CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP048054	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p2, complete sequence	0 crisprs	NA	0	1
NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	0 crisprs	NA	0	3
NZ_CP048055	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p3, complete sequence	0 crisprs	NA	0	1
NZ_CP048052	Piscirickettsia salmonis strain Ps-11091B chromosome, complete genome	3 crisprs	DEDDh,cas3,DinG,csa3	2	35

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1811 : 57111

unidentified_phage(32.14%)

tail,capsid,transposase,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036771639.1\|1811_2786_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-26	30.9
WP_087910670.1\|3740_3926_+	hypothetical protein	NA	NA	NA	NA
WP_087910671.1\|4019_4484_-	hypothetical protein	NA	NA	NA	NA
WP_162038711.1\|4871_5504_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.2e-10	35.7
WP_162038712.1\|5612_6134_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.7e-14	38.1
WP_032126138.1\|6561_6825_-	RNA-binding protein	NA	NA	NA	NA
WP_036771639.1\|7266_8241_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-26	30.9
WP_048876253.1\|8237_8894_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.3e-10	35.7
WP_048876254.1\|9151_10402_-	MFS transporter	NA	NA	NA	NA
WP_075275452.1\|10489_11551_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_036771347.1\|12364_13342_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_048876255.1\|13360_14362_-	hypothetical protein	NA	NA	NA	NA
WP_075275453.1\|14604_15579_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.9e-26	31.4
WP_017377662.1\|15666_15981_-	hypothetical protein	NA	NA	NA	NA
WP_017377663.1\|15991_16321_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	6.1e-13	44.9
WP_162038713.1\|16593_17385_-	hypothetical protein	NA	NA	NA	NA
WP_048876257.1\|17529_18324_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_036817087.1\|18705_19074_-	hypothetical protein	NA	NA	NA	NA
WP_048876258.1\|19386_20181_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_080963666.1\|22492_22732_+	hypothetical protein	NA	NA	NA	NA
WP_048876259.1\|22602_23619_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155049772.1\|24036_24990_+	hypothetical protein	NA	NA	NA	NA
WP_162038714.1\|25375_26329_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-25	31.1
WP_017375692.1\|26472_26706_+	hypothetical protein	Q7Y5W4	Haemophilus_phage	1.3e-06	42.6
WP_017375691.1\|26729_27431_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	9.6e-32	37.6
WP_036773107.1\|27414_27732_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|28019_28994_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
WP_027242588.1\|29332_29686_+	hypothetical protein	NA	NA	NA	NA
WP_036771953.1\|29702_31982_-	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|32444_33419_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-26	30.9
WP_075275454.1\|33468_34008_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	9.3e-35	44.2
WP_027242598.1\|34021_34606_-	hypothetical protein	NA	NA	NA	NA
WP_017375778.1\|34990_35302_+\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	5.6e-08	30.8
WP_017375779.1\|35298_35724_+\|head	phage head closure protein	A0A1W6JP44	Morganella_phage	3.9e-12	37.9
WP_017375780.1\|35902_36298_+	HK97 gp10 family phage protein	Q6UAX1	Klebsiella_phage	4.3e-05	39.6
WP_017375781.1\|36294_36645_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_017375782.1\|36644_37067_+	hypothetical protein	NA	NA	NA	NA
WP_017375783.1\|37068_37392_+	hypothetical protein	NA	NA	NA	NA
WP_017375784.1\|37448_37715_+	DUF4035 domain-containing protein	NA	NA	NA	NA
WP_036771950.1\|37718_39797_+\|tail	phage tail tape measure protein	A0A1J0GWA6	Alteromonas_phage	1.6e-50	31.2
WP_017375786.1\|39789_40131_+	hypothetical protein	NA	NA	NA	NA
WP_017375787.1\|40127_40799_+\|tail	phage minor tail protein L	W6EC15	Rhizobium_phage	1.4e-27	33.6
WP_144420832.1\|40728_41514_+	hypothetical protein	A0A0R6PHF9	Moraxella_phage	5.1e-42	41.1
WP_017375789.1\|41503_42061_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	2.7e-21	35.6
WP_027242568.1\|42057_44748_+	host specificity protein J	A0A0R6PIC9	Moraxella_phage	6.1e-111	32.9
WP_017375652.1\|44806_45235_+\|transposase	transposase	NA	NA	NA	NA
WP_036771347.1\|45262_46240_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_036771355.1\|46711_48148_-	hypothetical protein	NA	NA	NA	NA
WP_017375933.1\|48164_49157_-	ParA family protein	A0A1X9I765	Streptococcus_phage	5.0e-10	28.9
WP_036771347.1\|49556_50534_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_051929651.1\|50695_51748_+	ParA family protein	NA	NA	NA	NA
WP_036816420.1\|51751_52384_+	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|52787_53762_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-26	30.9
WP_087910670.1\|54717_54903_+	hypothetical protein	NA	NA	NA	NA
WP_087910671.1\|54996_55461_-	hypothetical protein	NA	NA	NA	NA
WP_162038711.1\|55848_56481_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.2e-10	35.7
WP_162038712.1\|56589_57111_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.7e-14	38.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP048053

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12001 : 56981

Streptococcus_phage(33.33%)

portal,integrase,transposase,terminase

attL 39204:39263|attR 61490:62055

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027242929.1\|12001_12385_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	9.5e-26	45.5
WP_075278733.1\|12471_12954_+\|terminase	P27 family phage terminase small subunit	Q9B019	Phage_GMSE-1	8.1e-14	33.3
WP_048876205.1\|12956_14288_+\|terminase	terminase large subunit	A0A1W6JP18	Morganella_phage	6.1e-112	46.3
WP_157894751.1\|14570_14927_+	hypothetical protein	A0A1X9I6B3	Streptococcus_phage	2.6e-25	49.6
WP_087910668.1\|15013_15400_+\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	2.1e-25	50.0
WP_036771649.1\|15437_16172_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-38	42.6
WP_048876202.1\|16218_16932_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.2e-11	31.2
WP_144420848.1\|18310_18496_+	hypothetical protein	NA	NA	NA	NA
WP_157894750.1\|18559_21844_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_017377509.1\|22024_22753_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-38	42.2
WP_075275482.1\|22846_23821_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-28	32.9
WP_027242596.1\|24134_24497_+	hypothetical protein	NA	NA	NA	NA
WP_027242595.1\|24536_25046_+	hypothetical protein	NA	NA	NA	NA
WP_144420849.1\|25277_26258_+	hypothetical protein	NA	NA	NA	NA
WP_036771347.1\|26723_27701_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_036771347.1\|28181_29159_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_155046636.1\|29173_29335_+	hypothetical protein	NA	NA	NA	NA
WP_027243211.1\|29552_29807_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_027243212.1\|29796_30084_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	9.6e-15	50.5
WP_036771347.1\|30578_31556_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_053093683.1\|32556_32769_+	hypothetical protein	NA	NA	NA	NA
WP_036771347.1\|32926_33904_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_075317322.1\|33890_35405_-	DUF1561 family protein	NA	NA	NA	NA
WP_047927782.1\|36200_36590_+	hypothetical protein	NA	NA	NA	NA
WP_036771347.1\|36505_37483_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
39204:39263	attL	NA	NA	NA	NA
WP_027243215.1\|40474_41497_+	hypothetical protein	NA	NA	NA	NA
WP_036774350.1\|41979_42708_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.4e-39	43.1
WP_048876194.1\|43947_44481_+\|portal	phage portal protein	Q8W629	Enterobacteria_phage	1.1e-19	33.3
WP_080963665.1\|44661_45003_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	4.3e-22	54.3
WP_080963664.1\|45183_45450_+\|portal	phage portal protein	G0ZT36	Aeromonas_phage	2.5e-09	46.7
WP_027243206.1\|45522_47388_-	UvrD-helicase domain-containing protein	V5K3E8	Pseudomonas_phage	7.9e-57	32.7
WP_146619416.1\|47693_47840_+	hypothetical protein	NA	NA	NA	NA
WP_017375910.1\|48183_48912_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_155046637.1\|48993_49485_-	hypothetical protein	NA	NA	NA	NA
WP_162038693.1\|50217_51374_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-49	39.5
WP_048876191.1\|51996_52425_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_048876190.1\|52417_52747_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_017377694.1\|52776_53505_+\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-38	42.2
WP_017375663.1\|53516_53666_-	hypothetical protein	NA	NA	NA	NA
WP_017377694.1\|53912_54641_-\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-38	42.2
WP_036774388.1\|56018_56981_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
61490:62055	attR	NA	NA	NA	NA

DBSCAN-SWA_2

60496 : 171823

102

Streptococcus_phage(50.0%)

portal,transposase,integrase

attL 80095:80154|attR 148441:150176

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036774373.1\|60496_61225_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-38	42.2
WP_048876188.1\|61398_62172_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.9e-10	31.6
WP_027243202.1\|62885_63821_-	hypothetical protein	NA	NA	NA	NA
WP_017375910.1\|64095_64824_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_155046639.1\|64989_65193_-	hypothetical protein	NA	NA	NA	NA
WP_051929623.1\|65292_68634_+	DEAD/DEAH box helicase	C3VNU0	Bombyx_mandarina_nucleopolyhedrovirus	2.6e-50	28.7
WP_036772541.1\|68791_69520_-\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	5.4e-38	42.2
WP_144420834.1\|69813_70209_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-09	46.2
WP_036815648.1\|70261_70990_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-38	42.2
WP_036772541.1\|71473_72202_+\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	5.4e-38	42.2
WP_027243197.1\|72372_72942_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	2.2e-26	38.1
WP_087910667.1\|72946_73630_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_036772541.1\|73781_74510_-\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	5.4e-38	42.2
WP_080963627.1\|74528_74747_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_036774644.1\|75726_76788_-	hypothetical protein	NA	NA	NA	NA
WP_047927488.1\|77296_78043_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	4.9e-18	29.9
WP_027243200.1\|78043_78448_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|78754_79729_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
80095:80154	attL	NA	NA	NA	NA
WP_036771293.1\|80268_80535_-\|transposase	transposase	NA	NA	NA	NA
WP_036771296.1\|80830_82726_-	DUF1561 family protein	NA	NA	NA	NA
WP_036771296.1\|83081_84977_+	DUF1561 family protein	NA	NA	NA	NA
WP_017375632.1\|85676_86012_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-23	51.5
WP_017375836.1\|86206_86410_+	hypothetical protein	NA	NA	NA	NA
WP_027243203.1\|86503_87298_+	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	2.5e-36	35.9
WP_080999971.1\|91348_92752_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_081000017.1\|93016_93268_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_048875857.1\|93668_94643_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.2e-26	31.5
WP_048876221.1\|95630_96086_-\|portal	phage portal protein	Q8W629	Enterobacteria_phage	4.3e-17	34.8
WP_016212398.1\|96180_96642_-	hypothetical protein	NA	NA	NA	NA
WP_144420836.1\|96816_97017_+	hypothetical protein	NA	NA	NA	NA
WP_157894758.1\|98744_100775_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_017377509.1\|100804_101533_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.2e-38	42.2
WP_144420837.1\|101674_102607_+	hypothetical protein	NA	NA	NA	NA
WP_017377511.1\|102636_103365_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_017377512.1\|103367_103640_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_017377511.1\|104490_105219_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_144420838.1\|105274_105895_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_017375910.1\|107043_107772_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_162038694.1\|107991_108894_+\|transposase	transposase	NA	NA	NA	NA
WP_017377667.1\|109563_109734_-	hypothetical protein	NA	NA	NA	NA
WP_017377666.1\|109878_110136_-	hypothetical protein	NA	NA	NA	NA
WP_036815609.1\|112036_112492_-	hypothetical protein	NA	NA	NA	NA
WP_036816769.1\|112735_113134_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_047927763.1\|113130_113394_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_027243210.1\|113807_114542_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.9e-36	42.2
WP_017377526.1\|114871_115732_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_157894756.1\|115993_116134_-	hypothetical protein	NA	NA	NA	NA
WP_017377525.1\|116133_116931_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_075275471.1\|117471_118446_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.3e-26	31.2
WP_048876214.1\|119217_119946_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-38	42.6
WP_017377521.1\|120454_120808_-	hypothetical protein	NA	NA	NA	NA
WP_017375910.1\|121735_122464_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_157894750.1\|123106_126391_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_048876213.1\|126699_127590_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275473.1\|128828_129005_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	1.7e-06	46.0
WP_027243191.1\|129121_129829_+	AAA family ATPase	A0A222YXS3	Escherichia_phage	1.2e-34	40.0
WP_048876212.1\|129782_130661_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_144420840.1\|130691_131123_-	hypothetical protein	NA	NA	NA	NA
WP_048876211.1\|131505_132210_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.9e-10	31.7
WP_162038695.1\|132229_132949_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.4e-38	42.2
WP_051929563.1\|132978_133368_-	recombinase family protein	A0A219Y912	Aeromonas_phage	1.1e-10	40.0
WP_017375910.1\|133390_134119_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_036815979.1\|134121_134730_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.9e-10	34.6
WP_155046641.1\|134910_135075_+	hypothetical protein	NA	NA	NA	NA
WP_157894755.1\|135188_135326_+	hypothetical protein	NA	NA	NA	NA
WP_027243184.1\|135318_135657_-	hypothetical protein	NA	NA	NA	NA
WP_052133264.1\|135670_136075_-	hypothetical protein	NA	NA	NA	NA
WP_017375840.1\|136119_136338_-	hypothetical protein	NA	NA	NA	NA
WP_157894754.1\|137324_138419_+	RepB family plasmid replication initiator protein	A0A218MNI2	uncultured_virus	3.6e-25	29.8
WP_017377655.1\|138760_139006_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_017377656.1\|139002_139389_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_036772434.1\|139476_140205_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.3e-38	42.2
WP_080963659.1\|140183_140804_+	ABC transporter permease	NA	NA	NA	NA
WP_017377658.1\|141149_141836_+	Fic family protein	NA	NA	NA	NA
WP_155082177.1\|142785_143004_-	hypothetical protein	NA	NA	NA	NA
WP_016212146.1\|143150_144890_-	PLD-like domain protein	NA	NA	NA	NA
WP_155046629.1\|145291_145444_+	hypothetical protein	NA	NA	NA	NA
WP_162038696.1\|145471_146002_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.6e-15	36.8
WP_036771347.1\|146076_147054_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_081000019.1\|147129_147300_+\|transposase	transposase	NA	NA	NA	NA
WP_048876210.1\|147340_148069_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.6e-37	42.2
WP_036771293.1\|148614_148881_-\|transposase	transposase	NA	NA	NA	NA
WP_155046692.1\|149176_151075_-	DUF1561 family protein	NA	NA	NA	NA
148441:150176	attR	NA	NA	NA	NA
WP_017377694.1\|151496_152225_+\|transposase	IS6-like element ISPsa2 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-38	42.2
WP_082884401.1\|152322_152445_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155046630.1\|152861_153026_+	hypothetical protein	NA	NA	NA	NA
WP_036771359.1\|154514_155243_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.5e-37	41.7
WP_036771347.1\|155370_156348_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.9e-47	35.9
WP_155046631.1\|156422_157073_+	hypothetical protein	NA	NA	NA	NA
WP_032126795.1\|159704_159965_+	hypothetical protein	NA	NA	NA	NA
WP_036772441.1\|159968_160241_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_017375910.1\|160316_161045_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_048876229.1\|161613_162585_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_157894752.1\|162857_163037_-	hypothetical protein	NA	NA	NA	NA
WP_048876208.1\|163449_164277_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-17	32.1
WP_036771289.1\|165130_165601_-	hypothetical protein	NA	NA	NA	NA
WP_155046633.1\|166494_166638_-	hypothetical protein	NA	NA	NA	NA
WP_075275480.1\|167844_168381_-	DUF1353 domain-containing protein	NA	NA	NA	NA
WP_017375850.1\|168797_169574_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_036771279.1\|169934_170663_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.1e-38	42.2
WP_155046634.1\|170732_170933_+	hypothetical protein	NA	NA	NA	NA
WP_048876229.1\|170851_171823_+\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

186969 : 191899

Streptococcus_phage(42.86%)

portal,transposase,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027242929.1\|186969_187353_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	9.5e-26	45.5
WP_075278733.1\|187439_187922_+\|terminase	P27 family phage terminase small subunit	Q9B019	Phage_GMSE-1	8.1e-14	33.3
WP_162038697.1\|187924_188521_+	hypothetical protein	A0A1J0GUY5	Halomonas_phage	4.7e-40	51.8
WP_157894751.1\|189537_189894_+	hypothetical protein	A0A1X9I6B3	Streptococcus_phage	2.6e-25	49.6
WP_087910668.1\|189980_190367_+\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	2.1e-25	50.0
WP_036771649.1\|190404_191139_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-38	42.6
WP_048876202.1\|191185_191899_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.2e-11	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP048055

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25559 : 41581

unidentified_phage(35.71%)

capsid,integrase,tail,terminase,transposase,head

attL 20055:20114|attR 42192:42483

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
20055:20114	attL	NA	NA	NA	NA
WP_027242943.1\|25559_25976_-	hypothetical protein	A0A2R3UA88	Siphoviridae_environmental_samples	2.2e-20	41.7
WP_027242944.1\|25972_26530_-\|tail	tail assembly protein	K7PGY0	Enterobacteria_phage	7.9e-21	36.2
WP_027242945.1\|26875_27391_+	hypothetical protein	NA	NA	NA	NA
WP_144420855.1\|28194_28410_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_036771330.1\|28483_29458_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
WP_027242946.1\|29838_30420_+	hypothetical protein	NA	NA	NA	NA
WP_075275490.1\|30455_30848_-\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	7.0e-24	45.0
WP_036771330.1\|30944_31919_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
WP_027242948.1\|31938_32124_-	hypothetical protein	A0A1J0GUY5	Halomonas_phage	9.0e-06	47.3
WP_027242949.1\|32126_32609_-\|terminase	P27 family phage terminase small subunit	Q9B019	Phage_GMSE-1	3.6e-14	34.0
WP_027242950.1\|32695_33079_-	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	4.3e-26	46.3
WP_027242951.1\|33291_34158_-	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|34783_35758_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
WP_027242952.1\|35855_36203_-	type II toxin-antitoxin system HicB family antitoxin	K7PJX6	Enterobacterial_phage	1.6e-16	36.4
WP_027242953.1\|36195_36450_-	addiction module toxin, HicA family	NA	NA	NA	NA
WP_027242954.1\|36594_36960_-	hypothetical protein	NA	NA	NA	NA
WP_069971681.1\|37492_38467_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.2
WP_016211078.1\|38643_38997_-	type II toxin-antitoxin system HicB family antitoxin	K7PJX6	Enterobacterial_phage	6.5e-13	34.8
WP_027242955.1\|38989_39250_-	type II toxin-antitoxin system HicA family toxin	NA	NA	NA	NA
WP_016212329.1\|39480_40071_+\|integrase	site-specific integrase	K4K6A1	Caulobacter_phage	3.2e-20	35.3
WP_075278739.1\|40136_40493_-\|transposase	transposase	NA	NA	NA	NA
WP_036771330.1\|40606_41581_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-26	31.8
42192:42483	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP048052

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048052_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048052_1

1098675-1098770

Orphan

Consensus_repeat	Method
CAGAGTGTCCTGAAGCCCCTTGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048052_1

>merge|NZ_CP048052|1|1098675-1098770|CRISPRCasFinder
CAGAGTGTCCTGAAGCCCCTTGAGATTGGGATTGAAAACCACCTACAGTACCAAAAATTTCTTCTTCTTGTCCAGAGTGCCCTGAAGCCCCTTGAG

>NZ_CP048052|1|1|1098675-1098770|CRISPRCasFinder
CAGAGTGTCCTGAAGCCCCTTGAG	ATTGGGATTGAAAACCACCTACAGTACCAAAAATTTCTTCTTCTTGTC
CAGAGTGCCCTGAAGCCCCTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048052.1\|WP_155046604.1\|1092936_1093077_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_036773793.1\|1090601_1090979_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378009.1\|1096269_1098015_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NZ_CP048052.1\|WP_053093668.1\|1093612_1094212_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379252
NZ_CP048052.1\|WP_036771696.1\|1094394_1095855_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NZ_CP048052.1\|WP_048875964.1\|1092089_1092869_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376573
NZ_CP048052.1\|WP_048875961.1\|1101917_1103321_-\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP048052.1\|WP_146619530.1\|1087828_1088086_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_144420647.1\|1093277_1093475_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378007.1\|1099828_1101772_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226654
NZ_CP048052.1\|WP_017378006.1\|1103440_1104070_-\|response-regulator	unknown	unknown	gnl\|CDD\|381113
NZ_CP048052.1\|WP_017377998.1\|1112685_1113216_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|284031
NZ_CP048052.1\|WP_036773465.1\|1109564_1111604_+\|NAD-dependent-DNA-ligase-LigA	unknown	unknown	gnl\|CDD\|236137
NZ_CP048052.1\|WP_027243145.1\|1111619_1112675_+\|protease-SohB	unknown	unknown	gnl\|CDD\|236978
NZ_CP048052.1\|WP_017378005.1\|1104308_1105028_-\|sulfate-transporter-CysZ	unknown	unknown	gnl\|CDD\|179898
NZ_CP048052.1\|WP_017376708.1\|1091123_1091525_-\|transposase	unknown	unknown	gnl\|CDD\|376573
NZ_CP048052.1\|WP_027242834.1\|1088834_1090142_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_075275277.1\|1114715_1114955_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379554
NZ_CP048052.1\|WP_017378004.1\|1105141_1108681_+\|chromosome-segregation-protein-SMC	unknown	unknown	gnl\|CDD\|274008
NZ_CP048052.1\|WP_017378003.1\|1108747_1109578_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367907

Protein	Function_ID	Function_description	E-value
NZ_CP048052.1\|WP_017378009.1\|1096269_1098015_-\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	0.000214736
NZ_CP048052.1\|WP_053093668.1\|1093612_1094212_-\|hypothetical-protein	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	0.000376208
NZ_CP048052.1\|WP_036771696.1\|1094394_1095855_-\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	8.47893e-06
NZ_CP048052.1\|WP_048875964.1\|1092089_1092869_-\|hypothetical-protein	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	0.00345182
NZ_CP048052.1\|WP_048875961.1\|1101917_1103321_-\|IS4-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	1.76184e-13
NZ_CP048052.1\|WP_036773465.1\|1109564_1111604_+\|NAD-dependent-DNA-ligase-LigA	gnl\|CDD\|236137	PRK07956, ligA, NAD-dependent DNA ligase LigA; Validated.	0
NZ_CP048052.1\|WP_017378007.1\|1099828_1101772_-\|hypothetical-protein	gnl\|CDD\|226654	COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms].	6.24409e-47
NZ_CP048052.1\|WP_017378006.1\|1103440_1104070_-\|response-regulator	gnl\|CDD\|381113	cd17569, REC_HupR-like, phosphoacceptor receiver (REC) domain of hydrogen uptake protein regulator (HupR) and similar domains. This family is composed of mostly uncharacterized response regulators with similarity to the REC domains of response regulator components of two-component systems that regulates hydrogenase activity, including HupR and HoxA. HupR is part of the HupT/HupR system that controls the synthesis of the membrane-bound [NiFe]hydrogenase, HupSL, of the photosynthetic bacterium Rhodobacter capsulatus. It contains an N-terminal REC domain, a central sigma-54 interaction domain that lacks ATPase activity, and a C-terminal DNA-binding domain. Members of this family contain a REC domain and various output domains including the cyclase homology domain (CHD) and the c-di-GMP phosphodiesterase domains, HD-GYP and EAL. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.63665e-55
NZ_CP048052.1\|WP_017377998.1\|1112685_1113216_+\|hypothetical-protein	gnl\|CDD\|284031	pfam06508, QueC, Queuosine biosynthesis protein QueC. This family of proteins participate in the biosynthesis of 7-carboxy-7-deazaguanine. They catalyze the conversion of 7-deaza-7-carboxyguanine to preQ0.	1.95217e-24
NZ_CP048052.1\|WP_075275277.1\|1114715_1114955_-\|hypothetical-protein	gnl\|CDD\|379554	pfam14319, Zn_Tnp_IS91, Transposase zinc-binding domain. This domain is likely to be a zinc-binding domain. It is found at the N-terminus of transposases belonging to the IS91 family.	6.98937e-12
NZ_CP048052.1\|WP_027243145.1\|1111619_1112675_+\|protease-SohB	gnl\|CDD\|236978	PRK11778, PRK11778, putative inner membrane peptidase; Provisional.	0
NZ_CP048052.1\|WP_017378005.1\|1104308_1105028_-\|sulfate-transporter-CysZ	gnl\|CDD\|179898	PRK04949, PRK04949, putative sulfate transport protein CysZ; Validated.	2.22151e-69
NZ_CP048052.1\|WP_017376708.1\|1091123_1091525_-\|transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	0.00109659
NZ_CP048052.1\|WP_017378004.1\|1105141_1108681_+\|chromosome-segregation-protein-SMC	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	0
NZ_CP048052.1\|WP_017378003.1\|1108747_1109578_+\|hypothetical-protein	gnl\|CDD\|367907	pfam04354, ZipA_C, ZipA, C-terminal FtsZ-binding domain. This family represents the ZipA C-terminal domain. ZipA is involved in septum formation in bacterial cell division. Its C-terminal domain binds FtsZ, a major component of the bacterial septal ring. The structure of this domain is an alpha-beta fold with three alpha helices and a beta sheet of six antiparallel beta strands. The major loops protruding from the beta sheet surface are thought to form a binding site for FtsZ.	1.17377e-13

