphate-diphosphokinase	gnl\|CDD\|234929	PRK01259, PRK01259, ribose-phosphate diphosphokinase.	0
NZ_CP048021.1\|WP_044153584.1\|2778081_2778480_+\|RNA-binding-protein-S1	gnl\|CDD\|236305	PRK08582, PRK08582, RNA-binding protein S1.	6.62757e-69
NZ_CP048021.1\|WP_044153560.1\|2762681_2763497_+\|pur-operon-repressor	gnl\|CDD\|236414	PRK09213, PRK09213, pur operon repressor; Provisional.	1.15484e-175
NZ_CP048021.1\|WP_044153568.1\|2767468_2768029_+\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|235457	PRK05426, PRK05426, peptidyl-tRNA hydrolase; Provisional.	5.74804e-100
NZ_CP048021.1\|WP_044153570.1\|2768101_2768332_+\|anti-sigma-F-factor-Fin-family-protein	gnl\|CDD\|371314	pfam10955, DUF2757, Protein of unknown function (DUF2757). Members in this family of proteins are annotated as YabK however currently no function is known.	5.44877e-29
NZ_CP048021.1\|WP_044153581.1\|2777019_2777619_+\|spore-cortex-biosynthesis-protein-YabQ	gnl\|CDD\|131939	TIGR02893, Spore_protein_YabQ, spore cortex biosynthesis protein YabQ. YabQ, a protein predicted to span the membrane several times, is found in exactly those genomes whose species perform sporulation in the style of Bacillus subtilis, Clostridium tetani, and others of the Firmicutes. Mutation of this sigma(E)-dependent gene blocks development of the spore cortex. The length of the C-terminal region, including some hydrophobic regions, is rather variable between members. [Cellular processes, Sporulation and germination].	4.05075e-30
NZ_CP048021.1\|WP_044153586.1\|2779243_2781697_+\|stage-II-sporulation-protein-E	gnl\|CDD\|274328	TIGR02865, Stage_II_sporulation_protein_E, stage II sporulation protein E. Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs. [Cellular processes, Sporulation and germination].	0
NZ_CP048021.1\|WP_044153576.1\|2774804_2776277_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|226465	COG3956, COG3956, Protein containing tetrapyrrole methyltransferase domain and MazG-like (predicted pyrophosphatase) domain [General function prediction only].	0
NZ_CP048021.1\|WP_044153572.1\|2768410_2771959_+\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NZ_CP048021.1\|WP_044153562.1\|2763637_2763925_+\|septation-protein-SpoVG	gnl\|CDD\|237321	PRK13259, PRK13259, septation regulator SpoVG.	6.71448e-59
NZ_CP048021.1\|WP_044153566.1\|2766726_2767368_+\|50S-ribosomal-protein-L25/general-stress-protein-Ctc	gnl\|CDD\|235534	PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed.	9.97782e-61
NZ_CP048021.1\|WP_044153563.1\|2764131_2765511_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	gnl\|CDD\|184643	PRK14354, glmU, bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU.	0
NZ_CP048021.1\|WP_044153583.1\|2777626_2778007_+\|septum-formation-initiator-family-protein	gnl\|CDD\|225471	COG2919, COG2919, Septum formation initiator [Cell division and chromosome partitioning].	6.4789e-13
NZ_CP048021.1\|WP_044153587.1\|2782261_2783002_+\|VWA-domain-containing-protein	gnl\|CDD\|238119	cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.	2.21536e-09
NZ_CP048021.1\|WP_044153558.1\|2761331_2761526_-\|small,-acid-soluble-spore-protein,-alpha/beta-type	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	6.10545e-07
NZ_CP048021.1\|WP_044153579.1\|2776720_2777023_+\|sporulation-protein-YabP	gnl\|CDD\|274341	TIGR02892, conserved_hypothetical_protein, sporulation protein YabP. Members of this protein family are the YabP protein of the bacterial sporulation program, as found in Bacillus subtilis, Clostridium tetani, and other spore-forming members of the Firmicutes. In Bacillus subtilis, a yabP single mutant appears to sporulate and germinate normally (), but is in an operon with yabQ (essential for formation of the spore cortex), it near-universal among endospore-forming bacteria, and is found nowhere else. It is likely, therefore, that YabP does have a function in sporulation or germination, one that is either unappreciated or partially redundant with that of another protein. [Cellular processes, Sporulation and germination].	7.33514e-30
NZ_CP048021.1\|WP_044153578.1\|2776282_2776546_+\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	2.85715e-30
NZ_CP048021.1\|WP_044153559.1\|2761764_2762613_+\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|234652	PRK00128, ipk, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	0
NZ_CP048021.1\|WP_044153575.1\|2773221_2774808_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	6.42048e-101
NZ_CP048021.1\|WP_044153573.1\|2772564_2773095_+\|stage-V-sporulation-protein-T	gnl\|CDD\|131898	TIGR02851, stage_V_sporulation_protein_T, stage V sporulation protein T. Members of this protein family are the stage V sporulation protein T (SpoVT), a protein of the sporulation/germination program in Bacillus subtilis and related species. The amino-terminal 50 amino acids are nearly perfectly conserved across all endospore-forming bacteria. SpoVT is a DNA-binding transcriptional regulator related to AbrB (See pfam04014). [Regulatory functions, DNA interactions, Cellular processes, Sporulation and germination].	2.46167e-91

>NZ_CP048021.1|WP_044153572.1|2768410_2771959_+|transcription-repair-coupling-factor
MQGLKNYLQEQNDIQTIISGFSSGMKEQLVSGLSGAARSVFISLLNESLDKPVLVLTHHLSQAQALYEDLLDLSHEEDVYLYPVNELMASEIAVASPELLSQRMESLNQWIHKRKGVFIAPIAACKRILPPIKSWEQSQLSFQVGEAISIHDYTQSLVEMGYRREDMISAKGEFSIRGGIIDLFPLTSEYPVRIELFDDEVDSIRYFDSNSQRSFNEKLSSITVGPAEEVLLTDEERLTGAQRLEQALSESLKKMKNDHAKKELVENIDYDIERLKNGETFQEIYKYSSLFYDQAASLIDYLPQNGLVVIDEMSRVEETASRLDQEEADWYANLLEQNKMVRDLSVSFSWNDIQEKLTGYSKLYMSVFLRHIANTNPENLINISCRAMQEFHGQMNLLKSELNRWDKAGFSVFIVAPTKNRVEKVQSVLEDYGMEARVADQGIEFPLKTPTIVEGQISGGFELPLFRVAVITEQELFKKQTKRPKRRQKISNAERIKSYQELKIGDYVVHANHGIGKYVGIETLELNGLHKDYLLIKYSGDDKLYVPIDQIDLVQKYVGSGEGKEPKLYKLGGSEWKKVKNRVQSSVEDIADDLIKLYAERERTKGFAFSGDNEMQREFEAAFPYEETEDQLRCIEEIKQDMMKSRPMDRLLCGDVGYGKTEVAIRAVFKAILDEKQVAILVPTTVLAQQHFETFQERFQDYGINIGLLSRFRSRKQQKETIDGLKMGLVDVVIGTHRILSKDIQYKDLGLLIVDEEQRFGVKHKEKIKQFKTNIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPIQTYVIEYNPQFVREVIERELSRGGQVFFLYNRVENIERMAAEIDVLVEDARVTFAHGRMNENQLENVMFDFLEGHSDVLVSTTIIETGVDIPNVNTLIVYDADKMGLSQLYQLRGRVGRSNRIAYAYFTHQQNKVLTEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGTGNLLGAEQHGFIDSVGFDMYSKMLKDAIDAKKEGKTYEEAKPFDVEINVNLDAYIPPSYIEDEKQKIDMYKRFGAVENMDEILDLQDELMDRFGEYPEEVENLLQVTKLRIMARQERIESITEKKLNVELLMDGEESQQVDGSKLFELANEYGRLIQLGTENNKLKMVFKFSRDQAHKRYDVISEFLTKLPRVKQQEVASS
>NZ_CP048021.1|WP_044153570.1|2768101_2768332_+|anti-sigma-F-factor-Fin-family-protein
MAVIYRCRHCGDKIGELQQSYVHEEDLGLHILSNEERNEMIDYTKDGHMEVKAICDHCEDALNNHPDYHELDSFIQ
>NZ_CP048021.1|WP_044153568.1|2767468_2768029_+|aminoacyl-tRNA-hydrolase
MKCIVGLGNPGSKFENTRHNIGFQVIDELAERNHWSLNREKYNALYTIEHLNGEKVLILKPLTYMNLSGEAVRPFMDFYDLDIEDLLVVYDDLDLPAGRIRLRQKGGHGGHNGIRNIIDQTTLKNFKRIRIGIGRPETNVPIIDYVLGKFTEEQKPKVEDSVKSAAEACEMWLEKPFLEVMNHFNS
>NZ_CP048021.1|WP_044153566.1|2766726_2767368_+|50S-ribosomal-protein-L25/general-stress-protein-Ctc
MTATIKANERKDLRRSNNRELRQNGFIPAVVYGKDKEPVTVSVNNLELIKTVREEGRNSVFSLEVQGNKPLDVMLYDYQSDSLKGEIIHVDFYLVDKSSVVDVEVSINLEGDSEGVRDGGVLQQTLHELHVRARPNEIPEVINVDISELKIGEGIVVGDLKGSKDYEILSDDETTIVTVLPPQNANTDEEGADEEEPAEPEVINEKSNDEEEE
>NZ_CP048021.1|WP_044153565.1|2765529_2766483_+|ribose-phosphate-diphosphokinase
MPNTYKDPFLKVFTLNSNPDLAQEIAENIGTELGKCSVKTFSDGEIQINIEESIRGCDVYVIQSTSDPVNDHLMELLIMIDALKRASAKTINVVIPYYGYARQDRKARSREPITSKLVANLLMTAGATRLITLDLHAPQIQGFFDVPVDQLLGVTILSEYFSKKGIDDPVIVSPDHGGVTRARKMADLLKAPIAIIDKRRPKPNVSEVMNIVGNIEGKTAILVDDIVDTAGTITLAANALVENGAKEVYACGTHPVLSGPAIERVQNSKIKELVVTNSIPLPESKKIDKVTQLSVGPLISEAITRVHELKSVSDLFE