>NZ_CP048052.1|WP_017378009.1|1096269_1098015_-|hypothetical-protein
MPITKQTKATTIQISIRALLSSTMEPCGQTIISSIDSSHQEIIRWLEFVKELPQIKESGGGVSFILESNTPLPEGFQQDLKDQCERLIANSKIFFNISSIAAKHHAAEKNSIEISEEIYEEIDSKHYATSPRQSVTEHSLSNHTDDDKDSSTHAHPIANTTQNNDFPPPPPNAADSSATASNLPFEQIQTQPASETVKNLGGSITYDQLLNLLKQEIQKAVAIIDKKIKNAKLPFSISTPFEDTKGRKKSILVLEEFIKDILTYPDQGNPDQPLTQELGMLVHTRLKDFYEDDGKMKGRRKTKTISMLFSEIKLMFQNITYANTAVSDDNGSPFPPPPPPLLEQDLLSLELTQFNDSELPLPPPPPPSPILLEDQQQLELNAAQPDLSADSHKAHMAVLGAKLRERQLSLGNETQSNSNSQPAPPPLPPKPVFSVGDLAPPNSGNTKPPLPPKPPLVVDDLTSSESTHAQCASDLTADKTVTFLEEIQQRKQQGLRSIKHSHPLQGPAPLDLNAQILKRRQNMQQTGTSDGKPINLAAALLFQCSQMNTQHSQSNNSNATNDNNDNWSDDWSDSASSPPSP
>NZ_CP048052.1|WP_036771696.1|1094394_1095855_-|hypothetical-protein
MIKVIKENEGAIVTKGQETILLTGSIYDGSNLGKSPAIIALSELGSGLFCAKATLQSENSCLSWLQELKETLGNEITFHLTGKQSKEDLAELQILCQQAEIEAQFPIPEKQPLLYSLATGVNANGIIEKEDLYEKTGGFSFSLTLTKEIEQAISELEKKIKDSWFTINTKGRTDSIILLKELKQNLEQLGESYIGPVNSESDLKFPKSLKEAIKDYSGSEAKNGRQQTTTVGGLLKTLDFHFTRYTVLTTKFTQVPVLTATWHTSEPSADTDSASATPMPDINESKSTPPPPPPAELKAGAKARREEEAAVTVLTNAMEFADDNAEDLPPPPPPSNPDLQQPLPDFNDSDFPPPPPPPPPSDEEQMPLADFDDIELPPPPPMDFETGPETQVSPIEEVNSGATPTDGTGPDTTEKKDSANITAEMQSIMARRGAIGGPDSETEAGEDDSWSDQEDNSGPNQSPSTLFQRQQSQSQEADNSNPLQYN
>NZ_CP048052.1|WP_053093668.1|1093612_1094212_-|hypothetical-protein
MRIITKPTTAKCNIQAYIRYLLSEPVRTSCTGLSDVLLNISHDSVNRFLLRENYRPEDLWTEVSEKIDLNNGVLSVDDMVIDKPYSNAEKTDLIGFFYSGKHHCVVKGVNVITLYYTDQHDVSVPINFRIIDPDEGKTKNEHFREMLQQVLSWGLQPSWVTRKRRYLGRYFAHPMMQNRRAKRDDYKPSAVRVTQRYVP
>NZ_CP048052.1|WP_144420647.1|1093277_1093475_+|hypothetical-protein
MLGDFASLDVQNTYRGSDAYVSEDIIRLFSIANSMPRLYFLINFRFSMLEYQQSPAASHGVLSTG
>NZ_CP048052.1|WP_155046604.1|1092936_1093077_-|hypothetical-protein
MLSTPWLAAGAVAVRFKQSIVGMKVVYKSNGTTLRARSEQKRTLAQ
>NZ_CP048052.1|WP_048875964.1|1092089_1092869_-|hypothetical-protein
MHYVINKLKSQIEKQKATLLDDEGSLSIESLLSSDKFQSIINNCRSFKSRFYTPFVTLILFIRQVLSPDKSCKNTVATFLASVSTEDNNNIPSSNTGPYCKARQKLPIETLESLVKLSGDSLSKSSNARWKIYNREVKLIDGTSLTMADSEENQSRYPQHDAQKAGAGFPIMRLVAIMSLTTGGIIDYAVGAYKGKGTGEHALLRQIKDSIHKDDIVMGDRYFPCFFVMGDLQSIGADGIFKAHSHVSVATSVGILHIQ
>NZ_CP048052.1|WP_017376708.1|1091123_1091525_-|transposase
MGSKNHLVIWKKPHKPDWMTQETYDSYPDQMTVREFKIKGEVYVTTFQDHKKYNKVALANHYKQRWHIEINFNSLKTIMSMDHLRSKTPDMVHKERKRRYLGRYFAHPMMQNRRAKRDDYKPSAVRVTQRYVP
>NZ_CP048052.1|WP_036773793.1|1090601_1090979_-|hypothetical-protein
MLSTPWLAAIAVHFLAYNLIRTLIAEACRNTERLPIQVSFKGVIQLFNSFVSLLSFSADCNKAHAILLHAIIKNKVGNRPGRIEPRAVKKRPKAFRRLNKSRELEKAEITKRMKKNSNKKCSSAP
>NZ_CP048052.1|WP_027242834.1|1088834_1090142_+|hypothetical-protein
MKFIYPGINAPLDTEKSLYAETTQGYFSHKESGKALDFNFIKKQESYFSQWDKRTAFTCEEYKALTHQQRLQLYRLHTTRWNYTLSLLLKDPGAGPDSPLYAEKQFLQNLNENEEMRKLYAGWFIDYVESREGETSKAVEALFKKEMQLKPECDLSKEKQIAVKVRGFRDEITELQAWLMNGSSAERIAIEKYDTKAVNQFIKYQLGQVSKSEFNKTFERAQSKCNKVLKNALHLTTSAASILTEKKIDLNSSVEWERLKNSQHLQKAVLILHKSNINLADSWDTLKDNSHLQKAVLTLHHESSINLTEHWDKVKNNSPLQKALAASYDYLNAERSSWSKMHHNHGIRQTHKFIRHLMASENQTLSGIQAEMQQWLHGYGHFSRASGSASNSRMSFALQSGLCPQADTPPTLLFNTSLQATEVEQEVTNQVTLSS
>NZ_CP048052.1|WP_146619530.1|1087828_1088086_+|hypothetical-protein
MFRQKCSHSYRYYAVAMPKINMLTDFTDGDFERIHKAHWNIERFHRATKQLCSIEKFQVRTTECIKNHIFRCEPWSAKHGVSRPR
>NZ_CP048052.1|WP_017378007.1|1099828_1101772_-|hypothetical-protein
MKNNIYLNKLPSFLILITGITISLFLFYSLNKSHNLEASSHFEELATDTQQAIQNNINKNIAALNILKSFYESSDFINFNEFTTFTNSLLERDLAIQALEWIPNIPHSKRHDYVKKANQFFKNFNIKEKTAQGKMLIAKTKTNYFPVYYVNPVRGNEKAIGFDISSSPMRNKSLEKAALTGRNVATHKITLIQEEKGNSYGFLLFNPVYHSSSPQDISPKSLKGFVLGVYRINDILGHALNFSAKNNLIIFVKERINNNTLSPIFQNNGKQEINSHLSYQSTFTVADKKWPITIYPSHDFIKEHKNHLPMIILFAGVIISLILAAYLWLLVNREVRVKNLVEERTEQLNELNSKLTVLNEELDQKVMERTQKLKENQEQLIQSEKLASIGQLAAGVAHEINNPIGYIMNNIEIMGEYLDSIKAITQQAEACSKTLTSNDIQIKNDQLQQLKNTLEQEDINYVIDDTEKIIQQSLEGAEKVKNIVLSLKSFAHSDTDNKEEFDLNHCIEQALTITQNELKYKCKIIKNLSPLNPLLGYSSQIGQVIMNLLINAAHAIKESGTITITTQQIAGFNKLTIEDDGYGIHKDHLAKLFDPFFTTKSVGEGTGLGLSISYGIIKKHQGSINVESTVGQGTVFTIQLPNHSHHS
>NZ_CP048052.1|WP_048875961.1|1101917_1103321_-|IS4-family-transposase
MHYVINKLKSQIEKQKATLLDDEGSLSIESLLSSDKFQSIINNCRSFKSRFYTPFVTLILFIRQVLSPDKSCKNTVATFLASVSTEDNNNIPSSNTGPYCKARQKLPIETLESLVKLSGDSLSKSSNARWKIYNREVKLIDGTSLTMADSEENQSRYPQHDAQKAGAGFPIMRLVAIMSLTTGGIIDYAVGAYKGKGTGEHALLRQIKDSIHKDDIVMGDRYFPCFFVMGDLQSIGADGIFKAHSQRKYDFRKGRKLGSKNHLVIWKKPHKPDWMTQETYDSYPDQMTVREFKIKGEVYVTTFQDHKKYNKVALANHYKQRWHIEINFNSLKTIMSMDHLRSKTPDMVHKEIAVHFLAYNLIRTLIAEACRNTERLPIQVSFKGVIQLFNSFVSLLSFSADCNKAHAILLHAIIKNKVGNRPGRIEPRAVKKRPKAFRRLNKSRELEKAEITKRMKKNSNKKCSSAP
>NZ_CP048052.1|WP_017378006.1|1103440_1104070_-|response-regulator
MPSLLLVDDEPHIIDALKRLFRREKYTLHCAYSAKEGLDILAQQHIDIILSDQRMPSMLGSEFLAKAQAQSPQTLRIILSGYADTKEIINGILNNHIHQFLEKPWRANELREHLRHLINLMDKNQYTQKNQSDNHYTRTAALSFNKNGAIKSINLYFCALLGQKPEHILSAPLTSVINYNQKQLKEILSYVNNHGHWQGKVTLANSTQD
>NZ_CP048052.1|WP_017378005.1|1104308_1105028_-|sulfate-transporter-CysZ
MSGFHYFLNGLNFILTPKMRRYLYLPILLNIILLLVLSYLGVHGIEVITNHVSTSLPHGLHFLRPIATIILSLALITLLVFSFTTLASIIGAPFYSLLCEAVLQKKDHQLPQDNITALIKDMPRLIGRELIKLRYFIIRVMILMILLFIPGINLIVSLLWFIFNCWMQAIQYIDYPMDVLKHPFKQTLKATRQTPLTAMSFGLVCFVCTLIPLLNLIAIPAAVAGGTLLWSERIQPLLK
>NZ_CP048052.1|WP_017378004.1|1105141_1108681_+|chromosome-segregation-protein-SMC
MRLKKIKLAGFKSFVDPMTVELPSQLAAIVGPNGCGKSNIIDAVRWVMGESSAKNLRGESITDVIFSGSSARKPVSQATIELIFDNSQGKLVGPYVSYSEISIKRIVNREAQSSYFLNGTKCRKRDIADVFLGTGLGPRSYSIIEQGMISRVIEAKPEELRVHLEEAAGISKYKERRKETERRIRHTRENLERLGDIREELGKQLSRLHQQAQAAEKYQNFKKEEREVKGQLYIQRWKSLQTQHGQEQKKIQEHEVIVEKQRAGQQHIDASLEKERLALSEASEKLHACQADYYQAGNEVSRLEQQIEHATTRIRETGQEMARLNTSLEKARSELAADEQQKVLLSAQEEALEPETELLQNAVDEAALSAEEAEVSYRQLEKERESLLQQVALCRQEAEVEQTRIRHMEEQGQRLQQRLERLRAETHNSDLISLEVGLEDVQGQQRELEEKEQELQLGAEEQQQRLIQQRQLIEQQRKGLEQQRGELHPLKGRLASLEALQQAALFDVNADSASSVKTWLETQGLIASKQLAQSLRVQEGWETAVETVLGDNLQALYTPGYQVNACVAELEMSLICIDQPLALNVNTQVAQGHENQAGILKLTDVIEPGESLPSQLQHVYLAEDLLAALRIRSELKSYESVVTVDGLWLGVNWLKVTKRDDSQSGVIAREKELMTLRQQELALEESICLHEEQLSQSQEVLMQVEAQVKSVQQQAQALQRELAEVKARVSGRLAHIEQVRARLAVVEHELSEALELFNEEQEEIKIARQRLEIAVEKMAELELQRQALESGRVEASRTTQEARQQLESLKSQYQQKQMQLQRVQSEQAGIKAALQRLEELLGRDKVRLVELEQSRIGLEEPLEEQRMLLDEQLERQLSFEDRLKTVKDQAQAHENQVRTFEKQLHEQMNQVAHAREALEQGRMQAQELFIRRQSVEEQLVEAGFQLRGLLEIYQEGCDVKELETALEDIGRRIQRLGVINLAAIDEYAGQSERKVYLDAQHDDLTEALDMLEAAIRKIDKETRTRFKETFDEVNGHFKLLFPKLFGGGSATLELIGEDLLEAGVALMAHPPGKRNSTIHLLSGGEKALTAAALVFAIFQLNPAPFCMLDEVDAPLDDANVGRFCRLVEEMSESVQFIFISHNKIAMEMADQLVGVTMREPGVSRLVAVDIEKALEMAEE
>NZ_CP048052.1|WP_017378003.1|1108747_1109578_+|hypothetical-protein
METFLKVLVLLVGILLVWVFIWEGLRRLKVWRIRKWGVKRPLQMRSGDPLAEDDIVDDVTDRQNTEDNQQNQSQHDRQADTVSARAPEPNHIILNIYIESKSTGFLAYALFSLLKRSGLIFNDELQVFEAKNEQGEVDFYITSAVAPGVFDIKNAMVSIPAVSVFARPDLQTNPRMSFFKLLESTHTIASELDGRVLNMRREILSEASVSADYLSVVNTYAVAESTAAALSASNSTSIVVDESMQDDNHVYQENESHVIADTRVDADSNKDQHVAG
>NZ_CP048052.1|WP_036773465.1|1109564_1111604_+|NAD-dependent-DNA-ligase-LigA
MSPAKLKRELVSDARVDELVKQLNLYSEAYYSEDDPLVPDSEYDRLFNELQQLEADYPELKQVDSPTLRVGGTILAEFTEVQHQSPMLSLSNGFNDQDIYDFIKRLKVDEDACFFCEPKLDGLAISLHYQRGRLVLAATRGDGTTGEDVTENVKTIRSIPLRLHSNNPPEFLEVRGEVFMMKSGFNKLNDQLRETNQKTFANPRNAAAGSLRQLNSKVAASRPLSFYAYSLTHMVGIELAQSHHERLALLASWGIPVNGDARCAAGTKGCLVFYQSILKVRDQLNYDIDGVVYKLDDIAAQEKLGFTARAPRWALAHKLPAEEEITIVKAIEFQVGRTGALTPVARLEPVHVGGVVVSNATLHNMDEVERKDVRIGDSVIVRRAGDVIPEIVKTIIENDTQSKAHAARPKLVMPDKCPVCDSAVERLAGEAVSRCMGGWRCKAQRKEALKHFISRKALNVDGLGEKLIEQLVDLELVQDAADLYQLTLEQLAGLERMAEKSANNVLEALEKSKVTTFGRLLYALGIRNVGQATAQVLAQRFGNLAALLAANTEELHAVDDVGPVTSQFILQFFSQQENQQLIERLQALGVCWPEQDKPLLAVRALQGEVIVLTGTLHGFSRDEVKEKLEQLGAKVTSSVSKKTTLLIAGENAGSKLDKAQALGVPVKNENDLKVLLGSN
>NZ_CP048052.1|WP_027243145.1|1111619_1112675_+|protease-SohB
MITQLLADYGLFLIKTATLVAAILIVFSGLLALAMKNRLAKQKGSLEVEKLNDHYDDLKETIEIEVLDKKELKALEKERRKEEKQERKDKKKNKSKETETDDEDAASAARIFVLDFDGDIEASAVHALREEVDALLTFINEKDEVVVRLESPGGMVSPYGLAASQLARFRSKGVKLTIAVDQVAASGGYLMACVADRVIAAPFAVLGSIGVVFQMPNFHRVLKKHDVEYEQLTAGDYKRTLTMFGKNTKEGREKLQEELEDIHYLFKNFVGEYRPQLDIDKVATGEHWFGQRALELNLVDELITSDDYLLSRADEHDIYSVNYMEKQTLADRLGIMARALLGKLATAGVKR
>NZ_CP048052.1|WP_017377998.1|1112685_1113216_+|hypothetical-protein
MQRKAIVLLSGGGYSSLCLYLARSQGYLPYALSLDIPKRHFQLDSAQQFARDVGVAEHQVIAMNENSLSDSKALTYYSSLLSFAVNWAQELSAQDIFIGLHPSAEHTLEYMVEWLQSYQELINLSSTTAIRIQTPLLFMSDKKREQTAEQFNLKLPEPVSKLKSKKKKFIQRIFSE
>NZ_CP048052.1|WP_075275277.1|1114715_1114955_-|hypothetical-protein
MANRDNIPRSVVEVVVKMLSCRTKFAGHDEYSCSNSGCKHTKVVTYTCKSRLCSSCGKKPLSNGLLHRISYSQSANTST

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048052_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048052_2

1336860-1337277

Orphan

Consensus_repeat	Method
GGTTCTACTTTTGAGGNTTCT	CRT

6 spacers

The CRISPR arrays of NZ_CP048052_2

>merge|NZ_CP048052|2|1336860-1337277|CRT
GGTTCTAAGCTTATAGATTCTTTACCTGGGACTGATACTGCAATTTCTACCTTCTACTTTGAGGTCTGCTTCAAGGTTCTACTTTTGAGGGTTCTGCTTCTCAAGGTTCTACTTTTGAGTTCAAGGTTCTACTTTTGAGGTTCTGCTTCTCAAGGTTCTACTTTTGAGGGTTCTGCTTCTCAAGGTTCTACTTTTGAAAGGTTCTACTTGAGGGCTTCTGGTTCTACTTTTGAAAGGTCTCTAGGATGAGAGGATTCTGCTTCTCAAGGTTCTTTTGAGGTTCTGCTTCTCAGGTTCTACTTTTGAGGGTTCTGCTTCTCAAGGTTCTACTTTTGAGGATTCTACTTCTCAAGGTTCTACTTTTGAGGATTCTACTTCTCAAGGTTCTACTTTTGAGGATTCTACTGCTCAGGACTCT

>NZ_CP048052|2|1|1336860-1337277|CRT
GGTTCTAAGCTTATAGATTCT	TTACCTGGGACTGATACTGCAATTTCTACCTTCTACTTTGAGGTCTGCTTCAA
GGTTCTACTTTTGAGGGTTCT	GCTTCTCAAGGTTCTACTTTTGAGTTCAAGGTTCTACTTTTGAGGTTCTGCTTCTCAA
GGTTCTACTTTTGAGGGTTCT	GCTTCTCAAGGTTCTACTTTTGAAAGGTTCTACTTGAGGGCTTCT
GGTTCTACTTTTGAAAGGTCT	CTAGGATGAGAGGATTCTGCTTCTCAAGGTTCTTTTGAGGTTCTGCTTCTCA
GGTTCTACTTTTGAGGGTTCT	GCTTCTCAAGGTTCTACTTTTGAGGATTCTACTTCTCAA
GGTTCTACTTTTGAGGATTCT	ACTTCTCAAGGTTCTACTTTTGAG
GATTCTACTGCTCAGGACTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048052.1\|WP_017378239.1\|1347633_1347903_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378240.1\|1346007_1347285_+\|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC	unknown	unknown	gnl\|CDD\|234978
NZ_CP048052.1\|WP_036771505.1\|1348107_1348608_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378245.1\|1341612_1342341_+\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|235387
NZ_CP048052.1\|WP_036817286.1\|1337333_1339646_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378258.1\|1325944_1326742_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378253.1\|1331859_1332270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378242.1\|1343762_1345364_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185052
NZ_CP048052.1\|WP_036771503.1\|1348768_1349872_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378254.1\|1331517_1331853_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_027242796.1\|1340318_1341590_+\|phosphopentomutase	unknown	unknown	gnl\|CDD\|235430
NZ_CP048052.1\|WP_129556634.1\|1330974_1331517_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378659
NZ_CP048052.1\|WP_017378249.1\|1334823_1336563_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378250.1\|1334012_1334246_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378243.1\|1342603_1343746_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
NZ_CP048052.1\|WP_017378257.1\|1326771_1329891_+\|DotA/TraY-family-protein	unknown	unknown	gnl\|CDD\|275142
NZ_CP048052.1\|WP_157894728.1\|1345858_1346011_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234978
NZ_CP048052.1\|WP_017378256.1\|1329921_1330671_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017378252.1\|1332260_1333226_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|379588
NZ_CP048052.1\|WP_144420661.1\|1333192_1333780_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP048052.1\|WP_129556634.1\|1330974_1331517_+\|hypothetical-protein	gnl\|CDD\|378659	pfam11393, T4BSS_DotI_IcmL, Type-IV b secretion system, inner-membrane complex component. IcmL contains two amphipathic beta-sheet regions, required for the pore-forming ability which may be related to the transfer of this protein into a host cell membrane. The icmL gene shows significant similarity to plasmid genes involved in conjugation however IcmL is thought to be required for macrophage killing. It is unknown whether conjugation plays a role in macrophage killing. This is a family of DotI/IcmL proteins of type IVb secretion systems, that reside in the inner-membrane. It carries a single transmembrane helix in the N-terminal conserved region, has an extra-periplasmic domain, and is conserved in all T4BSSs including I-type conjugation systems (TraM). DotI/IcmL (and DotJ) may form an inner membrane complex that associates with the core complex.	2.61185e-52
NZ_CP048052.1\|WP_157894728.1\|1345858_1346011_+\|hypothetical-protein	gnl\|CDD\|234978	PRK01747, mnmC, bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC.	4.10378e-21
NZ_CP048052.1\|WP_017378257.1\|1326771_1329891_+\|DotA/TraY-family-protein	gnl\|CDD\|275142	TIGR04346, DotA_TraY, conjugal transfer/type IV secretion protein DotA/TraY. Members of this protein family include transfer protein TraY of IncI1 plasmid R64 and DotA (defect in organelle trafficking A) of Legionella pneumophila.	5.1187e-31
NZ_CP048052.1\|WP_017378245.1\|1341612_1342341_+\|deoxyribose-phosphate-aldolase	gnl\|CDD\|235387	PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional.	5.48932e-76
NZ_CP048052.1\|WP_017378240.1\|1346007_1347285_+\|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC	gnl\|CDD\|234978	PRK01747, mnmC, bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC.	8.51905e-110
NZ_CP048052.1\|WP_017378252.1\|1332260_1333226_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|379588	pfam14378, PAP2_3, PAP2 superfamily.	6.58428e-30
NZ_CP048052.1\|WP_017378242.1\|1343762_1345364_-\|hypothetical-protein	gnl\|CDD\|185052	PRK15097, PRK15097, cytochrome bd-I ubiquinol oxidase subunit CydA.	0
NZ_CP048052.1\|WP_017378243.1\|1342603_1343746_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	4.22799e-128
NZ_CP048052.1\|WP_027242796.1\|1340318_1341590_+\|phosphopentomutase	gnl\|CDD\|235430	PRK05362, PRK05362, phosphopentomutase; Provisional.	0