>NZ_CP048021.1|WP_044153563.1|2764131_2765511_+|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU
MSQRFAVVLAAGQGTRMKSSLYKVLHPVCGKPMVQHVTDQLNELKLSQLITVVGFGAEKVKDELGDATEFVIQEEQLGTGHAVMQAEELLSDKEGTTLVVCGDTPLLTAETLEAFVSHHEKEAAKVSVLTAGADDPAGYGRVVRNEANEVEKIVEHKDASPDELAIKEINTGTYCFDNQALFNALKDVSNDNAQGEYYLPDVIEILKSQGEKIAAYQTDNFAETMGVNDRVALSRAEKHMRIRINEGHMRNGVTLIDPEHTYIGPDVKIEQDVIIEPGCTIDGSTVIRTEAFIGANTEIKNCEIGSGTTIKQSVAHDSKIGEYVKIGPYAHIRPSSDIKNNVKIGNFVEVKKSVFEEGSKASHLSYVGDAEVGKEVNIGCGTITVNYDGENKHKTIIEDGAFIGCNSNLVAPVTIEKGAYVAAGSTITKNVPEESLSIARSRQTNKEGYVERLKNIRKK
>NZ_CP048021.1|WP_044153562.1|2763637_2763925_+|septation-protein-SpoVG
MEVTDVRLRRVNTDGRMRAIASITLDQEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIAHPINSNTRGKIQDAVLAEYDRAGEEVEYEEAGAS
>NZ_CP048021.1|WP_044153560.1|2762681_2763497_+|pur-operon-repressor
MKRSERLVAMTNYLLNHPRRLVSLPFFSEQYDAAKSSISEDLDIVDQMFQAQGIGKLETVAGAAGGVKYIPLYSTENSGQFINELCNRLEDPARILPGGYLFMSDLLGDPELMRNLGKIFATAFADKDIDYIVTVATKGIPLAYATANVLNVPVIIVRRDPKVTEGSTVSINYVSGSSRKIQTMVLSKRSLPEGSNVCIIDDFMKAGGTITGMQSLLREFNAHVQGIGVLAEAEDEEEERVVNDYISLIKIQDVDIKGNKIEAVKGNYFDL
>NZ_CP048021.1|WP_044153559.1|2761764_2762613_+|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MIVEKAPAKINLTLDVLHKRDDGYHEVEMIMTTVDLYDQVQMMEIEADTIQVQSEKRFVPDDHRNLAYQAAEKIKQKFNITKGVNISIYKQIPVAAGLAGGSSDAAAVLRGLNQLWNLNLTQQELAEIGTEIGSDVAFCVYGGTALAKGRGEQIEPLPAPPKCWVILAKPAIGISTGTIYGNLTESHMNQVQTDSMIEAITEHNYQMVCQELANVLEIVTMEHYPEVRRMKYQMLKSGADNVLMSGSGPTIFGLTRKESRAERVYNSLRGFCEEVYIVRMLG
>NZ_CP048021.1|WP_044153558.1|2761331_2761526_-|small,-acid-soluble-spore-protein,-alpha/beta-type
MGRRKGIMSDQFKEEIAKDLGFYDTVQKEGWGGIRARDAGNMVKRAIQMAEGQLTNENENKDRS
>NZ_CP048021.1|WP_044153573.1|2772564_2773095_+|stage-V-sporulation-protein-T
MKATGIVRRIDDLGRVVVPKEIRRTLRIREGDPLEIFVDREGEVILKKYSPINELGDFAKEYAEALFDTLGHAVFISDRDEFIAVAGGSKKEYLNKKIGSHIEKIMEERNVVSESNEQSIEFLEGQEETISSYVMAPIIANGDPVGCVVLTSEEALGEAEKKAAETAAGFLARQMD
>NZ_CP048021.1|WP_044153575.1|2773221_2774808_+|polysaccharide-biosynthesis-protein
MSHRQVFKGALLLTAAGILGKLLSAGYRVPLQNLTGDTGFYIYQQVYPFITIAWMMSVYGYPAAISTFNLETRQERHSGSHITLYIPIFIFLFFLNGVVFLVLYFGAHRMAGWMGDPHLEGPIQFASLLFLLIPFTSFLRGSFQSAEDMRPSAVSQTGEQLVRIGLILWFTYTFLQQGKSLYDIGSGAALSSSIAACAAVLILILLLLFFYRRHQIHFSLKMISIRRMVKVLFETSMIAGLNYMLLILLQLVDVFTIIPGLQEYGLTLSEAKAEKGIFDRGQPLVQLGVVFGSSLSLALIPAISKMKARGTGNLEEQSVKRALKFTCFFATAATIGIILIFPSANILLFKTNVGTEALRIFMVMILLVSITLTLSTFLQGLGFVKRQALLFGLAVVMKGILNVLLIPAFGIQGAATASVVSVLILAAAFALMLKRYTGLSYRRILPWKPFLFSLSILAIIVLMMKLLLLNGEVNHRMDVLGYIIASTSLGALSFFGALIWSGGLTLRELRLFPYGKQLTEWVVRRRRP
>NZ_CP048021.1|WP_044153576.1|2774804_2776277_+|nucleoside-triphosphate-pyrophosphohydrolase
MKKMITILGLGAGDINQIPLGVYRQLVSSESVVHTRTMDHPVIKSLVADGVQFQSFDDVYEKHDSFEPVYQEIVQNLLQAAESFPVIYTTPGHPMLAERAVQILLEKAKQDSAVQIHIGQGHSYLDALFASLKIDPVEGFQFLDATSFKRLEVQFDQHVVFTQVYDQMIASEVKLTLMEDLPDHYPVTVVHAAGSDEEWTKEVPLFELDRSVPLSNLISVYVPPAPPELRHHQFNRLREVIAILRGPDGCPWDRKQTHESLRPYLLEEAYEVIEAIDEQDDEKLADELGDVLLQVMLHGQIGEDEGYFSVDDVIRHITDKMVRRHPHVFGNVNLNTSDEVVKTWDEIKRDEKGGVEEESIVDDIEKSLPALLIAFELQKKTGKVGFDWEDFQPVFDKIMEEIKEFKQSLAKQTTTEMEKELGDILFSIVNLARHYKINPEIALQRSNQTFKRRFQFIEKRTKEQGKTLNDMTLEEMDQLWNEAKSNEKER
>NZ_CP048021.1|WP_044153578.1|2776282_2776546_+|RNA-binding-S4-domain-containing-protein
MRLDKFLKISRLIKRRTLAKEVAEQGRIQLNGQPAKASTKLSAGDELTIRFGQKLLTVKVNDLRETVKKDEAQGLYTVVKEEPVHQD
>NZ_CP048021.1|WP_044153579.1|2776720_2777023_+|sporulation-protein-YabP
MNYENQFYPSTREPQEHHVKVLNRRELEITGVKEVDSFDNEEFLLQTSFGYLVVRGENLHMKNLNLDETLVSIKGRVYELSYIDDQQGDKAKGLFSKLFK
>NZ_CP048021.1|WP_044153581.1|2777019_2777619_+|spore-cortex-biosynthesis-protein-YabQ
MSLSLQFITMLVMAGSGIYLGMAADTFHRFNERKKRKPWIHYCNEILFWILQGLIIFYILYLTNYGQIRFYIWLALIFGFAFYQALLRVWYLKVLEHLIQFSVTTWQVLRRLIQRLVIAPLSWMLKVLTYLLTLFWTAVIWVLFIPWKLLRRPLIFVWNQIKKLIPENVKKYILSFLELCSKIINNLVDIWKSIFAKRR
>NZ_CP048021.1|WP_044153583.1|2777626_2778007_+|septum-formation-initiator-family-protein
MSSANKRVTRLDSNYVREYDAYVERQNKRKKRLYRRLTLFAIVAVSVFAYLITFHLNQRELYKEKVSEYEQLNDELDKLEVKEKNLQQEIDLLNDTDYILQIARKDYFLSKDGEIIFNVPDDESSY
>NZ_CP048021.1|WP_044153584.1|2778081_2778480_+|RNA-binding-protein-S1
MSVEVGSKLKGKVTGITNFGAFVELPDGSTGLVHISEVADKYVKDIHEFLTVGDEVEVKVINVSEGKIGLSIKKAKENKNPNNNNNKRGNPKRRSESFEAKMNRFLKDSEDRLASLRKNTESKRGGRGAKKG
>NZ_CP048021.1|WP_044153586.1|2779243_2781697_+|stage-II-sporulation-protein-E
MIESVTRSQSKSLYQQLRFALINAKRKTKELSQRKLIEEGWLLLFAGFLLGRAIILESVSPFAVAFFASIWMIRRKLSLKVAFAVLAGSLTLHWEHSLFLLSSIFLFCVLAGIFRKTTNQQKWLPVFVFISCIIPRISGSYLAGQMETYQWVLSIVESSLSVILVLIFMQSVPILSPNAVKKDLKNEEIVCMMILLASVLTGMIGWIVLDASVEQVFSRYVVLLLAYIAGAAIGSTVGVVTGLVLSLADVASLYQMSLLAFAGLLGGLLKDGKKIGVGLGLFVATLLIGIYGEGQGAPFRPVMIETGLAIALFFATPDGWIRKMARYIPGTNEHTEEQQQYLQKVRDVTAQRVETFSDMFQALSKSFSRIDGVTPQTQDGKERDYFLSNVTEKTCQSCFKKESCWVHKFDQTYDYMTEIMDEMEKGTFDNKRKLKRDFENHCVKSGKVYETMKNELSFYEANQRLKKQVKESRKFVAEQLRGVSDVMDNFAKEIMKERQIHEQQEQEIVQAIRNLGFEIEKLDIYSLDPGNIDIEMNLSFYDYHGEGSKVIAPALSDILEETVIVDKEEVSPFPNGYGYFTFKSARQYNIQTGVAHAAKGGGLISGDSYLTMELGSGRYALAISDGMGNGERAYMESMETLRLLRQILQSGIDEKVAIKSINSILSLRTTDEIFSTLDLAVIDLHHAGAKFLKIGSTPSFVRRTSDIIKVEAGNLPIGIIKEFDVDVVSEQLKPDDILIMMSDGIFEGPDHIENVDMWLRRKIKSIETNDPQAIADIILEEVVRTKSGEIDDDMTVLVAKLEEHIPKWASFPLHKAQ