>NZ_CP048052.1|WP_017378249.1|1334823_1336563_+|hypothetical-protein
MKFIKLKQKFILVLQLVDGLSGRGATKHQGKARSTEDKKDLVSEVEKILSVGFLEGLSAVVTDSGRSKQAEVLTRTRENIASLLEDSEVKEKLGLLTTAKIAHFEVVYKYLLGEEGEELDALVQALFAQKSTNSQEIDFCRYEAVEGLNSHFELKANIRPRKEFFVKFYHEMKRANSEISDAKETIEEINKKKSAADSSARRKTNLVTSQSDVLTSIATLYIQGDRERGLKSHSESYFNKIFGPYLEFNGGSPVIAPGYSLVDGNSDFEQILAGIVDNCQRKRTFWARVWGKLQAGKISALLLEAADKDCSKTALKINSGNVRAREAFSSNWIGNKPSECQAEAKALLDEFNRDKHLLKILPKTIEAGEAKKAKLLDDFARKVADYGKELKSAFNAIRSFRLLVQKAEKKGAAVGGLDSQVKDAEGGEKPQQATFLQKELQLTGERKVDGAIIVKHIEGIADNEQLLSLYDKLKEKEYLIKGNLLRIFSHFRTTMSGEAVKCSETWHTIEAAFTNRVRSNHQAMDGSEQGWTQLVTNYPFLRNHMQAQIVAASDVLLFRPALEQSTEVSPEELSCMAHL
>NZ_CP048052.1|WP_017378250.1|1334012_1334246_+|hypothetical-protein
MKKSFVIILVIIALFSCFMVSFIAGGANGFLKIFSSLLSLLEWGILGFIIFVTGLFVIFGSIVVCAAVWDELFKKKK
>NZ_CP048052.1|WP_144420661.1|1333192_1333780_-|hypothetical-protein
MIKIKKLPCILTLMPLLLSSLSSCSIYPVDLGTDATYKSPVTASALPFPIQVAPIKFTKAGLYKHYRFYSTERFPATLRLTVQSMLTQANLGSPLNNNTHLKKASTLKIKLYPITINDSSKNTVVGTFSFSATLENNQQTLWNKKLSATITGSSLDNLFKQAAQEIAYAINYTLTQECRFNINTVQCNGERFKIT
>NZ_CP048052.1|WP_017378252.1|1332260_1333226_+|phosphatase-PAP2-family-protein
MEVTGDKAATCKRNNVLITFISYLNKNFSYLDKATILLSTILILLSFLFSYINCKYTHYLSSVTPPLFIGSILIILAIMLTLLALPLCQALPKISLVFKLIGLYLIAWVAMLLAYNMQFTPFDPLDDYLYHIDLALGFDLGLWMQWLHQHPYIQQSLLYIYDSLEYQAFILPIIACFLVNQQDIELFLAKFAFLNLIGCLIYYFWPTASPASVVNSPYFTQGQLDIVLQFKQLHEGIQPSVIGAGLISFPSFHVIWSALFTCLFKKKRYLFWPLLTLNIILWFSTVLLGWHYIFDVIAGLILVLLAIVIFDYVILNRSPLH
>NZ_CP048052.1|WP_017378253.1|1331859_1332270_+|hypothetical-protein
MFKKIVSSFKSAASYSFLKESFSFIFSTSKKILTVSPDNKNGEKTQINELEISNHEIKKAKSVFRFLMWVYFLFFIIIFTYTLVNIVNHSLMTAIIGIAASLACLSLAFKYHFWLTQIKVGQLGITLKEWYESLWK
>NZ_CP048052.1|WP_017378254.1|1331517_1331853_+|hypothetical-protein
MDYNSTFTKVMRLYVGHRFFWKGDEISHEDVLSLSGNIIETLLRKVNLTYSFLFDSKISYSRKRLEGQSQESIHINSDKETAFILLLIVIDIMEEAVIKSGDDVYLDNYIK
>NZ_CP048052.1|WP_129556634.1|1330974_1331517_+|hypothetical-protein
MLISILINVALLAAFIVSLSSRPEPKYFATTSNGQLIKLHSLSFPVMNDSAVISWLSDIVPNINSLDFLNYRTQIREKRKYFTSYGWEQYLKAFQPIVEKIRDNKYVARAVVSDVPVVIQKGNIDGVYSWRLQVPMIITYQQGASRDTQNVIWTVLIQRSNEHADSLFGIAQIIQKGDET
>NZ_CP048052.1|WP_017378256.1|1329921_1330671_+|hypothetical-protein
MPKPGDSDNNPLGQQPEEFEMVDGQPVPIPASGAQAGDDGSELEDLPAQDQAEAAAEKEREEREKEEKKKRLTEMRDALGKTHEDMGKQPERARSISKQHRDAGNDLTQRMEKLSEIDPKNVTDEEKADFLRELRALGEEANRLAMSDKEKVPLRAGFLGTFISLIQKFVAWNREDNVDFQLEAIKDQAEALKQKFDSELSEYNTAGADGPKPGGTGPRCADDEEDADNQRDEEKKKKQKEEMMKELAM
>NZ_CP048052.1|WP_017378257.1|1326771_1329891_+|DotA/TraY-family-protein
MLSLVPGPGNDQSVYFLWQIFGNIIYWVSGQETSDTDLTIIHYVISAFNSGLLSLLLVIYALVIFIGTLNTAHQGEFLGRNWSSLWMPIRAIFGPLCVVPVKYGFCLAQVILLYGVLVGVQLANYVWNSLETDLDGTAIPSVPVSLLNSVKENVGRAVLYRSVQKVSDSLGLKTTDLPSTRLKSSYACDEVQGANQFYNIGNTPTFCANSQSLIPTSLLPKLTSYTSQLCQPNKFDNFIAAMRWFYQDPYNDNGMTIKPAGVPGLSSGTLAQQCVDAVDSLLTGGSSSMEKVYNYNFSVAGKNQVIALKANLGDAYSHDNNDNKERYVNAVGHIAFNFENQNYSSGKASDYSKSADEFTRIIVNDLYKNDVKQAHSSLNDYLSELNKNLLNVAGDATNRLVKNTNVPTDVSVRQGTDIVTHSVNCNNYLINGNLSLRYLECLQLKDSGQTFSMYDVSNKDYPFENYIKSWWIGGGSYLAVDKIMNYNLEMVKHKLDQEISYPGMNIVSTVHYEIPLSVNYYPLIDGHPPRYQNSEGNTEYASDVKTTIVSANAGVTSVTNTIPDGLSMVSSSWASNVYHAVPACIEESGSQACKDIIALQTQLLNLPSEWRPPFIYLFNLVKSGSKSAMKSISDSPKDVTFLNNVFYFLKQNGIYQPTTTTAVPVYAVIGRIFDQVGGNGLSSDMTAVMNEFYNLGMPSSNLFSKIMQAQQVGADVVQAVIDSFTNIFENYQEQFKDIQSTAESMISDWSWGAGIAGALGGLFGAGSIGTAAAILGQTAVQLYMATQIGNLSMSLAWLPIALVVLGSLFTAAISFVVMMPLIPYFLFWAGTIVWALSILEGLVAAPLVALALVYPEGHEILGHGSPAIKIALNIIFRPVLMVIGVIAAMALTYVLITYSAQGFHLVAPLILNNFSASGMVNGIVSCFLIFIYASFMMMAFSKCFSVIYLIPDKVFDWIGASAGHRAGAEEVQQLQGKTEGMGSQAGQSMGSGVQQGIQAKQTETQSSVQAQSQDIQVAEKAGEAAGSEARSAAEMAASL
>NZ_CP048052.1|WP_017378258.1|1325944_1326742_+|hypothetical-protein
MNIIKKTLIVFAVISSVSLNSIQVSHADPVSMAVLLKELYSIQGNQKAGNKELERANSALNSGFPPDTLKSFENLSPQSPQLSKFSEYMQDVSHSGSKSKENNSVKAQIKNLSDNKYLMSLVQGQYYDKEVKENLLSAGASPQAVVLATAVLSQVNLNEKTNSQLLKAVQAQLSKNWQDGLRVSTRDQLLRMISLQLSVSNLSQYQQLRTQELMALLQLAGLMDHGALLGKLTEINNKSIGIDKKLSEVNRQLDIINRHFKKSSN
>NZ_CP048052.1|WP_036817286.1|1337333_1339646_+|hypothetical-protein
MPIPEAPKNNDARLNLKEYAAPTGKYQAEFQEKSAASKQKLIDLLQEYETRYNSNFVDYLGDLLKIKADLIIPFLKKLNAFIEDTKGSRSDAIQFLLDTQHLAEMFPSQRETALFEVVCEFVFDIKSIELDEFIQALYERTPDSQPGEVDNFKLQALREISDQLSLNVIVPSGEDYLKGRQQVEQSLASNKEKLQEIESLRNGLSKHKSHAVTKQNEVLYKIIGLYVHGSEQDGLKSHGRKYFDRLFAPYFKFNDGDPQLSVEYTGDGFDFEDILKGIVENCKEKRTVWAVMGRQLQAGKIAKLLLEEASRYTEETGLRNIEGDVRRGISFSSSWDIKGPPYKQKIIIQTLNENITEVEGEIACLDEEKKGLVSAVREDINKAGAHVKLRIEELIERKRQEEERKKREEAERKRAELAERQKLAECKELLPEAMIKDLEGLVTPIASIPAEQQILINSANLKLVMQCISDIQGQGNEVLKALHYWLAKNYDFLKKPENNAVSDRSTTMSGQKEACSSEWNVIELTLAKCMFANAEKCDALASIPELILQNPFLKLYDRLQPSAEADAVDGAEGGAVGGARADVVDGAGARSGVESIARDFEVVMKSQKLITNIDAALGRDKKSKKNDLELIRTQVQSVPDNRVLEKLFAWLMTQGYLWKTTGFSFTNTTMFGKERYCRSTWGKIEECFAKKMTTNSCQAALHGRLDVKGIDKLIEDNPFLNKHRSLIKKTQKNFDLEAMELETEGRLFERQQSAETSSIESSLEVSYANT
>NZ_CP048052.1|WP_027242796.1|1340318_1341590_+|phosphopentomutase
MLKGRVIILLMDSFGIGASEDAEQFGDVGADTFGHIVEHAAHGLADSPERQGALKLPYLASLGLEQAAKQSRGRPIAKTITGDLELPIQGVYGYAIEQSCAKDTTSGHWEITGVPVEFEWDYFHKTAECKTPGQDSSCFPADFMQRFLVETGLTQGVLDAGHASGTEVINRLGDEHCLTGKPIVYTSADSVFQIACHEKSFGLERLYGLCETARELFDEMGLNIGRVIARPFVGNKAGEYQRTGNRHDYSVPPPQPTLLEYVVKNGGEVISVGKIADIFADRGISHKVKATGITELFDQSLTAFKRSKAGSLVFTNFVDFDSQYGHRRDVAGYAKALEYFDSRLPELMDSMEPGDLMILTADHGCDPTWPGSDHTREHIPVLAWGPGLQSKNIGQRHSFADIGQSIADFMGLAPLAHGQSFLS
>NZ_CP048052.1|WP_017378245.1|1341612_1342341_+|deoxyribose-phosphate-aldolase
MDKTKKTVMALIDLTSLNLDDNDQTIVDVCAKASNRLGKVAAVCIDPKFVGLAKKLLKNQHIAVASVVNFPLGNKSIETVLADINQVLIDGADEIDLVIPYQDYLQKGSSERALHLVKASKALCNDKLLKVILETGELKSRALIFKAACDAINAGADFIKTSTGKTAVGATVSAVKAMLDAIQINLRYHPHVGLKVSGGVKTLAEALQYIHLAKEVYGKENIQVSSMNLRFGASHLVDDLYT
>NZ_CP048052.1|WP_017378243.1|1342603_1343746_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MIDFPTLQVIGWIIVGATLLSFALTSGFDSGIGILLPFIGRNDTERRLTLNVIGPTWDGNQVWLIAAGGAVFAIWPLVYSTAFSGYYVAMLLILWSLFLRPVGFEYRSKLPNQTWRNNWDIGIFIASFIPILIMGIAFGNLLLGSPFSYDPVFLRMQYTGSFIDLLSPFALLSGVIAIFMVICHGAAYLNLRTKGIIKTRAQKALRLFAWCYLIAFALAGLLITYKIPGYFLGSQAGSIHDPLINHVNRHVGAWLNNYHTHHWMVLAPVIGFLGAFLAIISTHANRAIWSFIGTSFIQIGTLLTAAFSLFPFIMPSSSDPAHSLTVWNASTSQYTLTIIAIVAIIMVPVIFCYTSFVYIKMWRDGPINEKDIEKNQHILY
>NZ_CP048052.1|WP_017378242.1|1343762_1345364_-|hypothetical-protein
MLPIEHVVELSRWQFGITALYHFIFVPLTLGMTWILFGMECLYVKTGKQVYKDMVRFWGKLFGINFAMGVVTGITMEFEFGVNWAYYSQYVGDIFGAPLAIEGLVAFMLESTFFGIFFFGWDKLSKKQHLFATFCLAIGSMFSALFILIANGWMQHPVGSQFNIDSMRMELTSFYDVLLNPTAQAEFAHTITAGLVTAAMFVTGISSYYLLKGRDIVFAKRSFIYGSFFGLIVLLGVAFFGDHAGLDVDETQPMKMAAIEGLWETPEAPAPWTILALPSNNQLKNLAAIKIPYALSIIATHSLDGTVKGMQEIIADNVVRMTQGRKAYLALIELRTEKNIDGKTLSAEQLATAKHTLERYKDDLGYGLLLKSYISDIQHASEAQIQHVAKQAIPEVWAVFYSFRLMIGCFGIMLLIVLAAGFFNLRGKLWEQRWLFRTALYAIPLPFLACLFGWFVAEHGRQPWVVQNTLPTAMGASSVSTGQLTFSLTGFALFYTLLFIIEIYLMFKYARLGPSALHSGRYHFEQLAHANKS
>NZ_CP048052.1|WP_157894728.1|1345858_1346011_+|hypothetical-protein
MAQLTHNSGSFATFTSAGVVRRALTQAGFVVKKIPGFAGKREMMRGWETI
>NZ_CP048052.1|WP_017378240.1|1346007_1347285_+|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC
MTMLVEGNYAPWNRLAASATSPNVIVVGAGIAGASTSWALSTQGFNVTLVEKAAEAAQEASGNLAGLMMPALATDQSSFAEYFIQAYLYSIQHAKTLAQSHQFNFSQTGIIQLAFNDRQQKRQKNWLELKHVADLLEWVSQEQVMALSGLDFSCSGVYFKEAAWLSPYLYVKSHIHACKASINCLFNSYVNQLHYEQGLWKLYDQHQQLIAEAPTLILANASDATRLLGQFSSVLPLSLRTVRGQVSALKNHARVSQLKLPVCYDGYITPVINGKNYLGATFIDDYQAKCLHQDRVQNIQQLKQVLPGLNIDEREYKDLSQDRAALRCITTDYLPVIGPVPDVAFYRQHYSRLIQDRRESRYPSAQYLPGLFMNIGHGSRGMVSAPFATKLLVSELMGKDLKLSKRLREHLHPGRFLIRQLKKGK
>NZ_CP048052.1|WP_017378239.1|1347633_1347903_+|hypothetical-protein
MPINTKQSLKRFQAQDALQASGSFLKKGLPEGTNQADFIKAVNREIQIVIDGMQSIVRNNQPSASSYRGEDSVRELVALQFLPLRAMEC
>NZ_CP048052.1|WP_036771505.1|1348107_1348608_+|hypothetical-protein
MLGDFASLDVQNTYRGSDAYATIDEISGKKVNFFSKTAVREKSIQELKSLQNALEVIFTEPEEKLTKEFVQLIQERISQVYEEKITYKNKRLVCCLFDELKQDLSTLHCSIDSLNAGFSVANVSDKSQVQQCESVQSPMLFYQQHEQNLQPVDRDRSCYVMYETSV
>NZ_CP048052.1|WP_036771503.1|1348768_1349872_+|hypothetical-protein
MPMTREDWFKKANCPINESNNEKVTLYLDLDENVFSYHKKNKKMDQEVDVGCFNVLNVKKMSFHTSSGIFFVDKRAFLEVKKFLDNGHDLQVVTAGAYPPEIISKIFNELGIDIKLQHGENYFNRFDFGAGESKALNKQEFIDKHLNNNKAMLIDDQFWNKPKAKEGVLFTLTSPSRPFPTLVAIDKNLVLNLQKVGIDYDEIWKHAKDNLELQALAATTVSSAEGWQKAKQFIAVKSALESFNPAQSSQTPFSLITVNKRENLRDLRGLCSAVAASEEHSGLLVGELARLLNLPSNNALKLEICPEGNAVSMNDIDNYVSVPELLDRNRRAEGDLEAAGGALSMLMLEAHTKTLEAEQLNSMPLTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048052_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048052_3

1655939-1656048

Orphan

Consensus_repeat	Method
TATCTTTAAGTTGCTCCCAATCTCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048052_3

>merge|NZ_CP048052|3|1655939-1656048|CRISPRCasFinder
TATCTTTAAGTTGCTCCCAATCTCCTCGAGCTAATTTGATATCGGAACGATAAAGGGCGATAATGGCTGTTTGAAGGATAGAGCTATCTTTAAGTTGCTCCCAATCATCC

>NZ_CP048052|3|2|1655939-1656048|CRISPRCasFinder
TATCTTTAAGTTGCTCCCAATCTCCT	CGAGCTAATTTGATATCGGAACGATAAAGGGCGATAATGGCTGTTTGAAGGATAGAGC
TATCTTTAAGTTGCTCCCAATCATCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048052.1\|WP_017376797.1\|1665760_1666120_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017376785.1\|1654433_1655339_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182768
NZ_CP048052.1\|WP_027243095.1\|1663201_1665487_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_155046589.1\|1650915_1651065_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_027243096.1\|1661747_1662380_-\|MarC-family-protein	unknown	unknown	gnl\|CDD\|225006
NZ_CP048052.1\|WP_162038663.1\|1648458_1649259_-\|DNA-internalization-related-competence-protein-ComEC/Rec2	unknown	unknown	gnl\|CDD\|225212
NZ_CP048052.1\|WP_144420682.1\|1656745_1656907_+\|phosphatase	unknown	unknown	unknown
NZ_CP048052.1\|WP_155049745.1\|1661535_1661712_+\|DUF1508-domain-containing-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_162038664.1\|1649185_1649404_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_048876008.1\|1651144_1652119_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP048052.1\|WP_155046588.1\|1657441_1657651_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_036774017.1\|1649694_1650570_+\|IS982-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP048052.1\|WP_155046590.1\|1650571_1650736_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_162038665.1\|1652115_1653327_-\|ComEC-family-competence-protein	unknown	unknown	gnl\|CDD\|377126
NZ_CP048052.1\|WP_027242578.1\|1653434_1653971_+\|DUF2062-domain-containing-protein	unknown	unknown	gnl\|CDD\|378263
NZ_CP048052.1\|WP_144420683.1\|1662556_1663213_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_017376798.1\|1666401_1667037_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP048052.1\|WP_027243098.1\|1660315_1661461_+\|carboxypeptidase-family-protein	unknown	unknown	gnl\|CDD\|349453
NZ_CP048052.1\|WP_017376784.1\|1654007_1654193_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048052.1\|WP_027243099.1\|1658766_1660080_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|236722

Protein	Function_ID	Function_description	E-value
NZ_CP048052.1\|WP_048876008.1\|1651144_1652119_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.65717e-79
NZ_CP048052.1\|WP_017376785.1\|1654433_1655339_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182768	PRK10837, PRK10837, putative DNA-binding transcriptional regulator; Provisional.	3.43302e-86
NZ_CP048052.1\|WP_036774017.1\|1649694_1650570_+\|IS982-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.54754e-84
NZ_CP048052.1\|WP_162038663.1\|1648458_1649259_-\|DNA-internalization-related-competence-protein-ComEC/Rec2	gnl\|CDD\|225212	COG2333, ComEC, Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only].	3.63401e-72
NZ_CP048052.1\|WP_162038665.1\|1652115_1653327_-\|ComEC-family-competence-protein	gnl\|CDD\|377126	pfam03772, Competence, Competence protein. Members of this family are integral membrane proteins with 6 predicted transmembrane helices. Some members of this family have been shown to be essential for bacterial competence in uptake of extracellular DNA. These proteins may transport DNA across the cell membrane. These proteins contain a highly conserved motif in the amino terminal transmembrane region that has two histidines that may form a metal binding site.	1.76155e-43
NZ_CP048052.1\|WP_027242578.1\|1653434_1653971_+\|DUF2062-domain-containing-protein	gnl\|CDD\|378263	pfam09835, DUF2062, Uncharacterized protein conserved in bacteria (DUF2062). This domain, found in various prokaryotic proteins, has no known function.	2.12897e-42
NZ_CP048052.1\|WP_027243096.1\|1661747_1662380_-\|MarC-family-protein	gnl\|CDD\|225006	COG2095, MarC, Multiple antibiotic transporter [Intracellular trafficking and secretion].	1.76545e-45
NZ_CP048052.1\|WP_017376798.1\|1666401_1667037_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.53606e-35
NZ_CP048052.1\|WP_027243098.1\|1660315_1661461_+\|carboxypeptidase-family-protein	gnl\|CDD\|349453	cd06234, M14_PaCCP-like, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases similar to Pseudomonas aerugnosa CCP (PaCCP). A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins. This subgroup includes PaCCP from Pseudomonas aeruginosa, a carboxypeptidase homologous to M14D subfamily of human CCPs. Structural complexes with well-known inhibitors of metallocarboxypeptidases indicate that PaCCP might only possess C-terminal hydrolase activity against cellular substrates of particular specificity. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins (such as alpha-tubulin in eukaryotes) to remove a C-terminal tyrosine. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain.	9.10914e-164
NZ_CP048052.1\|WP_027243099.1\|1658766_1660080_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|236722	PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional.	0