>NZ_CP048021.1|WP_044153587.1|2782261_2783002_+|VWA-domain-containing-protein
MKKGTIKQILLITDGCSNQGEDPASISSIAYQQGISVNVIGVLEDDDSEQPEGLEEVEDISTAGGGVSRIVYAQALSQTVQMVTKQAMTQTLQGVVNQELQQILGDEKSMEDLPPEKRGEVMEVVDDLGETSDLEVLILVDTSASMSPKLATVKESLEDLSLSLNARTGKNRFAIYSFPGKKQPVNEIMPWTNKLQNISSVFPKLTSGGITPTGPALKEAIHHFQSTPKLEGWSSENGDIYEETGF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	532622-532648	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	533141-533167	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	600157-600183	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	158999-159025	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	215425-215451	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1416700-1416726	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1469461-1469487	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	733031-733057	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	521717-521743	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	532623-532649	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1229838-1229864	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1188876-1188902	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	774659-774685	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1140822-1140848	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1203344-1203370	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1817029-1817055	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1386175-1386201	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1119194-1119220	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	327241-327267	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1377037-1377063	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1202756-1202782	5	0.815
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP024312	Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence	142822-142848	6	0.778
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP041205	Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence	392405-392431	6	0.778
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP032923	Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence	158464-158490	6	0.778
NZ_CP048021_2	2.2\|2772129\|27\|NZ_CP048021\|CRISPRCasFinder	2772129-2772155	27	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1562205-1562231	6	0.778

1. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

2. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

3. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

4. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

5. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

6. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

7. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

8. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

9. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

10. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

11. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

12. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

13. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

14. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

15. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

16. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

17. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

18. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

19. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

20. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

21. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.815

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggcg	Protospacer
  **.************.********

22. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP024312 (Rhizobium sp. NXC24 plasmid pRspNXC24a, complete sequence) position: , mismatch: 6, identity: 0.778

tgcactggaatgtccttcatcgaggct	CRISPR spacer
ttcaatggaatgtccttcatcgacttc	Protospacer
* ** ******************  ..

23. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP041205 (Rhizobium sp. NIBRBAC000502774 plasmid pMK-2, complete sequence) position: , mismatch: 6, identity: 0.778

tgcactggaatgtccttcatcgaggct	CRISPR spacer
ccgaccgggatgtccttcatcgaggcg	Protospacer
.  **.**.*****************

24. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP032923 (Agrobacterium tumefaciens strain 1D1108 plasmid pAt1D1108a, complete sequence) position: , mismatch: 6, identity: 0.778

tgcactggaatgtccttcatcgaggct	CRISPR spacer
ccgaccagaatgtccttcatcgaggcg	Protospacer
.  **..*******************

25. spacer 2.2|2772129|27|NZ_CP048021|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.778

tgcactggaatgtccttcatcgaggct	CRISPR spacer
accattggaatgtcctttatcgaggag	Protospacer
  **.************.*******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

480093 : 487430

Staphylococcus_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044160488.1\|480093_481803_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-13	71.4
WP_044160486.1\|481884_482622_+	EAL domain-containing protein	NA	NA	NA	NA
WP_162038758.1\|482794_484024_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-21	23.7
WP_044160485.1\|484167_484512_+	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	1.8e-12	38.6
WP_044160483.1\|484527_485826_+	arsenic transporter	A0A2H4PQU3	Staphylococcus_phage	2.5e-158	66.4
WP_044160481.1\|485901_486321_+	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	6.1e-42	60.4
WP_044160480.1\|486458_487430_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	9.2e-17	44.2