>NZ_CP048052.1|WP_017376785.1|1654433_1655339_-|LysR-family-transcriptional-regulator
MSVKITLRQLEIFVAISQHGHVTQAANSLYLSQSAVSMALAELERQLGKTLFDRAHKNLQLTNEGRLLLDKAVSLMQQAREVEQLFESDVQGELVVGASSTVGNYMLAGLMSEYLQKYPQLRLRLEISNTRRSQEKLLDYQFDCAFVEGEVTHADIKRQLWCMDEMLLIVAPTHPLAYKGLVEASDLSKAVWVLREQGSGTREFFNRRVLPELTYAQVCLELSDSTAIVQSVETGVGVSCLSRHVVECALREKRLAKLPYERKLERAFYLLIHKKKHIPALVHHFIDFCYQYIGKNNNYSL
>NZ_CP048052.1|WP_017376784.1|1654007_1654193_-|hypothetical-protein
MEKIERVYARDHGISGNFKDIQFEKYCRDWLEPMRRKVNESTKLDDYVNPRVKSRLGGYLG
>NZ_CP048052.1|WP_027242578.1|1653434_1653971_+|DUF2062-domain-containing-protein
MFNWFKKKIPTRESLQDHKILAKLYHLLHYHYLWHFNRHSVSKAIAIGSFFAFIPVPFQMIPAALCALVFRANVGISIATVWISNPITIPPMIYAAYKLGSWMIGHPGFIISLEQPHDIIHLLSQSWPPFLLGCITLSITFSLVNYIIARLFYRLWIIHKWHKNREKHKQANTTKKER
>NZ_CP048052.1|WP_162038665.1|1652115_1653327_-|ComEC-family-competence-protein
MCYFIKSKHKAKLLCCLGLGGLWAIIIIFWQDYLHLDDFVLNQVVVITGNVVSIPEHDTRKVCFLFLIESINHQPLWPARQVRLNWYRFKQKKQQVLKAGESWQFQVKLRAPFGLENFIGFNYRRWLYQHSIQATGLVIDRYGKKGINRKLSSSHVFNLQQYRQKIAWFLERIDLHNTALIKALVLGERAEVKRSVRNLLQQTGTAHLLAVSGLHIGLIVTFTFFLIRGVLLWAPGMSRKYKSSGYALFIAAIVSLLVALCYSALAGFSVATLRACLMTVCVLLAFLCRRVVPIWALYQYALVGVVILFPLSVLSIGFWLSFLSVGVLIFVCAGRLTQTKLQKYLKPQWALLIALAPLSLAYFFNMPLIGLLANLVAIPWVGFLVLPLLLFALRHLKCNTTLY
>NZ_CP048052.1|WP_048876008.1|1651144_1652119_+|IS30-family-transposase
MVYRHLNEKDRFYIEQRLSEGDSLRSIARALGFSPSTISREIKRHTPIDFKGLYCHRLTSRCAQEKRANAKQGQAFQQISEEEKMLIHQRLSTHTSPDVISQELIREHNIQVSESTIYRYIYDDRERGGELYKNLPHSGKPYKKKVSRGDQTKIPNRVGIEQRPAIADEKTEFGHFEIDTVVGRDHQSYLLTLVDKANKMCCIRKMPNKQAKTVINTFMNVVGSTFFDFKSITSDNGTEFAGHEAISKITEADFYFARPYRSCDRGLNEHTNGLIRRFLPKGTDFNEVSDKEIAKIEHTLNTRRRASLNYRSPNHVFLEYLMAA
>NZ_CP048052.1|WP_155046589.1|1650915_1651065_-|hypothetical-protein
MTEGVLGLIFIPLSNELSWVLFHCADLQITWLINRCEPWSAKHGVSRPR
>NZ_CP048052.1|WP_155046590.1|1650571_1650736_-|hypothetical-protein
MLGDFASLDVQNTYRGSDAYGITLFRPLAALYTTLLWCANINFIGFFFFNVSSI
>NZ_CP048052.1|WP_036774017.1|1649694_1650570_+|IS982-family-transposase
MDLTLISLFCVIDDFCQELLPQWNAILLEDTNKKRNKPSQMSTSEIMTIMIYFHKSNYRNFKMYYLHVIKGSMVKYFPNSVSYNRFVELMPSILLPLCFFIAAQGKTATGIYFVDSTILRVCHEKRASQNRAFKGLAKKSKSTMRWYYGFKLHIIVNDMGELMAFKMSKATTDDRVVLPKMAENLTGKIIGDKGYISQKLFDQLYEKGLQLITKIRKNMKNKLVLMIDKILLRKRGIIESVFDQLKNISQIEHSRHRSADNFMVNIVAGLAAYCLQEKKPSLGIKYNLLNG
>NZ_CP048052.1|WP_162038664.1|1649185_1649404_-|hypothetical-protein
MLGDFASLDVQNTYRGSDAYVLLMSNSRFFRYVNLINAAWFPWAVVRACDDVGSLGLRTKTCYAGSCICAST
>NZ_CP048052.1|WP_162038663.1|1648458_1649259_-|DNA-internalization-related-competence-protein-ComEC/Rec2
MTMLVPWVYALRPVTPDHAFVRVLDVGQGLAVIVKTHHHNLVYDVGNKTKSGFDLGQMVVVPNLYALGIQHIDKLVISHIDSDHSAGLASVLAAYPKTPIVSSSPLLPYTKIQACVAGDRWLWDGVTFEFLSPAYPFPYGRNNQSCVLKVSINEEGSSMLLTGDIEKRQEKKLLLQAPLSLKSDILFAPHHGSNSSSTSPFIKAVSPHTVIISAGRYNAYRLPHVKVLHRYQSQHIAILNTGQVGAIDFQLSGNKEPLFTFAGAGV
>NZ_CP048052.1|WP_144420682.1|1656745_1656907_+|phosphatase
MYHFQIDNQINQFLNRKRRYLGRYFAHPMMQNRRAKRDDYKPSAVRVTQRYVP
>NZ_CP048052.1|WP_155046588.1|1657441_1657651_-|hypothetical-protein
MLGDFASLDVQNTYRGSDAYEINNILILFSYLFGAILKLTFPSYYNFLAKLRSHTICQELYGIQKSKEP
>NZ_CP048052.1|WP_027243099.1|1658766_1660080_-|DEAD/DEAH-box-helicase
MSFSSLGLSAPLLDAITEQNYKEPSAIQAQAIPAVLSGRDVMAAAQTGTGKTASFTLPLLERLSKGEQVRANQARALVLTPTRELAIQVAESVAVYGKNMPLRSTAVFGGVKINPQMMRLRRGVDILVATPGRLLDLYSQNAIKFKQLEVLVLDEADRMLDMGFIHDLRKIMALLPKQRQNLLFSATFSKEIRALAKTFVHQPLEISVTPRNTTAKTVKQWICPVDKKQKSALLMHLISHHQWQQALVFSKTKHGANRLARYLDDQGVTAAAIHGNKSQGARTKALADFKQGEVRILVATDIAARGLDIDQLPQVVNFDLPNVPEDYVHRIGRTGRAGACGQAVSLVSADEIKQLSDIEHLIGQLLARKLVDGFEPVHDVPVSSLDRRSKAPKKPEIEHQGGQRLGGSMQGKRREDHRNSQQQPGRKRRRPQLCRSK
>NZ_CP048052.1|WP_027243098.1|1660315_1661461_+|carboxypeptidase-family-protein
MRISSQFDAGNIEVISAEAVNNIQLKIRKDNQSDFLQWFHFRLHGAKNQACTLKILNASACSYPQGWQNYNIVASYDKEHWFRIPSHYDGKTLIVEHTPEANSIYYAYFTPYSYERHQELIGHAQQHSQCEVSLLGQTVDGRDLDLLTLGQLDQSNSDHHHKKKIWLIARQHPGETMAEWFIEGFLGALLDESNALARVLLSKAVFYVVPNMNPDGSVRGNLRTNAAGANLNREWQTPSMTKSPEVYYVKEKMQNTGVDLFLDIHGDEALPYNFVVGTEGNPLYSARIHSLEKQFKDAFKQTNPDFQDQYGYDKDQPGQANLTVACNNIGQTFDCLAFTIEMPFKDNADLPCKEFGWSAERSEQLGASVLQPIYNVIDQLR
>NZ_CP048052.1|WP_155049745.1|1661535_1661712_+|DUF1508-domain-containing-protein
MSELSRPENKWDIFKNSKGQWQWSCSDPNGRFLGASTETFDNEESCVANAREQGYSSE
>NZ_CP048052.1|WP_027243096.1|1661747_1662380_-|MarC-family-protein
MHELITFFITLLALTNPFGNLAIFIGLVEGRDVKEQRGIAFKAGIAVAIILMIVTLFGQNILDFFGISIGAFEVAGGLVILLLGLSMLNMKTEHQPHTKSEHTLAEEKPAIAVVPLAMPIIAGPGALAAVIIHTQSHVADRLFAKLPYVGVDIVIAVVVTAVLLFAPFFHKLLGVAGLKIVERIMGLILMAMAVTMMASGVHSLFPVPAA
>NZ_CP048052.1|WP_144420683.1|1662556_1663213_+|hypothetical-protein
MLKACSVPTMQLHADYDTETKKSHYSPLGDLRIQRFFDGRPNIQKTALKRYFKKKLPSGIFSGKTQPELSTYLQTTMRTIGQENGSNAPHSTQHYVITGIIQSIQVSKKPGVAKELMNPNAQYTPYIGASHYHAQVKFKAELRQAGLIILTVPVSINLFEITASHLTVQQDSDKMAYLLKKAINQAIKTMYKKLHQQLPQQSTMTSIKKLSQINRLHP
>NZ_CP048052.1|WP_027243095.1|1663201_1665487_-|hypothetical-protein
MPYTVELEEIYQGKRFESERKRYQECFNAADALADSVYLSESMLGYFEDVSGDELDFNNDATYSSSLSLFVLLGIFGVFKARAHFDKNENIDKYYKKLRTALSGLKNGRHALVNISSLVSILSHHAVASSVVSPVGALGFAIGILLAANNLYKLKLEEKRNSNLKAIEQYFLNFDRPEFDQDFKRIVPPNVKSNRKLIYTNIIDGFTDGLYLVGNAFMLLGLCGATSMVPTVAIGLCVAYGVYTLGSIINKYFKEKEEQLKEEFIYLKFLENLENQGKLVEYHDQFKSDPNYKKYIGDLSESDGAEEIRNKLGVALKIKEKELNAKKETLQSNTFYKVYKMISKSFSTVRSYVNTIKNSLATVTGIDILASQHPLAQAAVSLGCIITGCAVAVPFLVYKTYCSFRPTYQLRCRQGLDYPDLLYFFNEYAKSGFLKKHNHKGLIDRLTDDYQDYRENYLHILCTVNEYIADHYRNMNQKGELFLRYQAAKDYILCKHKYFSSMIKQLYKEYHYYSSLNINSDSDDIFIKNTRCLLKLYPATTKKEVVESLAIFSWDRQIAIITALPEFIDDHQVIMDLKGFLSAIKKPLREKNNFWLDKAHKKAQQDFFNAMLQNYLDNGVVNRSECAALVMNINKLLNSELLYPMPVKTINFYLHKAAVNYLAASASKILKNENLSIQQKIALYQSQHDELLRLLPNMMKSYAQRDSHDSLKVDESQFEEFLARAKNHRSNSNSCFTNMMFYHGQVDTMEPASSHRLVLGV
>NZ_CP048052.1|WP_017376797.1|1665760_1666120_-|hypothetical-protein
MFTRQKKSLAKFAAESAGTVEAVEAFHREPVCELVFSVCDQEISQCIDLLYDAGHNIHNLKKYAPIEFRNYIYEEFLMRLESPAADVQRELAREVFMDYLETRLKFDMDIAREIIKMPG
>NZ_CP048052.1|WP_017376798.1|1666401_1667037_+|LysE-family-translocator
MTFGIWLSLFAVCILGAMSPGPSLAIVTKHSLTNGRWHGIATSWSHALGVGLYATLTLLGLAVLLKRSPILFAIISYAGAGYLIYLGINALRSKGGIDSKLNLGQPAPLKDSCREGFMISLLNPKLALFFLALFSQFISVGHQLSSQVIIVATPTLVDGLWYTLIAFILSNPKVLSILKNKAQLIDRLSGIVLLLLASVFIISTISHSIFN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83146-83184	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83506-83544	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84046-84084	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84286-84324	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84676-84714	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85216-85254	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83071-83094	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83101-83124	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83131-83154	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83431-83454	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83461-83484	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83491-83514	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83941-83964	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83971-83994	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84001-84024	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84031-84054	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84211-84234	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84241-84264	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84271-84294	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84601-84624	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84631-84654	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84661-84684	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85111-85134	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85141-85164	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85171-85194	0	1.0
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85201-85224	0	1.0
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83086-83124	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83116-83154	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83446-83484	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83476-83514	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83956-83994	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83986-84024	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84016-84054	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84226-84264	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84256-84294	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84616-84654	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84646-84684	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85126-85164	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85156-85194	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85186-85224	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83236-83274	1	0.974
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84376-84414	1	0.974
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83161-83184	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83191-83214	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83221-83244	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83251-83274	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83281-83304	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83311-83334	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83341-83364	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83371-83394	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83401-83424	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83521-83544	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83551-83574	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83581-83604	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83611-83634	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83641-83664	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83671-83694	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83701-83724	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83731-83754	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83761-83784	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83791-83814	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83821-83844	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83851-83874	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83881-83904	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83911-83934	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84061-84084	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84091-84114	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84121-84144	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84151-84174	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84181-84204	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84301-84324	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84331-84354	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84361-84384	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84391-84414	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84421-84444	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84451-84474	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84481-84504	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84511-84534	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84541-84564	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84571-84594	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84691-84714	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84721-84744	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84751-84774	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84781-84804	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84811-84834	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84841-84864	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84871-84894	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84901-84924	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84931-84954	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84961-84984	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84991-85014	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85021-85044	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85051-85074	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85081-85104	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85231-85254	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85261-85284	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85291-85314	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85321-85344	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85351-85374	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85381-85404	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85411-85434	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85441-85464	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85471-85494	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85501-85524	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85531-85554	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85561-85584	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85591-85614	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85621-85644	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85651-85674	1	0.958
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85681-85704	1	0.958
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83176-83214	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83206-83244	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83266-83304	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83296-83334	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83326-83364	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83356-83394	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83386-83424	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83536-83574	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83566-83604	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83596-83634	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83626-83664	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83656-83694	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83686-83724	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83716-83754	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83746-83784	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83776-83814	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83806-83844	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83836-83874	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83866-83904	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83896-83934	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84076-84114	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84106-84144	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84136-84174	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84166-84204	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84316-84354	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84346-84384	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84406-84444	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84436-84474	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84466-84504	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84496-84534	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84526-84564	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84556-84594	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84706-84744	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84736-84774	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84766-84804	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84796-84834	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84826-84864	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84856-84894	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84886-84924	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84916-84954	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84946-84984	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84976-85014	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85006-85044	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85036-85074	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85066-85104	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85246-85284	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85276-85314	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85306-85344	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85336-85374	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85366-85404	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85396-85434	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85426-85464	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85456-85494	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85486-85524	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85516-85554	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85546-85584	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85576-85614	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85606-85644	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85636-85674	2	0.949
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85666-85704	2	0.949
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85711-85734	2	0.917
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83056-83094	3	0.923
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83416-83454	3	0.923
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83926-83964	3	0.923
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84196-84234	3	0.923
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84586-84624	3	0.923
NZ_CP048052_2	2.5\|1337173\|39\|NZ_CP048052\|CRT	1337173-1337211	39	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85096-85134	3	0.923
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP033067	Pseudoalteromonas agarivorans strain Hao 2018 plasmid unnamed, complete sequence	80335-80358	4	0.833
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	NZ_CP050314	Shewanella aestuarii strain PN3F2 plasmid pPN3F2_1, complete sequence	100484-100507	4	0.833
NZ_CP048052_2	2.6\|1337233\|24\|NZ_CP048052\|CRT	1337233-1337256	24	MN871441	UNVERIFIED: Aeromonas phage AsSzw2, complete genome	200918-200941	4	0.833

1. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

2. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

3. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

4. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

5. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

6. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctacttctcaa	Protospacer
***************************************

7. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

8. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

9. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

10. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

11. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

12. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

13. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

14. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

15. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

16. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

17. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

18. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

19. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

20. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

21. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

22. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

23. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

24. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

25. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

26. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

acttctcaaggttctacttttgag	CRISPR spacer
acttctcaaggttctacttttgag	Protospacer
************************

27. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

28. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

29. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

30. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

31. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

32. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

33. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

34. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

35. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

36. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

37. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

38. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

39. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

40. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctacttctcaa	Protospacer
.**************************************

41. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctgcttctcaa	Protospacer
******************************.********

42. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgaggattctgcttctcaa	Protospacer
******************************.********

43. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

44. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

45. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

46. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

47. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

48. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

49. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

50. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

51. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

52. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

53. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

54. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

55. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

56. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

57. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

58. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

59. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

60. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

61. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

62. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

63. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

64. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

65. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

66. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

67. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

68. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

69. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

70. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

71. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

72. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

73. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

74. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

75. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

76. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

77. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

78. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

79. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

80. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

81. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

82. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

83. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

84. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

85. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

86. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

87. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

88. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

89. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

90. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

91. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

92. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

93. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

94. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

95. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

96. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

97. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

98. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

99. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

100. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

101. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

102. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

103. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

104. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

105. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

106. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

107. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

108. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

109. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

110. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.958

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctacttttgag	Protospacer
.***********************

111. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

112. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

113. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

114. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

115. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

116. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

117. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

118. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

119. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

120. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

121. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

122. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

123. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

124. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

125. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

126. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

127. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

128. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

129. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

130. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

131. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

132. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

133. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

134. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

135. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

136. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

137. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

138. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

139. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

140. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

141. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

142. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

143. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

144. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

145. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

146. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

147. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

148. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

149. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

150. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

151. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

152. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

153. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

154. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

155. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

156. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

157. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

158. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

159. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

160. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

161. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

162. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

163. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

164. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

165. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

166. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

167. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

168. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

169. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

170. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.949

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
gcttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
*************************.****.********

171. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.917

acttctcaaggttctacttttgag	CRISPR spacer
acctctgaaggttctacttttgag	Protospacer
**.*** *****************

172. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgaggattctactgctcag	Protospacer
.******************************** ****.

173. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
.************************.****.********

174. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
.************************.****.********

175. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
.************************.****.********

176. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
.************************.****.********

177. spacer 2.5|1337173|39|NZ_CP048052|CRT matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.923

gcttctcaaggttctacttttgaggattctacttctcaa	CRISPR spacer
acttctcaaggttctacttttgagggttctgcttctcaa	Protospacer
.************************.****.********

178. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP033067 (Pseudoalteromonas agarivorans strain Hao 2018 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.833

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctgcttttggt	Protospacer
.**************.******.

179. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to NZ_CP050314 (Shewanella aestuarii strain PN3F2 plasmid pPN3F2_1, complete sequence) position: , mismatch: 4, identity: 0.833

acttctcaaggttctacttttgag	CRISPR spacer
gcttctcaaggttctgcttttggt	Protospacer
.**************.******.

180. spacer 2.6|1337233|24|NZ_CP048052|CRT matches to MN871441 (UNVERIFIED: Aeromonas phage AsSzw2, complete genome) position: , mismatch: 4, identity: 0.833

acttctcaaggttctacttttgag	CRISPR spacer
chttctcaaggttctacctttdag	Protospacer
  ***************.*** **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

608 : 56203

Escherichia_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017378478.1\|608_1988_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_017378477.1\|1995_3696_-	membrane protein insertase YidC	NA	NA	NA	NA
WP_144420589.1\|3910_4285_-	ribonuclease P protein component	NA	NA	NA	NA
WP_016209359.1\|4291_4426_-	50S ribosomal protein L34	NA	NA	NA	NA
WP_017378480.1\|6526_7153_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_017378481.1\|7172_8057_+	ParA family protein	Q8JL10	Natrialba_phage	5.8e-18	28.4
WP_027242747.1\|8089_8980_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	6.7e-14	31.8
WP_017378483.1\|9094_9493_+	hypothetical protein	NA	NA	NA	NA
WP_017378484.1\|9497_10313_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
WP_016209328.1\|10364_10769_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
WP_017378485.1\|10823_11294_+	F0F1 ATP synthase subunit B	NA	NA	NA	NA
WP_017378486.1\|11305_11833_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
WP_017378487.1\|11849_13391_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
WP_027242748.1\|13416_14277_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
WP_016209339.1\|14307_15699_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_017378489.1\|15723_16152_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_027242749.1\|16245_17610_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A0N7G7I9	Chrysochromulina_ericina_virus	3.9e-37	40.9
WP_027242750.1\|17666_19502_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	5.8e-121	43.7
WP_036773290.1\|19615_20344_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.3e-44	42.2
WP_027242751.1\|20870_22412_-	hypothetical protein	NA	NA	NA	NA
WP_017378498.1\|22678_23335_-	2OG-Fe dioxygenase family protein	NA	NA	NA	NA
WP_048876081.1\|24032_24692_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_017376300.1\|24836_25094_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_075275376.1\|25206_25959_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_017376303.1\|26017_26731_-	AAA family ATPase	A0A222YXS3	Escherichia_phage	2.2e-28	36.0
WP_027242752.1\|26922_27555_+	hypothetical protein	NA	NA	NA	NA
WP_080999959.1\|28615_28855_-	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|29289_30693_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155046628.1\|30689_30914_-	hypothetical protein	NA	NA	NA	NA
WP_036771332.1\|30993_31968_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.3e-30	33.2
WP_036815787.1\|31987_32305_-	hypothetical protein	NA	NA	NA	NA
WP_017376724.1\|32382_32595_-	hypothetical protein	NA	NA	NA	NA
WP_026063559.1\|32841_33261_+	CBS domain-containing protein	NA	NA	NA	NA
WP_036816796.1\|33358_33805_-	hypothetical protein	NA	NA	NA	NA
WP_027242563.1\|34149_35148_+	hypothetical protein	NA	NA	NA	NA
WP_051929590.1\|35180_35534_-	hypothetical protein	NA	NA	NA	NA
WP_051929591.1\|35578_35851_-	hypothetical protein	NA	NA	NA	NA
WP_017376728.1\|36246_37665_-	MFS transporter	NA	NA	NA	NA
WP_017376729.1\|37891_38833_+	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_026063560.1\|38867_40847_+	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_027242562.1\|40843_41449_+	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_016211294.1\|41450_41792_+	prokaryotic cytochrome C oxidase subunit IV family protein	NA	NA	NA	NA
WP_027242561.1\|41792_42629_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_080963573.1\|42794_43112_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_027242560.1\|43189_44611_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017376735.1\|44607_45303_-	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_047927112.1\|45466_45793_-	hypothetical protein	NA	NA	NA	NA
WP_144420744.1\|46489_47335_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_017376738.1\|47344_47683_+	hypothetical protein	NA	NA	NA	NA
WP_048876080.1\|48251_49655_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048876181.1\|49768_50632_+\|transposase	transposase	NA	NA	NA	NA
WP_155046627.1\|50836_51010_+	hypothetical protein	NA	NA	NA	NA
WP_048876079.1\|51617_52667_-\|transposase	transposase	NA	NA	NA	NA
WP_075275379.1\|52821_53040_-	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|53359_54763_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048876179.1\|54773_55331_-\|transposase	transposase	NA	NA	NA	NA
WP_036772663.1\|55327_56203_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

191881 : 322808

111

Acinetobacter_phage(11.11%)

tRNA,tail,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017377604.1\|191881_193864_+\|protease	ATP-dependent zinc metalloprotease FtsH	G9E4U6	Ostreococcus_lucimarinus_virus	1.0e-115	41.1
WP_017377605.1\|194073_195417_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_017377606.1\|195683_198353_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_017377607.1\|198376_200293_+	pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
WP_026063653.1\|200462_201884_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.1e-45	28.1
WP_017377609.1\|202028_203003_+	phospholipase A	NA	NA	NA	NA
WP_027242692.1\|203012_203312_+	hypothetical protein	NA	NA	NA	NA
WP_017377612.1\|203429_203651_-	hypothetical protein	NA	NA	NA	NA
WP_017377613.1\|203814_205476_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	7.7e-181	64.5
WP_016209850.1\|205548_205839_-	co-chaperone GroES	A0A221S322	uncultured_virus	3.3e-15	42.6
WP_017377614.1\|206065_206521_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_017377615.1\|206585_207050_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_027242691.1\|207141_208488_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_017377618.1\|208487_209393_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_017377619.1\|209454_210441_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_016209851.1\|210433_210676_+	Fis family transcriptional regulator	NA	NA	NA	NA
WP_017377620.1\|210794_212339_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.6e-63	46.9
WP_017377621.1\|212385_213672_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_017377622.1\|213714_215118_+	aminopeptidase P family protein	NA	NA	NA	NA
WP_144420750.1\|215122_217660_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_144420593.1\|218056_218305_+	hypothetical protein	NA	NA	NA	NA
WP_080963589.1\|218236_218698_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_017377624.1\|219192_219888_-	response regulator transcription factor	NA	NA	NA	NA
WP_080963590.1\|219989_221552_-	APC family permease	NA	NA	NA	NA
WP_017377626.1\|221879_223673_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	2.2e-117	41.0
WP_017377627.1\|223759_224032_+	DUF615 domain-containing protein	NA	NA	NA	NA
WP_017377628.1\|224037_224664_+	DUF938 domain-containing protein	NA	NA	NA	NA
WP_017377629.1\|224650_226081_+	exodeoxyribonuclease I	NA	NA	NA	NA
WP_017377630.1\|226402_227458_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.1e-29	34.7
WP_017377631.1\|227426_228104_+	ABC transporter permease	NA	NA	NA	NA
WP_017377632.1\|228093_228942_+	hypothetical protein	NA	NA	NA	NA
WP_016210080.1\|229087_229381_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_036772063.1\|229492_230305_-	trfA family protein	NA	NA	NA	NA
WP_017377635.1\|230603_231458_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_017377636.1\|231611_232661_-	hypothetical protein	NA	NA	NA	NA
WP_017377637.1\|232706_233363_-	DedA family protein	NA	NA	NA	NA
WP_017377638.1\|233380_234661_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_017377639.1\|234934_236296_+	signal recognition particle protein	NA	NA	NA	NA
WP_036772069.1\|236356_236908_+	paraquat-inducible protein A	NA	NA	NA	NA
WP_162034387.1\|241220_241379_+	hypothetical protein	NA	NA	NA	NA
WP_017376225.1\|242338_243610_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_017376226.1\|243666_244650_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_027243088.1\|244646_245432_+	type III pantothenate kinase	NA	NA	NA	NA
WP_017376227.1\|245739_246189_-	DUF1499 domain-containing protein	NA	NA	NA	NA
WP_048876031.1\|246282_247686_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376228.1\|248123_249605_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	5.3e-48	28.8
WP_017376229.1\|249660_250770_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.7e-35	29.8
WP_017376234.1\|252342_252555_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_027243087.1\|252595_253291_+	hypothetical protein	NA	NA	NA	NA
WP_017376236.1\|256087_256654_+	hypothetical protein	NA	NA	NA	NA
WP_027243085.1\|256811_257372_+	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_053856766.1\|257491_258895_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875886.1\|258891_259248_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_017376838.1\|259503_260328_-	hypothetical protein	NA	NA	NA	NA
WP_027243084.1\|261025_261550_-	hypothetical protein	NA	NA	NA	NA
WP_036773116.1\|261835_262810_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_027243083.1\|262909_263461_-	hypothetical protein	NA	NA	NA	NA
WP_075275261.1\|263573_264086_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_144420594.1\|264478_265936_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420595.1\|266049_266529_+	hypothetical protein	NA	NA	NA	NA
WP_027243080.1\|266724_267372_+	hypothetical protein	NA	NA	NA	NA
WP_017376843.1\|267651_268767_+	hypothetical protein	NA	NA	NA	NA
WP_017376844.1\|268738_269392_+	HAD family hydrolase	NA	NA	NA	NA
WP_027243079.1\|269385_270363_+	hypothetical protein	NA	NA	NA	NA
WP_027243078.1\|271899_272124_+	hypothetical protein	NA	NA	NA	NA
WP_016210632.1\|272506_272794_-	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_017376847.1\|272968_273724_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_036774056.1\|273756_274188_+	hypothetical protein	NA	NA	NA	NA
WP_017376849.1\|274163_274640_+	ribosomal protein S18-alanine N-acetyltransferase	NA	NA	NA	NA
WP_017376850.1\|274646_276224_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	3.6e-10	31.4
WP_017376851.1\|276226_276991_+	TatD family hydrolase	NA	NA	NA	NA
WP_017376852.1\|277044_277581_+	hypothetical protein	NA	NA	NA	NA
WP_017376853.1\|277577_278309_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_027243077.1\|278533_279295_-	hypothetical protein	NA	NA	NA	NA
WP_048875887.1\|279620_280496_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017378284.1\|281898_282054_-	hypothetical protein	NA	NA	NA	NA
WP_017375925.1\|282247_283915_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_017375924.1\|284610_284919_+	hypothetical protein	NA	NA	NA	NA
WP_144420596.1\|284936_287129_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.5e-141	44.9
WP_069971668.1\|287936_288185_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.9e-07	56.1
WP_017375921.1\|288297_288531_-	hypothetical protein	NA	NA	NA	NA
WP_017375920.1\|288765_289296_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_017375919.1\|289300_290014_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_144420751.1\|290641_291367_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_048875888.1\|291375_293439_+	serine/threonine protein kinase	A0A2H4UVE2	Bodo_saltans_virus	3.9e-17	28.0
WP_027243033.1\|293618_294098_-	hypothetical protein	NA	NA	NA	NA
WP_062312049.1\|294590_295958_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376531.1\|296349_297147_+	hypothetical protein	NA	NA	NA	NA
WP_027243034.1\|297258_298548_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_144420597.1\|298728_299715_+	hypothetical protein	NA	NA	NA	NA
WP_017376534.1\|299831_300011_+	rubredoxin	NA	NA	NA	NA
WP_017376535.1\|300022_300454_-	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_017376536.1\|300666_301026_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.4e-25	50.5
WP_017376537.1\|301195_302821_-	hypothetical protein	NA	NA	NA	NA
WP_080999962.1\|303544_304972_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376538.1\|305265_306447_-	hypothetical protein	NA	NA	NA	NA
WP_027243035.1\|309049_310348_-	MFS transporter	NA	NA	NA	NA
WP_144420752.1\|310703_311597_+	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	2.3e-14	33.8
WP_047927468.1\|311593_311899_+	pilus assembly protein PilZ	NA	NA	NA	NA
WP_017376543.1\|311924_312704_+	TatD family hydrolase	NA	NA	NA	NA
WP_144420598.1\|312733_312964_-	hypothetical protein	NA	NA	NA	NA
WP_016210862.1\|313115_313361_+	hypothetical protein	NA	NA	NA	NA
WP_017376547.1\|313547_314339_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_017376548.1\|315038_315761_+	putative N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_017376549.1\|315757_316639_+	ROK family protein	NA	NA	NA	NA
WP_027243038.1\|316662_318153_+	sodium:solute symporter	A0A219Y9P9	Aeromonas_phage	8.0e-20	23.8
WP_027243039.1\|318242_319130_+	N-acetylneuraminate lyase	NA	NA	NA	NA
WP_017376551.1\|319802_320294_-	hypothetical protein	NA	NA	NA	NA
WP_017375625.1\|320298_320526_-	hypothetical protein	NA	NA	NA	NA
WP_036773116.1\|320618_321593_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_069971669.1\|321569_322808_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

330774 : 384187

Staphylococcus_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053856767.1\|330774_332178_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420600.1\|332283_332469_-	hypothetical protein	NA	NA	NA	NA
WP_053856766.1\|333167_334571_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_080999963.1\|334661_335165_-\|transposase	transposase	NA	NA	NA	NA
WP_036771639.1\|335204_336179_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_017376774.1\|336175_336745_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	4.5e-32	40.3
WP_017376776.1\|337231_337924_-	hypothetical protein	NA	NA	NA	NA
WP_144420601.1\|338531_339524_+	hypothetical protein	NA	NA	NA	NA
WP_017376778.1\|339513_341286_+	single-stranded-DNA-specific exonuclease RecJ	NA	NA	NA	NA
WP_080963634.1\|341286_341475_-	DUF4286 family protein	NA	NA	NA	NA
WP_036774259.1\|341512_342487_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_036815640.1\|342545_342740_-	hypothetical protein	NA	NA	NA	NA
WP_017375625.1\|342806_343034_-	hypothetical protein	NA	NA	NA	NA
WP_069971671.1\|343163_344039_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_155046623.1\|344266_344416_+	hypothetical protein	NA	NA	NA	NA
WP_144420602.1\|344407_344674_-\|transposase	transposase	NA	NA	NA	NA
WP_144420603.1\|344818_345718_-\|transposase	transposase	NA	NA	NA	NA
WP_155046619.1\|345804_346062_-	hypothetical protein	NA	NA	NA	NA
WP_027243075.1\|346674_347901_+	cysteine desulfurase-like protein	NA	NA	NA	NA
WP_027243074.1\|347990_348530_-	hypothetical protein	NA	NA	NA	NA
WP_027243073.1\|348651_349290_-	MFS transporter	NA	NA	NA	NA
WP_075275265.1\|349323_349812_-	VUT family protein	NA	NA	NA	NA
WP_162038645.1\|350058_350205_-	VUT family protein	NA	NA	NA	NA
WP_036772686.1\|350341_350830_-	hypothetical protein	NA	NA	NA	NA
WP_162038646.1\|351400_352576_-	MFS transporter	NA	NA	NA	NA
WP_017378171.1\|352815_353106_+	hypothetical protein	NA	NA	NA	NA
WP_144420605.1\|353144_355799_-	hypothetical protein	NA	NA	NA	NA
WP_027243070.1\|356512_356767_+	hypothetical protein	NA	NA	NA	NA
WP_026063658.1\|357076_357805_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.3e-44	42.7
WP_017377650.1\|358575_359760_+	acyl-CoA desaturase	NA	NA	NA	NA
WP_017377649.1\|359778_360723_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_027243069.1\|361028_361814_+	hypothetical protein	NA	NA	NA	NA
WP_017377647.1\|361927_362296_-	hypothetical protein	NA	NA	NA	NA
WP_017377646.1\|362524_364102_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_144420753.1\|364885_369310_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_065653746.1\|369446_370970_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_017377643.1\|371174_371402_-	hypothetical protein	NA	NA	NA	NA
WP_017377642.1\|371546_371804_-	hypothetical protein	NA	NA	NA	NA
WP_036772743.1\|372371_373343_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_080999964.1\|373267_373507_-	hypothetical protein	NA	NA	NA	NA
WP_036772729.1\|373639_373861_-	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|373980_374955_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_036771639.1\|376058_377033_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_027242739.1\|377393_380063_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	5.5e-19	24.5
WP_036774478.1\|380233_381115_+	hypothetical protein	NA	NA	NA	NA
WP_017378307.1\|381125_381782_-	CoA transferase subunit B	NA	NA	NA	NA
WP_017378308.1\|381848_382553_-	CoA transferase subunit A	NA	NA	NA	NA
WP_048876031.1\|382783_384187_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

441184 : 508331

Acinetobacter_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875895.1\|441184_442348_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-25	32.0
WP_144420756.1\|442401_443403_-	EF-P beta-lysylation protein EpmB	NA	NA	NA	NA
WP_017378362.1\|443484_444054_+	elongation factor P	NA	NA	NA	NA
WP_144420608.1\|444267_445239_+	elongation factor P--(R)-beta-lysine ligase	A0A1V0SAC0	Catovirus	7.3e-22	25.9
WP_017378364.1\|445250_446846_+	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_036772406.1\|446866_447898_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_017378367.1\|448229_449333_-	glycosyltransferase	NA	NA	NA	NA
WP_017378368.1\|449444_450629_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_017378369.1\|450706_452695_+	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_162038647.1\|453275_453485_+	hypothetical protein	NA	NA	NA	NA
WP_144420609.1\|453853_455227_+	capsule biosynthesis protein	NA	NA	NA	NA
WP_017378374.1\|455244_456231_+	UDP-N-acetylglucosamine 4,6-dehydratase (inverting)	K7Y9E1	Megavirus	2.2e-42	34.2
WP_080963622.1\|456233_457388_+	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	A0A2D2W2B8	Stenotrophomonas_phage	2.3e-14	28.2
WP_017378376.1\|457384_458080_+	pseudaminic acid cytidylyltransferase	A0A1B1IVD3	uncultured_Mediterranean_phage	8.6e-09	32.3
WP_017378377.1\|458222_459713_+	UDP-2,4-diacetamido-2,4, 6-trideoxy-beta-L-altropyranose hydrolase	NA	NA	NA	NA
WP_017378378.1\|459733_460783_+	pseudaminic acid synthase	NA	NA	NA	NA
WP_027242727.1\|460849_462244_-	capsule biosynthesis protein	NA	NA	NA	NA
WP_017378381.1\|463176_465108_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.1e-117	36.0
WP_075273353.1\|465112_465643_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.7e-15	33.9
WP_017378382.1\|465677_465872_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_016210495.1\|465914_466274_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_017378383.1\|466405_467401_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	3.2e-33	36.5
WP_017378384.1\|467413_469795_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_016211707.1\|469800_470088_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	3.0e-08	33.7
WP_017378388.1\|472168_472942_-	hypothetical protein	NA	NA	NA	NA
WP_017378389.1\|472943_473885_-	hypothetical protein	A0A068C8G6	Acinetobacter_phage	1.7e-20	26.5
WP_017378390.1\|474018_475596_-	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_017378391.1\|475789_476746_-	hypothetical protein	NA	NA	NA	NA
WP_017378392.1\|476765_476918_-	hypothetical protein	NA	NA	NA	NA
WP_017378393.1\|477188_477395_-	hypothetical protein	NA	NA	NA	NA
WP_048875897.1\|478199_478844_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.7e-09	35.2
WP_069971672.1\|478911_480168_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376600.1\|480423_480603_+	hypothetical protein	NA	NA	NA	NA
WP_047927402.1\|480825_481053_+	hypothetical protein	NA	NA	NA	NA
WP_017377704.1\|482328_483087_-	hypothetical protein	NA	NA	NA	NA
WP_144420757.1\|483304_483868_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_017377702.1\|483971_484520_+	DUF2058 family protein	NA	NA	NA	NA
WP_157894716.1\|484977_485115_-	hypothetical protein	NA	NA	NA	NA
WP_087910634.1\|485116_486269_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-59	44.5
WP_017377698.1\|486614_486911_-	hypothetical protein	NA	NA	NA	NA
WP_144420758.1\|487170_488082_-	hypothetical protein	NA	NA	NA	NA
WP_146619438.1\|488316_488868_-	hypothetical protein	NA	NA	NA	NA
WP_017377695.1\|489368_490022_-	hypothetical protein	NA	NA	NA	NA
WP_155046620.1\|490018_490156_-	hypothetical protein	NA	NA	NA	NA
WP_017377686.1\|491176_491785_-	hypothetical protein	NA	NA	NA	NA
WP_016210764.1\|493059_493320_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_017377283.1\|493493_495032_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_017377282.1\|495210_496137_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SJE1	Klosneuvirus	1.6e-10	34.5
WP_048875900.1\|496241_497174_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.4e-27	33.8
WP_017377279.1\|497670_500484_+\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	1.0e-76	26.8
WP_017377278.1\|500476_500986_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_017377277.1\|500989_501433_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_027243089.1\|501528_502830_-	MFS transporter	NA	NA	NA	NA
WP_017377276.1\|503092_503461_+	hypothetical protein	NA	NA	NA	NA
WP_017377275.1\|503452_504175_-	aquaporin family protein	M1H9L8	Acanthocystis_turfacea_Chlorella_virus	1.6e-26	37.6
WP_017377274.1\|505236_506589_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	3.2e-36	45.7
WP_017377273.1\|506582_506822_+	hypothetical protein	NA	NA	NA	NA
WP_048875901.1\|507356_508331_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.2e-29	32.6

DBSCAN-SWA_5

517832 : 630356

111

Staphylococcus_phage(25.0%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048876031.1\|517832_519236_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275269.1\|519542_520163_+\|transposase	transposase	NA	NA	NA	NA
WP_048875903.1\|520342_521317_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.2e-29	32.6
WP_017376501.1\|521482_521749_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_144420759.1\|521745_522246_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_048875904.1\|522366_523242_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_075275277.1\|524331_524571_-	hypothetical protein	NA	NA	NA	NA
WP_017375999.1\|524901_525432_-	hypothetical protein	NA	NA	NA	NA
WP_017376000.1\|525431_525956_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.5e-50	58.4
WP_017376001.1\|526118_527234_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_017376003.1\|527470_528631_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	2.8e-121	58.7
WP_017376004.1\|529082_531086_+	transketolase	NA	NA	NA	NA
WP_017376005.1\|531154_532162_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_017376006.1\|532235_533420_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_017376007.1\|533429_534884_+	pyruvate kinase	NA	NA	NA	NA
WP_017376008.1\|534914_535952_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_017376009.1\|536274_536565_+	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|537919_538894_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_155082176.1\|539018_539690_+	hypothetical protein	NA	NA	NA	NA
WP_017377794.1\|540213_540465_+	hypothetical protein	NA	NA	NA	NA
WP_017377795.1\|540669_541833_+	hypothetical protein	NA	NA	NA	NA
WP_075275388.1\|541855_542545_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017377798.1\|542692_543343_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_017377799.1\|543443_544103_-	hypothetical protein	NA	NA	NA	NA
WP_048875907.1\|546164_546926_-	hypothetical protein	NA	NA	NA	NA
WP_017377800.1\|547344_547605_+	hypothetical protein	NA	NA	NA	NA
WP_017377801.1\|547690_548353_+	hypothetical protein	NA	NA	NA	NA
WP_017377802.1\|548469_549597_+	hypothetical protein	NA	NA	NA	NA
WP_017377803.1\|549972_550134_+	hypothetical protein	NA	NA	NA	NA
WP_144420613.1\|552265_552637_+	hypothetical protein	NA	NA	NA	NA
WP_155051411.1\|552868_554158_+	hypothetical protein	NA	NA	NA	NA
WP_075275272.1\|554295_554526_-	hypothetical protein	NA	NA	NA	NA
WP_017377811.1\|554659_555544_+	hypothetical protein	NA	NA	NA	NA
WP_027243005.1\|555572_556199_-	ribonuclease T	NA	NA	NA	NA
WP_036773165.1\|556229_557429_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_162038648.1\|557667_558765_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	1.1e-05	43.1
WP_017377815.1\|558916_560455_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	3.5e-87	36.5
WP_017375632.1\|560775_561111_-\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-23	51.5
WP_017377701.1\|561982_562216_-\|transposase	transposase	NA	NA	NA	NA
WP_036773116.1\|562586_563561_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_017377817.1\|564072_564570_+	hypothetical protein	NA	NA	NA	NA
WP_017377818.1\|564805_565450_+	porin family protein	NA	NA	NA	NA
WP_053856754.1\|565554_565806_-	hypothetical protein	NA	NA	NA	NA
WP_017377819.1\|565950_566946_-	hypothetical protein	NA	NA	NA	NA
WP_016210813.1\|567023_567452_-	hypothetical protein	NA	NA	NA	NA
WP_016210814.1\|567801_567999_-	hypothetical protein	NA	NA	NA	NA
WP_016210817.1\|568241_568874_-	riboflavin synthase	A0A1V0SE20	Indivirus	1.1e-13	32.8
WP_016210815.1\|569294_570245_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_017377820.1\|570241_571774_-	inactive transglutaminase family protein	NA	NA	NA	NA
WP_016210812.1\|571770_572277_-\|protease	ATP-dependent zinc protease family protein	NA	NA	NA	NA
WP_162038649.1\|572459_573615_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_048875857.1\|573872_574847_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.8e-29	33.2
WP_048876031.1\|575270_576674_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155051409.1\|576707_577508_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_017376557.1\|577626_578322_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	1.2e-10	27.4
WP_017376558.1\|578826_579333_+	hypothetical protein	NA	NA	NA	NA
WP_027242585.1\|579426_579984_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_080999966.1\|580281_581631_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155046619.1\|581717_581975_-	hypothetical protein	NA	NA	NA	NA
WP_017376564.1\|582042_582753_-	hypothetical protein	NA	NA	NA	NA
WP_144420761.1\|582897_583077_-	hypothetical protein	NA	NA	NA	NA
WP_017376566.1\|583599_584859_-	6-phosphofructokinase	NA	NA	NA	NA
WP_017376567.1\|584991_585465_+	hypothetical protein	NA	NA	NA	NA
WP_017376568.1\|585473_586856_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_026063542.1\|586848_587463_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_017376570.1\|587542_588259_+	hypothetical protein	NA	NA	NA	NA
WP_017376571.1\|588433_590758_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.6e-25	49.7
WP_036771330.1\|590924_591899_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017376573.1\|592828_594571_+	hypothetical protein	NA	NA	NA	NA
WP_017376574.1\|594742_595834_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017376575.1\|595866_596505_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_017376576.1\|596543_596816_-	DUF1315 family protein	NA	NA	NA	NA
WP_144420763.1\|596914_597157_-	BolA/IbaG family iron-sulfur metabolism protein	NA	NA	NA	NA
WP_017376578.1\|597174_597477_-	YciI family protein	NA	NA	NA	NA
WP_017376579.1\|597560_598103_-	septation protein A	NA	NA	NA	NA
WP_016210074.1\|598263_598890_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_017376580.1\|598895_599735_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.2e-10	24.2
WP_017376581.1\|599724_600375_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	3.9e-19	33.5
WP_026063543.1\|600378_601212_+	pseudouridine synthase	NA	NA	NA	NA
WP_162038650.1\|601301_602120_-	hypothetical protein	NA	NA	NA	NA
WP_162038651.1\|602110_602428_-	hypothetical protein	NA	NA	NA	NA
WP_157894717.1\|602694_602823_-	hypothetical protein	NA	NA	NA	NA
WP_047927249.1\|602954_603149_-	hypothetical protein	NA	NA	NA	NA
WP_017376585.1\|603341_603992_-	hypothetical protein	NA	NA	NA	NA
WP_017376586.1\|604246_605338_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_017376587.1\|605334_606699_-	peptidoglycan DD-metalloendopeptidase family protein	A0A088FRM7	Mycobacterium_phage	2.6e-17	52.2
WP_017376588.1\|606823_608020_+\|tRNA	tyrosine--tRNA ligase	A0A2I2L594	Orpheovirus	2.8e-07	24.8
WP_144420764.1\|608076_608640_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_017376590.1\|609572_610241_-	hypothetical protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.7e-28	44.1
WP_017376591.1\|610387_611689_-	hypothetical protein	NA	NA	NA	NA
WP_017376593.1\|613179_613584_+	hypothetical protein	NA	NA	NA	NA
WP_027243040.1\|613817_614900_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.4e-18	27.2
WP_017376596.1\|614884_615505_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017376597.1\|615569_616445_+	hypothetical protein	A0A140B3P3	Vibrio_phage	1.8e-11	24.0
WP_017376598.1\|616522_617098_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_017377700.1\|617906_618200_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	6.4e-06	36.5
WP_080999967.1\|618316_618466_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_036771330.1\|619794_620769_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_144420617.1\|620867_621023_-	phosphatase	NA	NA	NA	NA
WP_075275275.1\|620941_621133_-	hypothetical protein	NA	NA	NA	NA
WP_157894718.1\|621486_621906_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.7e-33	48.5
WP_026063680.1\|622160_622385_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-07	46.2
WP_144420618.1\|622529_623351_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-41	42.9
WP_017377700.1\|623308_623602_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	6.4e-06	36.5
WP_162038639.1\|623978_624470_-	hypothetical protein	NA	NA	NA	NA
WP_027243138.1\|625078_625366_-	hypothetical protein	NA	NA	NA	NA
WP_048875909.1\|625858_626629_-\|transposase	IS982-like element ISPsa1 family transposase	NA	NA	NA	NA
WP_027243137.1\|626698_628042_-	hypothetical protein	NA	NA	NA	NA
WP_087910635.1\|628477_629848_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155046582.1\|629844_630009_-	hypothetical protein	NA	NA	NA	NA
WP_017377223.1\|630068_630356_-\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2

DBSCAN-SWA_6

636218 : 679170

Acinetobacter_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017377840.1\|636218_636938_+\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_017377841.1\|637026_638811_+	SLC13 family permease	NA	NA	NA	NA
WP_155601396.1\|639117_639273_+	hypothetical protein	NA	NA	NA	NA
WP_017377842.1\|639199_639454_+	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_027243133.1\|639599_640421_+	amidohydrolase family protein	NA	NA	NA	NA
WP_157894719.1\|640693_640828_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_048876031.1\|640933_642337_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377200.1\|642901_643090_+	hypothetical protein	NA	NA	NA	NA
WP_162038652.1\|643267_643486_+	hypothetical protein	NA	NA	NA	NA
WP_017377198.1\|643871_645512_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_017377197.1\|645624_646974_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.0e-74	37.0
WP_027243130.1\|646970_647840_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	9.3e-69	47.2
WP_017377194.1\|648764_650078_+	ergothioneine biosynthesis protein EgtB	NA	NA	NA	NA
WP_048875913.1\|650074_650845_+	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_017375625.1\|650841_651069_-	hypothetical protein	NA	NA	NA	NA
WP_155046617.1\|651773_651914_-	hypothetical protein	NA	NA	NA	NA
WP_075278729.1\|652058_653186_-\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.1e-20	31.4
WP_069971647.1\|653190_653787_-\|transposase	transposase	NA	NA	NA	NA
WP_162038649.1\|653826_654982_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_048875916.1\|655950_656355_+	hypothetical protein	NA	NA	NA	NA
WP_048875923.1\|656358_657354_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_157894720.1\|657339_658512_-	MFS transporter	NA	NA	NA	NA
WP_036774946.1\|658468_659083_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	G9E4Q1	Emiliania_huxleyi_virus	3.8e-16	35.1
WP_155046615.1\|659779_659941_-	hypothetical protein	NA	NA	NA	NA
WP_017377737.1\|660220_660766_+	non-canonical purine NTP phosphatase	NA	NA	NA	NA
WP_017377736.1\|660799_661465_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_155764145.1\|661524_662136_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.1e-13	31.3
WP_048875917.1\|662075_662480_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_144420767.1\|662758_663436_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_048875918.1\|663478_664060_-	hypothetical protein	NA	NA	NA	NA
WP_155046614.1\|664204_664876_-	hypothetical protein	NA	NA	NA	NA
WP_047927746.1\|665478_666066_-	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|666105_667261_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_036773915.1\|667234_667630_-	hypothetical protein	NA	NA	NA	NA
WP_017377727.1\|668057_668873_-	hypothetical protein	NA	NA	NA	NA
WP_017377726.1\|668963_669950_+	transaldolase	V5UTB0	Synechococcus_phage	1.3e-13	33.5
WP_017377725.1\|670119_670641_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.8e-27	43.8
WP_017377724.1\|670674_670926_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	3.9e-20	57.6
WP_017377723.1\|670936_672214_-	hypothetical protein	NA	NA	NA	NA
WP_017377722.1\|672905_673433_+	hypothetical protein	NA	NA	NA	NA
WP_017377721.1\|673549_675862_-	RNA-binding transcriptional accessory protein	NA	NA	NA	NA
WP_036773913.1\|675990_676806_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017377718.1\|677062_677527_+	DUF4402 domain-containing protein	NA	NA	NA	NA
WP_162038649.1\|678014_679170_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0

DBSCAN-SWA_7

686525 : 758755

Staphylococcus_phage(44.44%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875919.1\|686525_686843_+\|transposase	transposase	NA	NA	NA	NA
WP_017377706.1\|686860_687073_+	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|687097_688253_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_144420621.1\|689411_690173_-\|transposase	transposase	NA	NA	NA	NA
WP_075275277.1\|690043_690283_-	hypothetical protein	NA	NA	NA	NA
WP_036771325.1\|692363_693338_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_027242902.1\|693462_694899_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_017376308.1\|694978_696439_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_017376309.1\|696559_696847_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_016210526.1\|697044_698088_+	rod shape-determining protein	NA	NA	NA	NA
WP_017376311.1\|698103_699003_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_017376312.1\|698999_699518_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_017376313.1\|699587_700205_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_026063524.1\|700214_701702_+	ribonuclease G	NA	NA	NA	NA
WP_027242903.1\|701711_705392_+	DUF3971 domain-containing protein	NA	NA	NA	NA
WP_017376318.1\|705465_706275_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_017376319.1\|706274_706955_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_036773116.1\|707579_708554_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_048875923.1\|708596_709592_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036773116.1\|709644_710619_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_017376224.1\|710931_711816_-	DUF2608 domain-containing protein	NA	NA	NA	NA
WP_017376223.1\|711946_712768_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_017376222.1\|712769_713807_-	asparaginase	NA	NA	NA	NA
WP_017376221.1\|713810_716468_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_017376220.1\|716545_717355_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_017376219.1\|717761_718529_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_017376218.1\|718693_719572_+	elongation factor Ts	NA	NA	NA	NA
WP_017376217.1\|719575_720313_+	UMP kinase	NA	NA	NA	NA
WP_017376216.1\|720316_720874_+	ribosome recycling factor	NA	NA	NA	NA
WP_026063514.1\|720881_721628_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	6.6e-23	44.0
WP_027242904.1\|721635_722442_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_036771906.1\|722530_723406_+	lipid A biosynthesis acyltransferase	NA	NA	NA	NA
WP_144420622.1\|723502_725080_-	hypothetical protein	NA	NA	NA	NA
WP_027242905.1\|725288_725477_+	hypothetical protein	NA	NA	NA	NA
WP_017376212.1\|725524_727435_-	hypothetical protein	NA	NA	NA	NA
WP_017376211.1\|727971_728511_-	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_017376210.1\|728507_729536_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_017376209.1\|729525_730590_-	hypothetical protein	NA	NA	NA	NA
WP_065653749.1\|730577_732806_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_027242906.1\|732792_733860_-	hydroxymethylglutaryl-CoA reductase	NA	NA	NA	NA
WP_036771893.1\|734144_736562_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_017376207.1\|736642_737176_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_017376206.1\|737286_738336_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_075275393.1\|738353_738800_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_017376204.1\|738799_739573_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_027242907.1\|739591_740746_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_017376201.1\|740959_741529_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	3.4e-27	43.4
WP_017376200.1\|741552_745059_+	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	1.9e-192	38.6
WP_027242908.1\|745136_746096_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_017376198.1\|746070_747531_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_017376197.1\|747566_749096_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.1e-85	42.6
WP_080999970.1\|749129_750533_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155635845.1\|752690_754259_+	hypothetical protein	NA	NA	NA	NA
WP_048876012.1\|754343_755747_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048876012.1\|755892_757296_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036771330.1\|757780_758755_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_8