DBSCAN-SWA_2

1170029 : 1176575

Bacillus_virus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044157747.1\|1170029_1170518_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	3.5e-41	51.2
WP_044157748.1\|1170585_1171530_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.8e-124	67.1
WP_052330347.1\|1171649_1172648_+	hypothetical protein	A0A1V0DZX6	Clostridioides_phage	1.0e-18	44.8
WP_162038969.1\|1172668_1173310_-	HD domain-containing protein	S4W232	Pandoravirus	4.5e-12	32.7
WP_044157750.1\|1173306_1174164_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_044157751.1\|1174210_1174432_-	hypothetical protein	NA	NA	NA	NA
WP_044157752.1\|1174749_1174950_+	cold-shock protein	Q9AZD3	Lactococcus_phage	4.5e-19	67.7
WP_044157753.1\|1175101_1175722_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	7.9e-38	63.0
WP_044157754.1\|1175903_1176575_+	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	1.4e-11	27.6

DBSCAN-SWA_3

3007238 : 3050127

uncultured_virus(18.18%)

integrase,holin,tRNA,protease,transposase

attL 3024240:3024254|attR 3042370:3042384

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044164392.1\|3007238_3007850_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_044164393.1\|3007982_3008345_+	holo-[acyl-carrier-protein] synthase	NA	NA	NA	NA
WP_044164394.1\|3008623_3009646_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_044164395.1\|3010275_3011457_+	alanine racemase	NA	NA	NA	NA
WP_044164455.1\|3011622_3011916_+	hypothetical protein	NA	NA	NA	NA
WP_044164397.1\|3011922_3012273_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A2P0ZKX3	Lactobacillus_phage	1.7e-13	37.7
WP_044164399.1\|3012535_3013402_+	STAS domain-containing protein	NA	NA	NA	NA
WP_044164401.1\|3013406_3013763_+	STAS domain-containing protein	NA	NA	NA	NA
WP_044164457.1\|3013767_3014175_+	anti-sigma regulatory factor	NA	NA	NA	NA
WP_044164403.1\|3014185_3015178_+	PP2C family protein-serine/threonine phosphatase	NA	NA	NA	NA
WP_044164406.1\|3015261_3015591_+	STAS domain-containing protein	NA	NA	NA	NA
WP_044164408.1\|3015590_3016070_+	anti-sigma B factor RsbW	NA	NA	NA	NA
WP_044164409.1\|3016041_3016833_+	RNA polymerase sigma factor SigB	A0A0Y0AU18	Bacillus_phage	1.8e-23	32.4
WP_052330502.1\|3016829_3017432_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_044164461.1\|3017625_3019773_+	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_044164410.1\|3019786_3019918_-	cortex morphogenetic protein CmpA	NA	NA	NA	NA
WP_044164413.1\|3020340_3020784_+	SprT family protein	NA	NA	NA	NA
3024240:3024254	attL	NA	NA	NA	NA
WP_162038833.1\|3028250_3029444_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_044164112.1\|3029788_3030757_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_044164110.1\|3030771_3031227_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_044164108.1\|3031223_3031931_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_044164106.1\|3031923_3032370_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_044164104.1\|3032354_3033416_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.9e-72	45.3
WP_044164103.1\|3033773_3035705_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.4e-55	32.1
WP_044164101.1\|3035847_3036513_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_044164099.1\|3036658_3036868_-	YdiK family protein	NA	NA	NA	NA
WP_044164097.1\|3036874_3037582_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_044164095.1\|3037955_3038240_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.7e-19	53.8
WP_044164094.1\|3038301_3039936_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-159	56.6
WP_162039009.1\|3040017_3040806_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	5.8e-78	60.5
WP_052330490.1\|3040992_3042006_+\|transposase	ISL3 family transposase	Q6V7R1	Burkholderia_virus	4.3e-25	27.9
WP_044164093.1\|3042814_3043942_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.2e-71	43.6
3042370:3042384	attR	NA	NA	NA	NA
WP_162039010.1\|3043961_3045206_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-96	49.5
WP_044164091.1\|3045685_3046012_+	hypothetical protein	NA	NA	NA	NA
WP_044164089.1\|3046182_3046800_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_044164087.1\|3046829_3047240_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
WP_162039011.1\|3047394_3047970_-	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
WP_044164084.1\|3048441_3050127_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	5.4e-65	33.0