771228 : 831498

Acinetobacter_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048876012.1\|771228_772632_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_082300719.1\|772850_773276_+	hypothetical protein	NA	NA	NA	NA
WP_027243151.1\|773327_774815_-	hypothetical protein	NA	NA	NA	NA
WP_017377221.1\|775124_775664_-	superoxide dismutase family protein	NA	NA	NA	NA
WP_162038653.1\|775953_777110_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.0e-50	39.9
WP_017377224.1\|777426_778002_-	hypothetical protein	NA	NA	NA	NA
WP_080999971.1\|778115_779519_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377226.1\|779515_779806_-	hypothetical protein	NA	NA	NA	NA
WP_017377227.1\|780173_780587_+	hypothetical protein	NA	NA	NA	NA
WP_052106211.1\|781275_783063_+	protein kinase family protein	NA	NA	NA	NA
WP_017377229.1\|783229_783850_+	DUF2272 domain-containing protein	NA	NA	NA	NA
WP_155046612.1\|784196_784337_+	hypothetical protein	NA	NA	NA	NA
WP_017377231.1\|786703_788161_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	9.4e-98	42.1
WP_017377232.1\|788229_789810_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.1e-16	27.3
WP_017377234.1\|790450_794347_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	3.4e-118	54.4
WP_016210741.1\|794353_794677_-	late competence development ComFB family protein	NA	NA	NA	NA
WP_017377235.1\|794750_795224_-	hypothetical protein	NA	NA	NA	NA
WP_036772195.1\|795255_796251_-	hypothetical protein	NA	NA	NA	NA
WP_162038654.1\|796502_796769_+	hypothetical protein	NA	NA	NA	NA
WP_082303845.1\|796768_798139_+	hypothetical protein	NA	NA	NA	NA
WP_087910659.1\|798498_799446_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	4.3e-35	35.2
WP_017377238.1\|799764_800109_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_144420626.1\|800202_800874_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_017377240.1\|800913_801741_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_036772199.1\|801827_802355_+	hypothetical protein	NA	NA	NA	NA
WP_027243013.1\|803240_803660_+	hypothetical protein	NA	NA	NA	NA
WP_052106212.1\|803768_804350_+	hypothetical protein	NA	NA	NA	NA
WP_017377245.1\|804704_805985_+	hypothetical protein	NA	NA	NA	NA
WP_017377246.1\|806105_806969_-	polyamine aminopropyltransferase	NA	NA	NA	NA
WP_017377247.1\|807057_807852_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_036772212.1\|808089_809076_+	HlyD family secretion protein	NA	NA	NA	NA
WP_027243014.1\|809081_810608_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_144420771.1\|810703_811948_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_017377251.1\|812001_813381_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	2.4e-34	35.8
WP_026063614.1\|813498_814284_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.7e-32	33.3
WP_016211687.1\|814626_815271_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_016211684.1\|817133_817709_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_036771330.1\|818758_819733_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_081377824.1\|820616_820955_+\|transposase	transposase	NA	NA	NA	NA
WP_053093666.1\|822268_822946_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.4e-48	47.4
WP_144420627.1\|824444_824666_+	hypothetical protein	NA	NA	NA	NA
WP_075274768.1\|825146_825446_-	hypothetical protein	NA	NA	NA	NA
WP_081000005.1\|825546_825708_-	hypothetical protein	NA	NA	NA	NA
WP_080999972.1\|825644_826145_-	hypothetical protein	NA	NA	NA	NA
WP_017376821.1\|826240_826669_-	hypothetical protein	NA	NA	NA	NA
WP_075275303.1\|826928_827918_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_080999973.1\|827894_828860_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.0e-48	38.6
WP_017377288.1\|829078_829339_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_087910637.1\|829433_830168_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	2.0e-24	31.3
WP_155046611.1\|830196_830349_+	hypothetical protein	NA	NA	NA	NA
WP_048875930.1\|830553_831498_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

867302 : 989629

Staphylococcus_phage(22.73%)

transposase,integrase,tRNA

attL 869938:869997|attR 920359:921119

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875933.1\|867302_868247_-\|transposase	transposase	NA	NA	NA	NA
WP_080999974.1\|868520_869924_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420631.1\|869928_870714_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-06	29.7
869938:869997	attL	NA	NA	NA	NA
WP_075275282.1\|871104_871947_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017377467.1\|871943_872240_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_017377471.1\|873721_874333_-	hypothetical protein	NA	NA	NA	NA
WP_017377472.1\|874401_875208_-	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|875511_876486_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_017377475.1\|876657_878550_+	DNA topoisomerase IV subunit B	A0A172JHT4	Bacillus_phage	3.6e-81	32.3
WP_027243186.1\|879056_881438_+	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|881852_883256_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875935.1\|883696_884176_+	hypothetical protein	NA	NA	NA	NA
WP_144420633.1\|884243_885500_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036772665.1\|885646_886171_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017376899.1\|886575_886716_+	hypothetical protein	NA	NA	NA	NA
WP_051929562.1\|886913_887618_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017376902.1\|888472_888784_-	hypothetical protein	NA	NA	NA	NA
WP_017376903.1\|888847_889027_-	hypothetical protein	NA	NA	NA	NA
WP_027243159.1\|889589_889772_+	hypothetical protein	NA	NA	NA	NA
WP_017376905.1\|889835_890063_-	hypothetical protein	NA	NA	NA	NA
WP_026063576.1\|890270_891035_+	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	6.3e-29	33.0
WP_026063577.1\|891261_891555_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	4.7e-17	52.8
WP_048875878.1\|892080_893484_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376909.1\|893953_894931_-	malate dehydrogenase	NA	NA	NA	NA
WP_027243158.1\|895027_896488_-	TolC family outer membrane protein	NA	NA	NA	NA
WP_017376911.1\|896514_897168_-	protein-L-isoaspartate O-methyltransferase	NA	NA	NA	NA
WP_017376912.1\|897292_897859_+	hypothetical protein	NA	NA	NA	NA
WP_036774028.1\|898155_899889_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	1.6e-32	30.0
WP_047927497.1\|899960_901667_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-24	26.3
WP_017376916.1\|901658_902717_-	hypothetical protein	NA	NA	NA	NA
WP_048875936.1\|902970_903819_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.4e-16	31.4
WP_017375855.1\|904413_904860_-	hypothetical protein	NA	NA	NA	NA
WP_026063481.1\|905549_906971_-	sodium:proton antiporter	NA	NA	NA	NA
WP_017375857.1\|907353_908796_+	MFS transporter	NA	NA	NA	NA
WP_144420634.1\|909194_910526_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036771639.1\|910630_911605_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_017377669.1\|911654_912359_+	hypothetical protein	NA	NA	NA	NA
WP_144420635.1\|912799_913612_+\|transposase	transposase	NA	NA	NA	NA
WP_144420636.1\|913670_916181_+	hypothetical protein	NA	NA	NA	NA
WP_036815620.1\|916526_917702_+	outer membrane transport family protein	NA	NA	NA	NA
WP_144420637.1\|919049_919274_-	hypothetical protein	NA	NA	NA	NA
WP_048875940.1\|919302_920466_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.4e-25	31.1
WP_036774146.1\|922708_923854_-	competence/damage-inducible protein A	NA	NA	NA	NA
920359:921119	attR	NA	NA	NA	NA
WP_027243152.1\|924445_925381_+	hypothetical protein	NA	NA	NA	NA
WP_048875941.1\|926878_927190_+	hypothetical protein	NA	NA	NA	NA
WP_144420638.1\|927186_928269_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377679.1\|928584_928791_+	hypothetical protein	NA	NA	NA	NA
WP_027243160.1\|928888_929419_+	prokaryotic cytochrome b561 family protein	NA	NA	NA	NA
WP_017377681.1\|929706_930885_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	7.7e-50	31.6
WP_027243161.1\|931033_934870_-	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_017377683.1\|934856_936359_-	sodium/proline symporter PutP	NA	NA	NA	NA
WP_036773927.1\|936910_937546_+	peroxiredoxin C	NA	NA	NA	NA
WP_016211781.1\|938036_939284_+	LbtU family siderophore porin	NA	NA	NA	NA
WP_075275285.1\|939506_940943_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_048875943.1\|941118_942336_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_080999976.1\|942797_943577_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_036771330.1\|944583_945558_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_048875941.1\|946603_946915_+	hypothetical protein	NA	NA	NA	NA
WP_144420638.1\|946911_947994_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155046609.1\|948304_948511_-	hypothetical protein	NA	NA	NA	NA
WP_027243178.1\|950231_951593_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	4.3e-12	35.5
WP_017375734.1\|951703_952075_-	DUF1043 family protein	NA	NA	NA	NA
WP_017375735.1\|952297_952948_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_017375736.1\|952990_954073_+	cell division protein ZapE	NA	NA	NA	NA
WP_069971648.1\|954799_955774_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.7e-29	31.6
WP_162038655.1\|959052_960102_+	protein kinase family protein	NA	NA	NA	NA
WP_162038656.1\|960387_960894_+	hypothetical protein	NA	NA	NA	NA
WP_017376859.1\|961682_961919_+	hypothetical protein	NA	NA	NA	NA
WP_075275287.1\|962038_963082_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017375571.1\|963328_963730_+	hypothetical protein	NA	NA	NA	NA
WP_036774710.1\|963903_964803_-	hypothetical protein	NA	NA	NA	NA
WP_048875946.1\|965197_966409_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.8e-25	31.1
WP_036771959.1\|966419_966644_-	hypothetical protein	NA	NA	NA	NA
WP_155046608.1\|966965_967130_-	hypothetical protein	NA	NA	NA	NA
WP_048876012.1\|967222_968626_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_027243219.1\|968792_969101_+	hypothetical protein	NA	NA	NA	NA
WP_017375595.1\|969385_969559_-	hypothetical protein	NA	NA	NA	NA
WP_048875947.1\|970184_971234_-\|transposase	transposase	NA	NA	NA	NA
WP_048875948.1\|971302_972325_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.9e-135	72.4
WP_017378198.1\|972370_973285_-	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|973324_974480_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_017378197.1\|974437_975307_-	hypothetical protein	NA	NA	NA	NA
WP_053093667.1\|976744_977461_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017376026.1\|977905_979777_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.4e-34	28.4
WP_027243175.1\|979868_981614_-	DNA primase	A0A1S5RGL3	Helicobacter_phage	7.6e-46	36.7
WP_017376029.1\|981693_982143_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.4e-20	44.9
WP_016211035.1\|982195_982411_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_017376030.1\|982657_983674_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.8e-100	54.2
WP_017376031.1\|983722_984352_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_017376032.1\|984692_985904_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_048875949.1\|985936_986287_-	hypothetical protein	NA	NA	NA	NA
WP_144420640.1\|986252_986933_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376035.1\|987209_987629_-	hypothetical protein	NA	NA	NA	NA
WP_157894724.1\|987774_988575_-\|transposase	transposase	NA	NA	NA	NA
WP_036771639.1\|988654_989629_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2

DBSCAN-SWA_10

1008689 : 1051881

Orpheovirus(22.22%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026063502.1\|1008689_1009565_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_144420642.1\|1009829_1010024_-	hypothetical protein	NA	NA	NA	NA
WP_036773960.1\|1010168_1010642_-	hypothetical protein	NA	NA	NA	NA
WP_155046586.1\|1010911_1011085_+	hypothetical protein	NA	NA	NA	NA
WP_144420643.1\|1011289_1012603_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376055.1\|1012599_1013244_-	hypothetical protein	NA	NA	NA	NA
WP_036772015.1\|1013762_1014950_-	MFS transporter	NA	NA	NA	NA
WP_036772012.1\|1015082_1015772_+	hypothetical protein	NA	NA	NA	NA
WP_017376060.1\|1015845_1017195_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	7.5e-33	27.6
WP_048876123.1\|1017298_1019479_+	GTP diphosphokinase	NA	NA	NA	NA
WP_036772169.1\|1019548_1020424_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017376064.1\|1020566_1020767_+	hypothetical protein	NA	NA	NA	NA
WP_017376065.1\|1020890_1021298_+	hypothetical protein	NA	NA	NA	NA
WP_144420776.1\|1021277_1021856_-	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	6.9e-20	34.3
WP_017376067.1\|1022278_1022941_+	adenylate kinase	NA	NA	NA	NA
WP_016211263.1\|1022971_1023340_+	thioredoxin family protein	NA	NA	NA	NA
WP_017376068.1\|1023350_1024667_-	MFS transporter	NA	NA	NA	NA
WP_144420644.1\|1024913_1025525_+	DedA family protein	NA	NA	NA	NA
WP_017376070.1\|1025627_1025780_+	hypothetical protein	NA	NA	NA	NA
WP_016211261.1\|1025950_1026244_-	cold shock domain-containing protein	A0A2H4N7Y6	Lake_Baikal_phage	5.8e-15	61.5
WP_036772670.1\|1026484_1026787_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	7.5e-10	40.0
WP_017376072.1\|1026841_1029115_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.3e-167	42.0
WP_016211259.1\|1029174_1029420_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_048875954.1\|1029544_1030300_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_048875955.1\|1030408_1031383_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.3e-30	33.2
WP_036771709.1\|1031590_1032352_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_017376076.1\|1032335_1033292_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.6e-61	43.7
WP_017376078.1\|1036055_1036796_+	hypothetical protein	NA	NA	NA	NA
WP_017376079.1\|1037245_1038040_-	inositol monophosphatase	NA	NA	NA	NA
WP_017376080.1\|1038202_1038991_+\|tRNA	tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ	NA	NA	NA	NA
WP_017376081.1\|1038987_1040199_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_144420777.1\|1040191_1040548_+	hypothetical protein	NA	NA	NA	NA
WP_017376083.1\|1040642_1041071_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	1.8e-17	39.4
WP_036771725.1\|1041222_1042332_+	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_017376085.1\|1042328_1043057_+	type IV pilus biogenesis/stability protein PilW	NA	NA	NA	NA
WP_017376086.1\|1043114_1044002_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017376087.1\|1044086_1044461_+	hypothetical protein	NA	NA	NA	NA
WP_017376088.1\|1044560_1045838_+\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	3.6e-21	24.8
WP_027242842.1\|1045852_1046581_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_048875956.1\|1046567_1047809_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_027242841.1\|1047918_1049322_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_155046606.1\|1049474_1049645_-	hypothetical protein	NA	NA	NA	NA
WP_075275292.1\|1051050_1051881_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1055427 : 1112675

Staphylococcus_phage(20.0%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875957.1\|1055427_1056084_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-10	31.9
WP_017375746.1\|1056080_1056389_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.7e-09	41.4
WP_036771957.1\|1056737_1057709_+\|transposase	transposase	NA	NA	NA	NA
WP_017377899.1\|1058012_1058804_+	hypothetical protein	NA	NA	NA	NA
WP_048875958.1\|1058793_1059657_-	hypothetical protein	NA	NA	NA	NA
WP_017377897.1\|1059683_1060103_-	response regulator	W8CYM9	Bacillus_phage	1.2e-05	29.4
WP_017377896.1\|1060155_1061112_-	23S rRNA pseudouridine(955/2504/2580) synthase RluC	NA	NA	NA	NA
WP_027242839.1\|1061594_1064267_+	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_017377894.1\|1064347_1064974_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_026063687.1\|1065130_1066729_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_017377892.1\|1066818_1068240_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_017377891.1\|1068270_1068792_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.0e-10	34.2
WP_017377890.1\|1068788_1069394_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_017377889.1\|1069470_1070481_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	6.9e-07	30.8
WP_017377888.1\|1070593_1071298_+	protein TolQ	NA	NA	NA	NA
WP_017377887.1\|1071332_1071764_+	protein TolR	NA	NA	NA	NA
WP_036771700.1\|1071766_1072861_+	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_048875959.1\|1072920_1074273_+	Tol-Pal system beta propeller repeat protein TolB	NA	NA	NA	NA
WP_017377882.1\|1074308_1074950_+	OmpA family protein	NA	NA	NA	NA
WP_144420778.1\|1075022_1075922_+	tol-pal system protein YbgF	NA	NA	NA	NA
WP_027242836.1\|1075924_1076572_+	7-carboxy-7-deazaguanine synthase QueE	J9PV61	Bacillus_phage	1.6e-36	38.6
WP_027242835.1\|1076622_1077426_-	AAA family ATPase	A0A0E3G5H5	Synechococcus_phage	6.8e-42	43.1
WP_017377879.1\|1077607_1077823_+	SlyX family protein	NA	NA	NA	NA
WP_017377878.1\|1077826_1078060_-	hypothetical protein	NA	NA	NA	NA
WP_017377877.1\|1078121_1079714_-	exodeoxyribonuclease VII large subunit	NA	NA	NA	NA
WP_017377875.1\|1079916_1080846_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	7.0e-14	31.9
WP_017377874.1\|1080847_1081615_+	ABC transporter permease	NA	NA	NA	NA
WP_047927659.1\|1081980_1082751_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_048875960.1\|1082809_1083784_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017377870.1\|1083891_1084254_-	hypothetical protein	NA	NA	NA	NA
WP_017377869.1\|1084423_1086133_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_048875961.1\|1086373_1087777_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_146619530.1\|1087828_1088086_+	hypothetical protein	NA	NA	NA	NA
WP_027242834.1\|1088834_1090142_+	hypothetical protein	NA	NA	NA	NA
WP_036773793.1\|1090601_1090979_-	hypothetical protein	NA	NA	NA	NA
WP_017376708.1\|1091123_1091525_-\|transposase	transposase	NA	NA	NA	NA
WP_048875964.1\|1092089_1092869_-	hypothetical protein	NA	NA	NA	NA
WP_155046604.1\|1092936_1093077_-	hypothetical protein	NA	NA	NA	NA
WP_144420647.1\|1093277_1093475_+	hypothetical protein	NA	NA	NA	NA
WP_053093668.1\|1093612_1094212_-	hypothetical protein	NA	NA	NA	NA
WP_036771696.1\|1094394_1095855_-	hypothetical protein	NA	NA	NA	NA
WP_017378009.1\|1096269_1098015_-	hypothetical protein	NA	NA	NA	NA
WP_027243143.1\|1098450_1099311_-	hypothetical protein	NA	NA	NA	NA
WP_017378007.1\|1099828_1101772_-	hypothetical protein	NA	NA	NA	NA
WP_048875961.1\|1101917_1103321_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017378006.1\|1103440_1104070_-	response regulator	NA	NA	NA	NA
WP_017378005.1\|1104308_1105028_-	sulfate transporter CysZ	NA	NA	NA	NA
WP_017378004.1\|1105141_1108681_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_017378003.1\|1108747_1109578_+	hypothetical protein	NA	NA	NA	NA
WP_036773465.1\|1109564_1111604_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	7.1e-128	40.9
WP_027243145.1\|1111619_1112675_+\|protease	protease SohB	NA	NA	NA	NA

DBSCAN-SWA_12

1119539 : 1153681

Acinetobacter_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144420650.1\|1119539_1120796_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376600.1\|1121051_1121231_+	hypothetical protein	NA	NA	NA	NA
WP_162038657.1\|1121571_1122204_+\|transposase	IS3 family transposase	A0A0N7C035	Escherichia_phage	5.6e-15	33.1
WP_157894725.1\|1122501_1122735_+\|transposase	transposase	NA	NA	NA	NA
WP_080999971.1\|1123506_1124910_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377761.1\|1125080_1126451_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_144420780.1\|1126497_1127397_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_017377763.1\|1127377_1130182_-	response regulator	A0A1V0SGX0	Hokovirus	6.9e-57	31.8
WP_017377764.1\|1130261_1130858_-	hypothetical protein	NA	NA	NA	NA
WP_017377765.1\|1131271_1132027_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_162038649.1\|1132116_1133273_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_027242898.1\|1133460_1134102_+	hypothetical protein	NA	NA	NA	NA
WP_017377768.1\|1134371_1135697_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_047927230.1\|1135693_1137751_+	hypothetical protein	NA	NA	NA	NA
WP_017377771.1\|1137728_1138301_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_144420781.1\|1138383_1138716_+	DUF1820 family protein	NA	NA	NA	NA
WP_017377773.1\|1138780_1139815_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
WP_027242897.1\|1139802_1140924_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_107517353.1\|1141017_1141965_-	magnesium transporter CorA family protein	NA	NA	NA	NA
WP_027242896.1\|1142157_1143825_+	AMP-binding protein	A0A1V0SBX8	Catovirus	1.2e-19	25.3
WP_027242895.1\|1144111_1144963_-	hypothetical protein	NA	NA	NA	NA
WP_017377782.1\|1145371_1147840_+	bifunctional aspartate kinase/homoserine dehydrogenase I	NA	NA	NA	NA
WP_017377783.1\|1147853_1148828_+	homoserine kinase	NA	NA	NA	NA
WP_017377784.1\|1148814_1150083_+	threonine synthase	NA	NA	NA	NA
WP_027242894.1\|1150116_1151865_-	PLD-like domain protein	NA	NA	NA	NA
WP_017375591.1\|1152044_1152248_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_144420652.1\|1152466_1153144_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.6e-34	38.8
WP_017377787.1\|1153453_1153681_+\|transposase	transposase	A4JX31	Burkholderia_virus	8.1e-09	47.0

DBSCAN-SWA_13

1193868 : 1254146

uncultured_Mediterranean_phage(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051929562.1\|1193868_1194573_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_036771332.1\|1194823_1195798_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.3e-30	33.2
WP_017376395.1\|1196685_1199412_-	hypothetical protein	NA	NA	NA	NA
WP_036773116.1\|1199935_1200910_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_017376397.1\|1201107_1202589_-	MFS transporter	NA	NA	NA	NA
WP_016209947.1\|1203048_1203711_+	carbonic anhydrase	NA	NA	NA	NA
WP_017376398.1\|1203952_1205185_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_017376399.1\|1205341_1208113_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.9e-150	39.4
WP_017376400.1\|1208181_1208625_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_017376401.1\|1208777_1210250_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.8e-43	30.2
WP_017376402.1\|1210361_1211423_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_027242800.1\|1211419_1212454_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_017376405.1\|1212456_1213497_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_026063528.1\|1213681_1214797_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.2e-94	49.2
WP_017376407.1\|1214835_1215189_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.1e-07	46.5
WP_017376408.1\|1215209_1217078_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_017376409.1\|1217099_1218044_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.4e-38	35.2
WP_017376410.1\|1218277_1218556_+	hypothetical protein	NA	NA	NA	NA
WP_016209938.1\|1218918_1219557_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_017376411.1\|1219531_1220956_-	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	3.9e-40	33.4
WP_017376412.1\|1221156_1221834_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_027242801.1\|1221954_1223229_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.7e-90	50.9
WP_017376414.1\|1223296_1224052_+	hypothetical protein	NA	NA	NA	NA
WP_017376415.1\|1224103_1225021_+	TIGR01777 family protein	NA	NA	NA	NA
WP_144420654.1\|1225445_1226225_+\|transposase	transposase	NA	NA	NA	NA
WP_017376231.1\|1226277_1226565_+\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_051929627.1\|1226624_1226975_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155046603.1\|1227168_1227321_+	hypothetical protein	NA	NA	NA	NA
WP_080999981.1\|1227248_1227722_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.9e-32	48.0
WP_048875973.1\|1227734_1228370_+\|transposase	transposase	NA	NA	NA	NA
WP_036773947.1\|1228881_1229757_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_036772615.1\|1230543_1230867_+	hypothetical protein	NA	NA	NA	NA
WP_017376433.1\|1231363_1232722_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.9e-37	26.0
WP_026063530.1\|1232945_1233134_+	hypothetical protein	NA	NA	NA	NA
WP_017376430.1\|1233147_1234281_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_048875975.1\|1234481_1238354_+	tandem-95 repeat protein	NA	NA	NA	NA
WP_162038658.1\|1238615_1239113_-	hypothetical protein	NA	NA	NA	NA
WP_017375910.1\|1239502_1240231_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	41.8
WP_017375910.1\|1240633_1241362_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	41.8
WP_075275409.1\|1241425_1242253_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_027242802.1\|1242434_1242803_-	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_017376425.1\|1242799_1243618_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_017376424.1\|1243718_1244534_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_017376423.1\|1244817_1246878_+	hypothetical protein	NA	NA	NA	NA
WP_144420655.1\|1246874_1247300_+	hypothetical protein	NA	NA	NA	NA
WP_017376421.1\|1247485_1248979_-	hypothetical protein	NA	NA	NA	NA
WP_017376420.1\|1249111_1249927_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_017376419.1\|1250022_1250439_-	hypothetical protein	NA	NA	NA	NA
WP_017376418.1\|1250821_1251361_-	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_144420656.1\|1252277_1252439_-	phosphatase	NA	NA	NA	NA
WP_048875923.1\|1253150_1254146_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1282885 : 1298201

Acinetobacter_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875980.1\|1282885_1284289_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017378296.1\|1285729_1286515_+	hypothetical protein	NA	NA	NA	NA
WP_017378295.1\|1286605_1288255_-	hypothetical protein	NA	NA	NA	NA
WP_017378294.1\|1288399_1289245_-	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|1289358_1290762_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_047927801.1\|1290758_1291205_-	hypothetical protein	NA	NA	NA	NA
WP_157894727.1\|1291446_1292097_-	hypothetical protein	NA	NA	NA	NA
WP_017378290.1\|1292124_1293000_-	hypothetical protein	NA	NA	NA	NA
WP_075275303.1\|1293135_1294125_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_053093670.1\|1294101_1294782_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-43	43.0
WP_155046602.1\|1294895_1295675_+	hypothetical protein	NA	NA	NA	NA
WP_048875973.1\|1295951_1296587_+\|transposase	transposase	NA	NA	NA	NA
WP_155046582.1\|1296583_1296748_-	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|1296946_1297921_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017378288.1\|1297979_1298201_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1358178 : 1398583

Tupanvirus(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017378228.1\|1358178_1359099_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_155048048.1\|1359150_1359684_-	hypothetical protein	NA	NA	NA	NA
WP_155046600.1\|1363262_1363406_-	hypothetical protein	NA	NA	NA	NA
WP_017378223.1\|1364015_1364834_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_016211418.1\|1364941_1365403_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_017378221.1\|1365419_1366343_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_027242798.1\|1366366_1367416_-	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_047927040.1\|1367553_1368147_+	oligoribonuclease	A0A1B3B0T8	Gordonia_phage	1.2e-14	29.6
WP_017378219.1\|1368169_1368640_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_144420785.1\|1368749_1370000_+	AMIN domain-containing protein	A0A067ZJB6	Vibrio_phage	1.7e-15	27.4
WP_016211840.1\|1370688_1371153_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	4.7e-19	32.9
WP_036773427.1\|1371585_1373064_+	catalase	A0A2K9L572	Tupanvirus	3.3e-98	46.5
WP_017378213.1\|1373180_1373633_+	CBS domain-containing protein	NA	NA	NA	NA
WP_155046599.1\|1373757_1373913_-	hypothetical protein	NA	NA	NA	NA
WP_144420662.1\|1374057_1374261_-	hypothetical protein	NA	NA	NA	NA
WP_017378212.1\|1374451_1374850_-	hypothetical protein	NA	NA	NA	NA
WP_048875983.1\|1375035_1375641_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.3e-48	49.5
WP_017375549.1\|1375649_1375946_-	hypothetical protein	NA	NA	NA	NA
WP_048875984.1\|1375950_1376487_-\|transposase	transposase	NA	NA	NA	NA
WP_155046598.1\|1376631_1377201_-	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|1377280_1378255_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_048875986.1\|1378251_1378749_-	hypothetical protein	NA	NA	NA	NA
WP_087910640.1\|1379156_1379573_+	hypothetical protein	NA	NA	NA	NA
WP_053856767.1\|1379640_1381044_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275305.1\|1381040_1381661_-	hypothetical protein	NA	NA	NA	NA
WP_036773116.1\|1381932_1382907_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_036773538.1\|1383071_1383695_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_017376442.1\|1383691_1385632_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.8e-72	33.0
WP_017376443.1\|1385787_1386441_+	glutaredoxin 2	NA	NA	NA	NA
WP_017376444.1\|1386609_1387785_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_017376445.1\|1388138_1389464_+	hypothetical protein	NA	NA	NA	NA
WP_026063532.1\|1389556_1390345_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_017376447.1\|1390446_1391319_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_017376448.1\|1391504_1392767_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_017376449.1\|1392840_1393371_+	hypothetical protein	NA	NA	NA	NA
WP_017376450.1\|1393392_1394898_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.7e-87	40.4
WP_017376451.1\|1394910_1395576_+\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_017376452.1\|1395669_1397430_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_036773947.1\|1397707_1398583_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1404249 : 1509675

Burkholderia_phage(13.04%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017376460.1\|1404249_1406844_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.4e-88	41.3
WP_017376461.1\|1407150_1407414_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.1e-12	68.6
WP_069971651.1\|1407786_1408662_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_155046597.1\|1408776_1408953_+	hypothetical protein	NA	NA	NA	NA
WP_017376465.1\|1409497_1411060_-	hypothetical protein	NA	NA	NA	NA
WP_036772167.1\|1411601_1412549_-	sphingomyelin phosphodiesterase	NA	NA	NA	NA
WP_017376467.1\|1412768_1414244_-	APC family permease	NA	NA	NA	NA
WP_017376469.1\|1414763_1415786_-	hypothetical protein	NA	NA	NA	NA
WP_017376470.1\|1416142_1417510_+	glycerol-3-phosphate transporter	NA	NA	NA	NA
WP_026063533.1\|1417785_1418040_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_048876132.1\|1418088_1419342_+	GTPase HflX	NA	NA	NA	NA
WP_027242811.1\|1419361_1420576_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_017376474.1\|1420575_1421469_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_017376475.1\|1421666_1422965_+	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	2.4e-65	34.1
WP_027242812.1\|1423054_1424332_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	7.5e-51	33.1
WP_036772166.1\|1424345_1426745_+	ribonuclease R	Q0GXV6	Lactococcus_phage	5.2e-69	33.3
WP_017376476.1\|1426741_1427500_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_017376477.1\|1427676_1428066_+	hypothetical protein	NA	NA	NA	NA
WP_162038641.1\|1428674_1428818_-	hypothetical protein	NA	NA	NA	NA
WP_017376231.1\|1430188_1430476_+\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_081078114.1\|1430841_1431633_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.9e-44	41.4
WP_017377694.1\|1432771_1433500_-\|transposase	IS6-like element ISPsa2 family transposase	A0A077SL39	Escherichia_phage	7.8e-45	42.7
WP_017377465.1\|1433518_1434376_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.3e-16	31.3
WP_027242813.1\|1434381_1435635_-	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_027242814.1\|1435668_1437537_-	IucA/IucC family siderophore biosynthesis protein	NA	NA	NA	NA
WP_047927302.1\|1437523_1438747_-	MFS transporter	NA	NA	NA	NA
WP_048875988.1\|1438746_1440582_-	IucA/IucC family siderophore biosynthesis protein	NA	NA	NA	NA
WP_017377461.1\|1440578_1441784_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_017377460.1\|1441795_1443985_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_017377459.1\|1444553_1445183_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_075275307.1\|1445205_1445625_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_036772544.1\|1445605_1446022_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_075275308.1\|1446021_1446864_+	energy transducer TonB	NA	NA	NA	NA
WP_027242817.1\|1446919_1447900_+	iron-siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017377453.1\|1447880_1449878_+	iron ABC transporter permease	NA	NA	NA	NA
WP_027242818.1\|1449895_1451071_-	hypothetical protein	NA	NA	NA	NA
WP_048875989.1\|1451352_1452756_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_027242819.1\|1452904_1453267_-	hypothetical protein	NA	NA	NA	NA
WP_017377447.1\|1453438_1453657_-	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_027242820.1\|1454202_1456230_+	NADPH-dependent 2,4-dienoyl-CoA reductase	NA	NA	NA	NA
WP_017377445.1\|1456311_1457562_-	MFS transporter	NA	NA	NA	NA
WP_017377444.1\|1457861_1458197_-	ferredoxin family protein	NA	NA	NA	NA
WP_016211283.1\|1458508_1458757_+	30S ribosomal protein S16	NA	NA	NA	NA
WP_017377443.1\|1458792_1459302_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_017377442.1\|1459301_1460081_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_017377441.1\|1460098_1460446_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_017377440.1\|1460555_1460831_+	hypothetical protein	A0A1B0Z0G5	Vibrio_phage	6.6e-13	50.6
WP_080963600.1\|1460992_1461349_+	hypothetical protein	NA	NA	NA	NA
WP_036816484.1\|1461747_1462083_+	hypothetical protein	NA	NA	NA	NA
WP_048875990.1\|1462287_1463064_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420664.1\|1463020_1463893_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.8e-49	40.6
WP_017376231.1\|1464177_1464465_-\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_051929871.1\|1464587_1465268_+\|transposase	transposase	NA	NA	NA	NA
WP_036773116.1\|1466812_1467787_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_051929549.1\|1467866_1468244_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_047927093.1\|1468342_1469446_-	hypothetical protein	NA	NA	NA	NA
WP_053856757.1\|1471106_1471604_-\|transposase	transposase	NA	NA	NA	NA
WP_048875992.1\|1471748_1472147_-	hypothetical protein	NA	NA	NA	NA
WP_144420665.1\|1472232_1473138_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-49	39.5
WP_047927606.1\|1473356_1473677_-\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	3.1e-06	36.6
WP_144420666.1\|1473758_1474535_-	DUF2807 domain-containing protein	NA	NA	NA	NA
WP_027242597.1\|1475108_1475942_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_144420786.1\|1475971_1476826_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_144420667.1\|1477202_1478213_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	2.5e-25	31.5
WP_017377585.1\|1478357_1478615_-	hypothetical protein	NA	NA	NA	NA
WP_048875994.1\|1478728_1479985_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376600.1\|1480240_1480420_+	hypothetical protein	NA	NA	NA	NA
WP_017377584.1\|1480913_1481156_+	hypothetical protein	NA	NA	NA	NA
WP_017377583.1\|1481181_1482540_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.1e-71	37.9
WP_026063647.1\|1482821_1483181_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_017377580.1\|1483612_1485247_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.7e-143	50.5
WP_017377579.1\|1485253_1486090_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.7e-51	41.3
WP_017377578.1\|1486111_1487389_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	9.6e-139	60.9
WP_017377577.1\|1487475_1487793_+	cell division protein FtsB	NA	NA	NA	NA
WP_017377576.1\|1487815_1488907_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_017377575.1\|1489097_1490687_+	APC family permease	NA	NA	NA	NA
WP_017377574.1\|1490747_1491521_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.5e-66	52.4
WP_017377573.1\|1491691_1492741_+	RNA polymerase sigma factor RpoS	M4SMP8	Cyanophage	1.7e-29	30.8
WP_017377572.1\|1493490_1493661_+	hypothetical protein	NA	NA	NA	NA
WP_036772584.1\|1494490_1495267_+	hypothetical protein	NA	NA	NA	NA
WP_036772586.1\|1495512_1495779_+	hypothetical protein	NA	NA	NA	NA
WP_048875874.1\|1495871_1496837_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275315.1\|1498047_1498302_-	hypothetical protein	NA	NA	NA	NA
WP_144420669.1\|1498708_1498951_+\|transposase	transposase	NA	NA	NA	NA
WP_048875996.1\|1498963_1499839_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_036816928.1\|1500165_1500606_-	universal stress protein	NA	NA	NA	NA
WP_081000007.1\|1502189_1502594_-	hypothetical protein	NA	NA	NA	NA
WP_080999986.1\|1502755_1502953_-	hypothetical protein	NA	NA	NA	NA
WP_036771332.1\|1503156_1504131_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.3e-30	33.2
WP_017377185.1\|1504479_1505418_+	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_027242821.1\|1505481_1507476_+	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_026063604.1\|1507478_1508075_+	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_017377182.1\|1508071_1508410_+	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_036774017.1\|1508799_1509675_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1568009 : 1583868

unidentified_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048876002.1\|1568009_1568993_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.5e-27	32.0
WP_087910642.1\|1569792_1570946_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.8e-59	44.2
WP_048876004.1\|1571067_1571760_-	hypothetical protein	NA	NA	NA	NA
WP_027242833.1\|1571768_1572956_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.2e-22	34.3
WP_017376484.1\|1573105_1573732_+	uridine kinase	A0A1V0SAA3	Catovirus	1.2e-33	41.3
WP_017376485.1\|1573777_1575007_+	hypothetical protein	B2YG43	Musca_hytrovirus	2.6e-08	21.9
WP_144420789.1\|1575201_1575648_-	hypothetical protein	NA	NA	NA	NA
WP_017376487.1\|1575839_1577198_+	dNTP triphosphohydrolase	NA	NA	NA	NA
WP_075275317.1\|1577863_1578037_-	hypothetical protein	NA	NA	NA	NA
WP_048876005.1\|1578166_1579084_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.6e-26	32.4
WP_053093673.1\|1579425_1580085_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_144420674.1\|1580165_1580669_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.0e-19	40.7
WP_017376491.1\|1580641_1580929_-\|transposase	transposase	NA	NA	NA	NA
WP_036771330.1\|1582893_1583868_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_18

1598853 : 1703387

102

Staphylococcus_phage(24.0%)

transposase,integrase,tRNA,protease

attL 1599921:1599980|attR 1658487:1659027

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036771330.1\|1598853_1599828_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_144420675.1\|1599903_1600221_-	hypothetical protein	NA	NA	NA	NA
1599921:1599980	attL	NA	NA	NA	NA
WP_075275321.1\|1600224_1600593_-	hypothetical protein	NA	NA	NA	NA
WP_027243029.1\|1601326_1602295_-	threonine/serine dehydratase	NA	NA	NA	NA
WP_027243028.1\|1602504_1603917_-	MFS transporter	NA	NA	NA	NA
WP_017375994.1\|1604104_1604818_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.7e-36	39.0
WP_017375995.1\|1604838_1605252_-	hypothetical protein	NA	NA	NA	NA
WP_017375996.1\|1605352_1606426_-	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_027243027.1\|1606562_1607462_-	hypothetical protein	NA	NA	NA	NA
WP_036772860.1\|1607717_1607969_+	hypothetical protein	NA	NA	NA	NA
WP_027243025.1\|1608017_1608653_+	hypothetical protein	NA	NA	NA	NA
WP_036772872.1\|1608777_1609635_+	sel1 repeat family protein	NA	NA	NA	NA
WP_053856766.1\|1609822_1611226_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_047927520.1\|1611401_1611905_+	hypothetical protein	NA	NA	NA	NA
WP_017377328.1\|1611981_1613283_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	8.2e-29	37.3
WP_027243024.1\|1613451_1614552_+	carbohydrate kinase family protein	NA	NA	NA	NA
WP_027243023.1\|1614902_1615145_+	hypothetical protein	NA	NA	NA	NA
WP_036772851.1\|1615138_1615456_-	hypothetical protein	NA	NA	NA	NA
WP_162038662.1\|1615749_1616905_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-49	39.5
WP_075275277.1\|1617116_1617356_-	hypothetical protein	NA	NA	NA	NA
WP_036774927.1\|1617516_1617987_-	hypothetical protein	NA	NA	NA	NA
WP_016212018.1\|1618209_1618509_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_047927838.1\|1618505_1618751_-	hypothetical protein	NA	NA	NA	NA
WP_144420676.1\|1619043_1620000_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.8e-49	39.5
WP_017375591.1\|1620284_1620488_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_065653736.1\|1620618_1621647_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_047927336.1\|1622010_1622256_+	hypothetical protein	NA	NA	NA	NA
WP_069971648.1\|1622618_1623593_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.7e-29	31.6
WP_075275420.1\|1625064_1626771_+	sodium:proton exchanger	NA	NA	NA	NA
WP_036773893.1\|1626816_1627668_-	DUF4402 domain-containing protein	NA	NA	NA	NA
WP_027243019.1\|1627756_1630327_+	hypothetical protein	NA	NA	NA	NA
WP_144420677.1\|1630846_1631248_+\|transposase	transposase	NA	NA	NA	NA
WP_036771639.1\|1631834_1632809_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_017378512.1\|1632849_1634178_-	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_016211143.1\|1634441_1635011_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	7.3e-30	39.5
WP_017378513.1\|1635026_1635338_-	hypothetical protein	NA	NA	NA	NA
WP_017378514.1\|1635347_1636316_-	ferrochelatase	NA	NA	NA	NA
WP_016211147.1\|1636428_1636782_+	hypothetical protein	NA	NA	NA	NA
WP_017378515.1\|1636785_1637850_-	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_017378516.1\|1637850_1639590_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	5.8e-54	31.2
WP_017378517.1\|1639596_1640019_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_017378518.1\|1640002_1640632_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_075275322.1\|1640867_1640966_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_027243018.1\|1641052_1642870_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_048876007.1\|1643017_1643992_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-29	32.9
WP_155046591.1\|1644071_1644215_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_027243017.1\|1644388_1645732_-	hypothetical protein	NA	NA	NA	NA
WP_144420678.1\|1646230_1646509_-	hypothetical protein	NA	NA	NA	NA
WP_144420679.1\|1646776_1647733_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-50	39.0
WP_017375696.1\|1648059_1648443_+	hypothetical protein	NA	NA	NA	NA
WP_162038663.1\|1648458_1649259_-	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_162038664.1\|1649185_1649404_-	hypothetical protein	NA	NA	NA	NA
WP_036774017.1\|1649694_1650570_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_155046590.1\|1650571_1650736_-	hypothetical protein	NA	NA	NA	NA
WP_155046589.1\|1650915_1651065_-	hypothetical protein	NA	NA	NA	NA
WP_048876008.1\|1651144_1652119_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-29	32.6
WP_162038665.1\|1652115_1653327_-	ComEC family competence protein	NA	NA	NA	NA
WP_027242578.1\|1653434_1653971_+	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_017376784.1\|1654007_1654193_-	hypothetical protein	NA	NA	NA	NA
WP_017376785.1\|1654433_1655339_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_144420682.1\|1656745_1656907_+	phosphatase	NA	NA	NA	NA
WP_155046588.1\|1657441_1657651_-	hypothetical protein	NA	NA	NA	NA
WP_027243099.1\|1658766_1660080_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.7e-51	32.0
1658487:1659027	attR	NA	NA	NA	NA
WP_027243098.1\|1660315_1661461_+	carboxypeptidase family protein	NA	NA	NA	NA
WP_155049745.1\|1661535_1661712_+	DUF1508 domain-containing protein	NA	NA	NA	NA
WP_027243096.1\|1661747_1662380_-	MarC family protein	NA	NA	NA	NA
WP_144420683.1\|1662556_1663213_+	hypothetical protein	NA	NA	NA	NA
WP_027243095.1\|1663201_1665487_-	hypothetical protein	NA	NA	NA	NA
WP_017376797.1\|1665760_1666120_-	hypothetical protein	NA	NA	NA	NA
WP_017376798.1\|1666401_1667037_+	LysE family translocator	NA	NA	NA	NA
WP_017376801.1\|1668223_1669048_+	hypothetical protein	X2KR27	Campylobacter_phage	6.2e-06	28.3
WP_144420791.1\|1669103_1670315_-	protein kinase	NA	NA	NA	NA
WP_027243094.1\|1671098_1671806_+	hypothetical protein	NA	NA	NA	NA
WP_146619422.1\|1671868_1672048_-	hypothetical protein	NA	NA	NA	NA
WP_027243093.1\|1672109_1672427_-	hypothetical protein	NA	NA	NA	NA
WP_017376807.1\|1672538_1673282_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_017376808.1\|1673295_1674339_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_017376809.1\|1674477_1676247_-\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	4.9e-08	40.7
WP_048876146.1\|1676471_1677605_-	MFS transporter	S4TR35	Salmonella_phage	2.6e-15	23.0
WP_026063564.1\|1678454_1681274_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-312	55.3
WP_017376814.1\|1681648_1682374_+	single-stranded DNA-binding protein	A0A2I7QWB5	Vibrio_phage	6.2e-42	65.6
WP_157894730.1\|1684968_1685493_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.5e-37	46.6
WP_051929542.1\|1685733_1686066_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_017376231.1\|1686125_1686413_-\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_075275277.1\|1686955_1687195_+	hypothetical protein	NA	NA	NA	NA
WP_048876009.1\|1687065_1688091_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_036771330.1\|1688218_1689193_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_027243041.1\|1689387_1690341_-	chemotaxis protein CheV	NA	NA	NA	NA
WP_017376824.1\|1690510_1690669_-	hypothetical protein	NA	NA	NA	NA
WP_144420792.1\|1690940_1691465_-	hypothetical protein	NA	NA	NA	NA
WP_017376827.1\|1691919_1692747_+	DsbA family protein	NA	NA	NA	NA
WP_144420685.1\|1692815_1693001_-	hypothetical protein	NA	NA	NA	NA
WP_017376828.1\|1693201_1693660_+	amino acid permease	NA	NA	NA	NA
WP_017376829.1\|1693800_1694028_+	hypothetical protein	NA	NA	NA	NA
WP_048876010.1\|1694192_1695578_-	protein kinase family protein	A0A1M7XTW9	Cedratvirus	1.4e-05	27.7
WP_017376830.1\|1695873_1696188_+	hypothetical protein	NA	NA	NA	NA
WP_027243043.1\|1696296_1697922_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.9e-28	25.3
WP_017376832.1\|1698334_1699324_-	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_016212182.1\|1699645_1699831_-	hypothetical protein	NA	NA	NA	NA
WP_017376833.1\|1700220_1702176_+	transglycosylase SLT domain-containing protein	K4NWI2	Pseudomonas_phage	9.2e-16	39.7
WP_080963614.1\|1702247_1702370_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_036771330.1\|1702412_1703387_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_19

1723151 : 1782065

Acinetobacter_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048876011.1\|1723151_1724201_-\|transposase	transposase	NA	NA	NA	NA
WP_036772296.1\|1724400_1724778_+	hypothetical protein	NA	NA	NA	NA
WP_017376231.1\|1725967_1726255_+\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_036773200.1\|1726314_1726611_+	hypothetical protein	NA	NA	NA	NA
WP_144420686.1\|1726755_1727412_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.7e-41	46.8
WP_017377324.1\|1727651_1728032_-	hypothetical protein	NA	NA	NA	NA
WP_048876012.1\|1728683_1730087_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_087910660.1\|1730083_1730365_-	hypothetical protein	NA	NA	NA	NA
WP_048876013.1\|1730759_1731224_+	hypothetical protein	NA	NA	NA	NA
WP_047927610.1\|1731404_1731998_+	hypothetical protein	NA	NA	NA	NA
WP_048876007.1\|1732183_1733158_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-29	32.9
WP_051929845.1\|1733561_1734386_-\|transposase	transposase	NA	NA	NA	NA
WP_027243222.1\|1734460_1735609_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_027243221.1\|1735624_1737253_-	cytochrome d terminal oxidase subunit I	NA	NA	NA	NA
WP_017375698.1\|1737596_1738790_-	hypothetical protein	NA	NA	NA	NA
WP_162034387.1\|1740302_1740461_-	hypothetical protein	NA	NA	NA	NA
WP_026063486.1\|1744904_1745405_+	WbuC family cupin fold metalloprotein	NA	NA	NA	NA
WP_155046587.1\|1745818_1745959_+	hypothetical protein	NA	NA	NA	NA
WP_036772592.1\|1746081_1747542_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.3e-56	33.4
WP_026063485.1\|1747619_1748102_-	DUF4442 domain-containing protein	NA	NA	NA	NA
WP_017375881.1\|1748260_1749526_+	sodium:proton antiporter	A0A2H4J178	uncultured_Caudovirales_phage	1.2e-48	42.8
WP_027243180.1\|1749610_1750870_+	phosphoesterase	NA	NA	NA	NA
WP_017375878.1\|1750941_1751214_-	hypothetical protein	NA	NA	NA	NA
WP_048876014.1\|1751551_1751887_+	hypothetical protein	NA	NA	NA	NA
WP_155069586.1\|1752112_1752496_+	hypothetical protein	NA	NA	NA	NA
WP_048876016.1\|1752766_1753177_+	hypothetical protein	NA	NA	NA	NA
WP_048875984.1\|1753321_1753858_+\|transposase	transposase	NA	NA	NA	NA
WP_144420687.1\|1753868_1754054_-	hypothetical protein	NA	NA	NA	NA
WP_017376772.1\|1754489_1755461_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027243181.1\|1755442_1756414_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_144420793.1\|1756527_1757301_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_146619432.1\|1757709_1757901_+	hypothetical protein	NA	NA	NA	NA
WP_155082172.1\|1758147_1758675_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_162038666.1\|1758727_1759884_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_075275326.1\|1759936_1760788_-\|transposase	transposase	NA	NA	NA	NA
WP_051929549.1\|1761003_1761381_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_048876011.1\|1761940_1762990_+\|transposase	transposase	NA	NA	NA	NA
WP_017376108.1\|1763303_1764689_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	3.4e-49	29.7
WP_017376107.1\|1764695_1766234_-\|tRNA	glutamate--tRNA ligase	A0A2K9L594	Tupanvirus	2.6e-05	22.4
WP_017376106.1\|1766276_1767002_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_017376105.1\|1767172_1768405_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	8.9e-33	27.2
WP_017376104.1\|1768604_1769426_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_017376103.1\|1769475_1770285_-	hypothetical protein	NA	NA	NA	NA
WP_048876018.1\|1770440_1774307_-	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	1.6e-51	26.5
WP_017376100.1\|1774472_1775348_+	ParA family protein	NA	NA	NA	NA
WP_075275424.1\|1775412_1775691_+	hypothetical protein	NA	NA	NA	NA
WP_144420689.1\|1775835_1776411_+	nitronate monooxygenase	NA	NA	NA	NA
WP_017376099.1\|1776459_1776618_+	hypothetical protein	NA	NA	NA	NA
WP_051929528.1\|1777366_1778083_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_026063521.1\|1779211_1779628_-	hypothetical protein	NA	NA	NA	NA
WP_144420690.1\|1780542_1781472_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-60	44.9
WP_144420691.1\|1781443_1781602_+	phosphatase	NA	NA	NA	NA
WP_017376276.1\|1781750_1782065_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	6.9e-06	36.5

DBSCAN-SWA_20

1785979 : 1846115

Acinetobacter_phage(50.0%)

transposase,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048876152.1\|1785979_1786924_-\|transposase	transposase	NA	NA	NA	NA
WP_144420693.1\|1786911_1787055_+	phosphatase	NA	NA	NA	NA
WP_036771585.1\|1787416_1787749_+	hypothetical protein	NA	NA	NA	NA
WP_075275332.1\|1790641_1791643_+	hypothetical protein	NA	NA	NA	NA
WP_157894731.1\|1791799_1792180_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_081329473.1\|1792552_1792972_-\|transposase	transposase	NA	NA	NA	NA
WP_144420694.1\|1793832_1794069_+	hypothetical protein	NA	NA	NA	NA
WP_017376672.1\|1794362_1797419_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_027242910.1\|1797500_1798955_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_027242911.1\|1799389_1800406_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_017376669.1\|1800514_1800913_+	hypothetical protein	NA	NA	NA	NA
WP_017376668.1\|1800952_1802776_+	BamA/TamA family outer membrane protein	NA	NA	NA	NA
WP_027242912.1\|1802772_1806075_+	DUF490 domain-containing protein	NA	NA	NA	NA
WP_036772026.1\|1806179_1807055_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017376663.1\|1807092_1808007_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_027242913.1\|1808071_1808701_-	hypothetical protein	NA	NA	NA	NA
WP_017376662.1\|1808745_1809180_-	hypothetical protein	NA	NA	NA	NA
WP_017376661.1\|1809160_1809901_-	hypothetical protein	NA	NA	NA	NA
WP_017376660.1\|1809914_1811312_-	hypothetical protein	NA	NA	NA	NA
WP_027242914.1\|1811314_1814263_-	hypothetical protein	NA	NA	NA	NA
WP_036772028.1\|1814262_1815984_-	hypothetical protein	NA	NA	NA	NA
WP_027242917.1\|1815998_1816403_-	hypothetical protein	NA	NA	NA	NA
WP_017376655.1\|1816403_1819283_-	DUF4280 domain-containing protein	NA	NA	NA	NA
WP_075275426.1\|1819285_1820008_-	hypothetical protein	NA	NA	NA	NA
WP_027242919.1\|1820369_1822262_-	hypothetical protein	NA	NA	NA	NA
WP_017376650.1\|1822293_1824834_-	hypothetical protein	NA	NA	NA	NA
WP_157894732.1\|1824865_1825957_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027242921.1\|1826034_1826658_-	hypothetical protein	NA	NA	NA	NA
WP_027242922.1\|1826672_1828172_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_036772036.1\|1828188_1828695_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_075275427.1\|1829950_1830022_+	hypothetical protein	NA	NA	NA	NA
WP_075275333.1\|1830204_1830387_+	hypothetical protein	NA	NA	NA	NA
WP_069971656.1\|1831588_1831861_-	hypothetical protein	NA	NA	NA	NA
WP_144420695.1\|1831876_1833310_-	hypothetical protein	NA	NA	NA	NA
WP_144420696.1\|1833454_1834720_-	hypothetical protein	NA	NA	NA	NA
WP_027242924.1\|1835005_1836757_-	hypothetical protein	NA	NA	NA	NA
WP_157894733.1\|1836769_1837861_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_036774095.1\|1837936_1838215_-	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|1838272_1839429_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_036771639.1\|1840368_1841343_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_081000010.1\|1841401_1841665_-	hypothetical protein	NA	NA	NA	NA
WP_144420643.1\|1841674_1842988_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_155046586.1\|1843192_1843366_-	hypothetical protein	NA	NA	NA	NA
WP_144420794.1\|1843433_1843577_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_027243218.1\|1843595_1843793_-	hypothetical protein	NA	NA	NA	NA
WP_036772025.1\|1843810_1844317_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_036772663.1\|1845239_1846115_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

1877132 : 1989656

Acinetobacter_phage(23.08%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087910645.1\|1877132_1878286_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-59	44.2
WP_048876023.1\|1878376_1879480_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.0e-25	31.1
WP_017375861.1\|1879819_1880320_-	hypothetical protein	NA	NA	NA	NA
WP_016211829.1\|1881016_1881370_-	hypothetical protein	NA	NA	NA	NA
WP_017375862.1\|1881670_1883398_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_047927270.1\|1883501_1884227_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.4e-31	38.7
WP_017375864.1\|1884219_1885458_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_017375865.1\|1885595_1886633_+	agmatine deiminase family protein	NA	NA	NA	NA
WP_017375866.1\|1886687_1887590_+	carbon-nitrogen hydrolase	M1HCD5	Acanthocystis_turfacea_Chlorella_virus	3.2e-56	40.7
WP_017375867.1\|1887699_1888953_+	hypothetical protein	NA	NA	NA	NA
WP_027242968.1\|1889010_1892502_+	transcription-repair coupling factor	NA	NA	NA	NA
WP_144420795.1\|1892618_1893296_+	hypothetical protein	NA	NA	NA	NA
WP_017375871.1\|1893423_1893972_+	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_017375873.1\|1895842_1896004_-	hypothetical protein	NA	NA	NA	NA
WP_026063558.1\|1897195_1897762_-	dCTP deaminase	S5VM63	Pseudomonas_phage	2.8e-74	77.8
WP_087910646.1\|1897764_1898889_-	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_026063557.1\|1898973_1899792_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_027242970.1\|1899922_1901902_+	sodium:proton exchanger	NA	NA	NA	NA
WP_017376714.1\|1901961_1902615_-	hypothetical protein	NA	NA	NA	NA
WP_080999995.1\|1903299_1904670_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376707.1\|1906385_1907033_-	hypothetical protein	NA	NA	NA	NA
WP_017376706.1\|1907070_1907463_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_017376705.1\|1907715_1908462_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_027243123.1\|1909060_1909966_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|1910081_1911056_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017376701.1\|1911201_1911930_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_162038667.1\|1912064_1912631_+	hypothetical protein	NA	NA	NA	NA
WP_027243124.1\|1912653_1915494_-	hypothetical protein	NA	NA	NA	NA
WP_017376696.1\|1917536_1918487_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_017376695.1\|1918569_1919352_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_027243125.1\|1919450_1919744_-	hypothetical protein	NA	NA	NA	NA
WP_017376693.1\|1920266_1920911_+	hypothetical protein	NA	NA	NA	NA
WP_017376692.1\|1920944_1921589_+	hypothetical protein	NA	NA	NA	NA
WP_017376691.1\|1921637_1922492_+	hypothetical protein	NA	NA	NA	NA
WP_017376690.1\|1922629_1923142_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_107517381.1\|1923209_1923404_-	hypothetical protein	NA	NA	NA	NA
WP_017376688.1\|1923617_1923971_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|1925179_1926154_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017376683.1\|1926901_1927603_-	cyclase family protein	NA	NA	NA	NA
WP_027243126.1\|1927677_1928307_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_026063554.1\|1928474_1929731_+	YihY family inner membrane protein	NA	NA	NA	NA
WP_017376681.1\|1930005_1930668_+	HAD-IB family phosphatase	NA	NA	NA	NA
WP_017376680.1\|1930657_1931890_+	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	8.2e-95	47.3
WP_027243127.1\|1932021_1932639_+	VOC family protein	NA	NA	NA	NA
WP_036773258.1\|1932716_1933223_-	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|1933233_1934390_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_157894734.1\|1934743_1934986_-\|transposase	transposase	NA	NA	NA	NA
WP_144420796.1\|1935239_1936358_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036774270.1\|1936502_1936838_+	hypothetical protein	NA	NA	NA	NA
WP_051929523.1\|1936848_1937262_-	hypothetical protein	NA	NA	NA	NA
WP_017375562.1\|1938470_1938635_-	hypothetical protein	NA	NA	NA	NA
WP_036772169.1\|1938671_1939547_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_051929862.1\|1939733_1940246_-	hypothetical protein	NA	NA	NA	NA
WP_162038642.1\|1942381_1942621_+	hypothetical protein	NA	NA	NA	NA
WP_017375899.1\|1942677_1943877_-	trans-2-enoyl-CoA reductase family protein	NA	NA	NA	NA
WP_017375900.1\|1944130_1944412_+	hypothetical protein	NA	NA	NA	NA
WP_047927375.1\|1944467_1946459_-	TRAP transporter permease	NA	NA	NA	NA
WP_026063491.1\|1946532_1947510_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_027242984.1\|1947645_1948428_+	hypothetical protein	NA	NA	NA	NA
WP_036774087.1\|1948584_1948908_+	hypothetical protein	NA	NA	NA	NA
WP_048876030.1\|1948975_1950079_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036772169.1\|1950148_1951024_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_047927184.1\|1951020_1951365_+	hypothetical protein	NA	NA	NA	NA
WP_075275338.1\|1951386_1951836_+	murein L,D-transpeptidase catalytic domain family protein	NA	NA	NA	NA
WP_027242985.1\|1951849_1953241_-	flagellar hook-associated protein 3	NA	NA	NA	NA
WP_027242986.1\|1953282_1956270_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_027242987.1\|1956339_1957173_-	hypothetical protein	NA	NA	NA	NA
WP_087910648.1\|1957227_1958415_-	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_027242989.1\|1958402_1959107_-	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_027242990.1\|1959152_1959938_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_027242991.1\|1959965_1960703_-	flagellar basal body rod protein FlgF	NA	NA	NA	NA
WP_016210285.1\|1960807_1963003_-	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_027242992.1\|1963077_1963761_-	flagellar hook assembly protein FlgD	NA	NA	NA	NA
WP_027242993.1\|1963771_1964203_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_027242994.1\|1964248_1964647_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_027242995.1\|1965023_1965731_+	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_027242996.1\|1965795_1966092_+	hypothetical protein	NA	NA	NA	NA
WP_146619421.1\|1966130_1966610_+	flagellar protein FlgN	NA	NA	NA	NA
WP_027242998.1\|1966663_1967185_-	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	3.8e-25	53.4
WP_027242999.1\|1967266_1968361_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_048876031.1\|1969327_1970731_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017375890.1\|1970900_1971464_+	hypothetical protein	NA	NA	NA	NA
WP_017375891.1\|1971599_1973075_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_017375892.1\|1973081_1973288_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_017375893.1\|1973345_1974416_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_162038668.1\|1974613_1974991_-	hypothetical protein	NA	NA	NA	NA
WP_017375757.1\|1977232_1978792_+	APC family permease	NA	NA	NA	NA
WP_144420701.1\|1979388_1979745_-	hypothetical protein	NA	NA	NA	NA
WP_027243002.1\|1980584_1981244_+	response regulator transcription factor	NA	NA	NA	NA
WP_027243003.1\|1981339_1982701_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_162038649.1\|1982842_1983999_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_017375762.1\|1984121_1985462_+	hypothetical protein	NA	NA	NA	NA
WP_080963648.1\|1986112_1986274_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_036815628.1\|1986373_1987201_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_157894735.1\|1987554_1988394_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	1.3e-19	33.3
WP_036771330.1\|1988473_1989448_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_047927692.1\|1989467_1989656_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2007158 : 2074734

Acinetobacter_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062365727.1\|2007158_2007851_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017375561.1\|2007847_2007991_+\|transposase	transposase	NA	NA	NA	NA
WP_162038649.1\|2009334_2010491_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_017375766.1\|2010868_2012899_+	hypothetical protein	NA	NA	NA	NA
WP_017375767.1\|2012965_2013991_-	FUSC family protein	NA	NA	NA	NA
WP_036771312.1\|2015458_2016454_+	glycosyl hydrolase family 17	NA	NA	NA	NA
WP_048876036.1\|2016751_2017390_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-09	35.7
WP_017375978.1\|2018103_2019291_+	hypothetical protein	NA	NA	NA	NA
WP_017375977.1\|2019456_2020410_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_036771316.1\|2020432_2022451_+	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_017375975.1\|2022539_2022863_-	YqcC family protein	NA	NA	NA	NA
WP_155046584.1\|2023111_2023288_-	hypothetical protein	NA	NA	NA	NA
WP_053093677.1\|2023515_2024235_+\|transposase	IS982-like element ISPsa1 family transposase	NA	NA	NA	NA
WP_016209463.1\|2024850_2025234_-	DNA-binding protein	NA	NA	NA	NA
WP_048876037.1\|2025878_2026352_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_027242774.1\|2026457_2027828_-	DNA repair protein RadA	NA	NA	NA	NA
WP_048876038.1\|2027943_2028675_+	hypothetical protein	M1IDP9	Pelagibacter_phage	9.1e-09	35.8
WP_027242775.1\|2028699_2029797_-	alanine racemase	NA	NA	NA	NA
WP_048876039.1\|2029832_2031251_-	replicative DNA helicase	A0A077SK18	Escherichia_phage	2.0e-153	62.1
WP_027242777.1\|2031460_2031913_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_016209480.1\|2031924_2032152_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_027242778.1\|2032201_2032528_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_027242779.1\|2032731_2033421_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_036771340.1\|2033569_2034058_+	GAF domain-containing protein	NA	NA	NA	NA
WP_036771342.1\|2034098_2035199_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_027242782.1\|2035244_2036327_-	chorismate synthase	A0A291AU41	Pandoravirus	4.5e-73	42.4
WP_080963651.1\|2036319_2036880_-	hypothetical protein	NA	NA	NA	NA
WP_036771345.1\|2036870_2038175_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_144420704.1\|2038228_2039257_-	chorismate mutase	NA	NA	NA	NA
WP_027242785.1\|2039275_2040292_-	3-deoxy-7-phosphoheptulonate synthase	NA	NA	NA	NA
WP_146619549.1\|2040723_2043891_-	hypothetical protein	NA	NA	NA	NA
WP_051929877.1\|2044242_2044866_-	hypothetical protein	NA	NA	NA	NA
WP_017378208.1\|2045648_2047199_-	hypothetical protein	NA	NA	NA	NA
WP_017378207.1\|2047493_2048249_+	ZIP family metal transporter	NA	NA	NA	NA
WP_036771639.1\|2048957_2049932_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_017378201.1\|2052840_2053512_-	hypothetical protein	NA	NA	NA	NA
WP_048875961.1\|2054590_2055994_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017378195.1\|2056688_2056937_+	hypothetical protein	NA	NA	NA	NA
WP_027242788.1\|2057581_2060983_-	UvrD-helicase domain-containing protein	S5M596	Bacillus_phage	4.5e-10	23.3
WP_017378193.1\|2060979_2063673_-	hypothetical protein	NA	NA	NA	NA
WP_017378192.1\|2063976_2065476_+	sugar porter family MFS transporter	O13311	Aichi_virus	2.2e-33	28.1
WP_027242789.1\|2066142_2066964_-	DUF1338 domain-containing protein	NA	NA	NA	NA
WP_146619408.1\|2067035_2067521_-	hypothetical protein	NA	NA	NA	NA
WP_048876012.1\|2067669_2069073_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017378188.1\|2069069_2070140_-	hypothetical protein	NA	NA	NA	NA
WP_027242790.1\|2070385_2072560_+	hypothetical protein	NA	NA	NA	NA
WP_017378184.1\|2072582_2073263_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_036774233.1\|2073291_2073525_-	hypothetical protein	NA	NA	NA	NA
WP_162038666.1\|2073577_2074734_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0

DBSCAN-SWA_23

2084840 : 2135918

Acinetobacter_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075275340.1\|2084840_2085449_+\|transposase	transposase	NA	NA	NA	NA
WP_017375657.1\|2085592_2085775_+	hypothetical protein	NA	NA	NA	NA
WP_048875904.1\|2085979_2086855_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_051929548.1\|2087095_2087770_-\|transposase	transposase	NA	NA	NA	NA
WP_080999996.1\|2087798_2088287_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	7.4e-15	30.9
WP_080999997.1\|2089332_2089767_+	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|2089972_2091376_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_162038669.1\|2091623_2091986_+	hypothetical protein	NA	NA	NA	NA
WP_162038670.1\|2091982_2093134_+	hypothetical protein	NA	NA	NA	NA
WP_048876046.1\|2094094_2094388_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	4.1e-05	36.4
WP_144420706.1\|2094345_2094924_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-28	40.8
WP_048876047.1\|2095009_2095885_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017378015.1\|2095877_2096234_+\|transposase	transposase	A0A0P0I4A4	Acinetobacter_phage	3.5e-22	52.0
WP_017378014.1\|2096242_2096638_-\|transposase	transposase	NA	NA	NA	NA
WP_082300708.1\|2097962_2098523_+\|transposase	transposase	NA	NA	NA	NA
WP_048876048.1\|2099645_2101535_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_027243106.1\|2101569_2102775_-	hypothetical protein	NA	NA	NA	NA
WP_144420707.1\|2102777_2104076_-	hypothetical protein	NA	NA	NA	NA
WP_027243104.1\|2104056_2105280_-	hypothetical protein	NA	NA	NA	NA
WP_027243103.1\|2105329_2106130_-	hypothetical protein	NA	NA	NA	NA
WP_155048038.1\|2106126_2106489_-	hypothetical protein	NA	NA	NA	NA
WP_027243102.1\|2106521_2106830_-	STAS domain-containing protein	NA	NA	NA	NA
WP_017377694.1\|2107223_2107952_+\|transposase	IS6-like element ISPsa2 family transposase	A0A077SL39	Escherichia_phage	7.8e-45	42.7
WP_017377851.1\|2107992_2108637_-	VWA domain-containing protein	NA	NA	NA	NA
WP_017377852.1\|2108649_2109117_-	VWA domain-containing protein	NA	NA	NA	NA
WP_036771330.1\|2109171_2110146_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017377854.1\|2110175_2110775_-	VWA domain-containing protein	NA	NA	NA	NA
WP_017377855.1\|2110771_2111233_-	DUF4381 domain-containing protein	NA	NA	NA	NA
WP_017377856.1\|2111276_2112212_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_017377857.1\|2112239_2113235_-	MoxR family ATPase	NA	NA	NA	NA
WP_017377858.1\|2113458_2114421_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_017377694.1\|2115848_2116577_-\|transposase	IS6-like element ISPsa2 family transposase	A0A077SL39	Escherichia_phage	7.8e-45	42.7
WP_080963626.1\|2116627_2118262_+	hypothetical protein	NA	NA	NA	NA
WP_017377862.1\|2118532_2119720_+	hypothetical protein	NA	NA	NA	NA
WP_017377863.1\|2120321_2120759_+	hypothetical protein	NA	NA	NA	NA
WP_017377865.1\|2123292_2123565_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_036772457.1\|2123640_2123949_-	hypothetical protein	NA	NA	NA	NA
WP_036772454.1\|2126424_2126742_-	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|2126898_2127873_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_048876051.1\|2127869_2128226_-	hypothetical protein	NA	NA	NA	NA
WP_048876052.1\|2128339_2129086_+	hypothetical protein	NA	NA	NA	NA
WP_017375910.1\|2129054_2129783_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	41.8
WP_017377223.1\|2130527_2130815_+\|transposase	IS3 family transposase	A9YX41	Burkholderia_phage	2.2e-06	37.2
WP_155046582.1\|2130874_2131039_+	hypothetical protein	NA	NA	NA	NA
WP_048876053.1\|2131035_2132439_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_053093670.1\|2132552_2133233_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.1e-43	43.0
WP_155046684.1\|2133518_2134220_-	hypothetical protein	NA	NA	NA	NA
WP_048876055.1\|2135012_2135918_-\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

2151081 : 2199010

Bacillus_thuringiensis_phage(14.29%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036771957.1\|2151081_2152053_-\|transposase	transposase	NA	NA	NA	NA
WP_157894741.1\|2154276_2155407_+	hypothetical protein	NA	NA	NA	NA
WP_162038643.1\|2155375_2155519_+	hypothetical protein	NA	NA	NA	NA
WP_017377033.1\|2155746_2156058_+	hypothetical protein	NA	NA	NA	NA
WP_144420710.1\|2156535_2156841_-	hypothetical protein	NA	NA	NA	NA
WP_027242870.1\|2157162_2157693_-	hypothetical protein	NA	NA	NA	NA
WP_017377031.1\|2158139_2159069_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.2e-31	30.6
WP_144420711.1\|2159225_2159651_-	hypothetical protein	NA	NA	NA	NA
WP_017375625.1\|2159767_2159995_-	hypothetical protein	NA	NA	NA	NA
WP_162038671.1\|2160148_2161102_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.8e-28	33.2
WP_080999998.1\|2161388_2161658_-\|transposase	transposase	NA	NA	NA	NA
WP_144420803.1\|2161802_2162759_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377028.1\|2162919_2163825_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_027242871.1\|2164141_2164903_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_016211971.1\|2165104_2165716_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_051929560.1\|2165736_2166936_-	site-specific DNA-methyltransferase	A0A2L1IZ21	Streptomyces_phage	2.7e-42	33.2
WP_017377024.1\|2167030_2167171_+	hypothetical protein	NA	NA	NA	NA
WP_017377023.1\|2167183_2167588_-	SufE family protein	NA	NA	NA	NA
WP_017377022.1\|2167818_2168388_+	hypothetical protein	NA	NA	NA	NA
WP_017377021.1\|2168454_2169495_-	hypothetical protein	NA	NA	NA	NA
WP_162038649.1\|2169521_2170678_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_027242872.1\|2170799_2171657_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	NA	NA	NA	NA
WP_144420712.1\|2171653_2172415_-	hypothetical protein	NA	NA	NA	NA
WP_027242873.1\|2172499_2175229_-	hypothetical protein	NA	NA	NA	NA
WP_048875904.1\|2175362_2176238_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_065653747.1\|2176502_2177843_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_016209885.1\|2177905_2178619_-	response regulator transcription factor	NA	NA	NA	NA
WP_027242875.1\|2178787_2179279_+	Spy/CpxP family protein refolding chaperone	NA	NA	NA	NA
WP_017377014.1\|2179418_2179910_-	hypothetical protein	NA	NA	NA	NA
WP_027242876.1\|2180112_2181003_+	Rossmann-like and DUF2520 domain-containing protein	NA	NA	NA	NA
WP_026063591.1\|2181387_2181972_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_027242877.1\|2182052_2182991_-	signal peptide peptidase SppA	A0A2I6UGK8	Salinibacter_virus	4.9e-15	30.1
WP_036771855.1\|2183042_2184137_-	fusaric acid resistance family protein	NA	NA	NA	NA
WP_047927528.1\|2184261_2185584_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	7.3e-65	39.9
WP_017377008.1\|2185631_2190518_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_017377007.1\|2190612_2190915_-	DUF2835 family protein	NA	NA	NA	NA
WP_027242879.1\|2191025_2192948_+	PrkA family serine protein kinase	NA	NA	NA	NA
WP_027242880.1\|2192969_2194265_+	YeaH/YhbH family protein	A0A219UQP6	Bacillus_phage	1.2e-06	32.8
WP_017377006.1\|2194261_2195872_+	SpoVR family protein	NA	NA	NA	NA
WP_052106204.1\|2195978_2196872_-	thiol:disulfide interchange protein DsbG	NA	NA	NA	NA
WP_017377003.1\|2196981_2197605_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_017377001.1\|2198311_2199010_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA

DBSCAN-SWA_25

2211708 : 2264481

Staphylococcus_phage(41.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162038666.1\|2211708_2212865_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.4e-50	39.0
WP_017376987.1\|2213635_2214319_-	hypothetical protein	NA	NA	NA	NA
WP_036774751.1\|2214566_2215490_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_047927028.1\|2215503_2216427_+	PAS and helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_027243112.1\|2216374_2217031_-	hypothetical protein	NA	NA	NA	NA
WP_027243113.1\|2217333_2218161_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_017376518.1\|2218311_2218683_+	hypothetical protein	NA	NA	NA	NA
WP_047927029.1\|2218909_2220400_+	nuclease	NA	NA	NA	NA
WP_017376516.1\|2220467_2221805_-	N-succinylarginine dihydrolase	NA	NA	NA	NA
WP_017376515.1\|2221947_2223414_-	succinylglutamate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_017376514.1\|2223410_2224460_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_027243115.1\|2224583_2226692_-	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_016210305.1\|2226854_2227259_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_016210308.1\|2227320_2228046_-	ribonuclease PH	NA	NA	NA	NA
WP_017376511.1\|2228131_2229025_+	YicC family protein	NA	NA	NA	NA
WP_017376510.1\|2229065_2229686_+	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	1.4e-18	34.5
WP_016210310.1\|2229746_2229953_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_017376509.1\|2229974_2232119_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.0e-12	37.1
WP_017376506.1\|2234314_2235238_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.3e-24	40.4
WP_017376505.1\|2235304_2236588_+	MFS transporter	NA	NA	NA	NA
WP_036771330.1\|2236828_2237803_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_155046579.1\|2238118_2238280_+	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|2238276_2239680_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377823.1\|2239793_2240561_+	hypothetical protein	NA	NA	NA	NA
WP_080999971.1\|2240919_2242323_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_080963604.1\|2243143_2243344_-	hypothetical protein	NA	NA	NA	NA
WP_017377826.1\|2243584_2245030_+	MFS transporter	NA	NA	NA	NA
WP_036772169.1\|2246225_2247101_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_027243174.1\|2248552_2248834_-	hypothetical protein	NA	NA	NA	NA
WP_047927196.1\|2249391_2250411_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_017376520.1\|2250397_2250820_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_017376521.1\|2250821_2251295_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.4e-26	43.4
WP_017376522.1\|2251420_2252077_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.8e-40	44.2
WP_017376523.1\|2252073_2252748_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	6.0e-31	37.7
WP_017376524.1\|2252753_2253902_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.7e-44	34.8
WP_017376525.1\|2253898_2254360_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_017376526.1\|2254435_2255686_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	2.4e-102	54.4
WP_017376527.1\|2255812_2257492_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	3.0e-39	26.6
WP_027243172.1\|2257603_2258485_-	hypothetical protein	NA	NA	NA	NA
WP_036772261.1\|2259614_2260208_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_017375618.1\|2262024_2262309_+\|transposase	transposase	NA	NA	NA	NA
WP_144420804.1\|2262858_2263134_