DBSCAN-SWA_4

3238213 : 3288226

Acinetobacter_phage(42.86%)

integrase,transposase

attL 3269976:3269997|attR 3287146:3287167

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162038833.1\|3238213_3239407_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_044163823.1\|3239534_3240071_-	hypothetical protein	NA	NA	NA	NA
WP_044163821.1\|3240717_3241413_+	DUF2711 family protein	NA	NA	NA	NA
WP_044163818.1\|3241543_3242836_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_044163816.1\|3243057_3243588_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_044163814.1\|3243580_3244609_+	hypothetical protein	NA	NA	NA	NA
WP_044163811.1\|3245448_3246870_+	anthranilate synthase component I	NA	NA	NA	NA
WP_044163809.1\|3246866_3247490_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.8e-45	47.4
WP_044163807.1\|3247473_3248493_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	2.5e-49	32.0
WP_044163806.1\|3248500_3249289_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	8.8e-34	44.9
WP_044163804.1\|3249285_3249900_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_044163802.1\|3249896_3251102_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_044163800.1\|3251094_3251883_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_044163798.1\|3251924_3253766_-	sodium:proton antiporter	NA	NA	NA	NA
WP_044163796.1\|3254068_3254470_+	hypothetical protein	NA	NA	NA	NA
WP_044163795.1\|3254531_3254999_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_162038927.1\|3255075_3256041_-	AEC family transporter	NA	NA	NA	NA
WP_044163793.1\|3256501_3256996_+	hypothetical protein	NA	NA	NA	NA
WP_044163792.1\|3257007_3258294_-	MFS transporter	NA	NA	NA	NA
WP_044163791.1\|3258375_3259011_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044163790.1\|3259231_3260182_+	D-2-hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_044163789.1\|3260184_3260739_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_044163788.1\|3260881_3261328_+	peroxide-responsive transcriptional repressor PerR	NA	NA	NA	NA
WP_044163787.1\|3261569_3261953_-	YgzB family protein	NA	NA	NA	NA
WP_044163786.1\|3262079_3262940_+	hypothetical protein	NA	NA	NA	NA
3269976:3269997	attL	NA	NA	NA	NA
WP_044161443.1\|3270144_3271257_-\|integrase	site-specific integrase	Q5YAA6	Bacillus_phage	2.8e-118	58.4
WP_044161442.1\|3271419_3271743_-	DUF771 domain-containing protein	Q9MBW7	Lactococcus_phage	9.2e-14	41.7
WP_044161441.1\|3272203_3272515_+	hypothetical protein	NA	NA	NA	NA
WP_044161440.1\|3273218_3274202_+	hypothetical protein	NA	NA	NA	NA
WP_044161438.1\|3274504_3274993_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_044161436.1\|3275027_3275993_+	hypothetical protein	NA	NA	NA	NA
WP_044161434.1\|3276126_3276708_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_044161432.1\|3276719_3278249_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.6e-95	39.2
WP_052330419.1\|3278258_3279449_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_044161430.1\|3279486_3282585_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.5e-71	26.3
WP_044161428.1\|3282596_3283322_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_044161426.1\|3283405_3283909_-	hypothetical protein	NA	NA	NA	NA
WP_044161425.1\|3284014_3284599_+	SLATT domain-containing protein	NA	NA	NA	NA
WP_044161424.1\|3284608_3285961_+	nucleotidyltransferase	NA	NA	NA	NA
WP_044161423.1\|3286066_3286906_+	hypothetical protein	NA	NA	NA	NA
WP_162038928.1\|3287383_3287647_+\|transposase	transposase	NA	NA	NA	NA
3287146:3287167	attR	NA	NA	NA	NA
WP_162038929.1\|3287660_3287957_+\|transposase	transposase	NA	NA	NA	NA
WP_162038930.1\|3287956_3288073_+\|transposase	transposase	NA	NA	NA	NA
WP_162039020.1\|3288091_3288226_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048021

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection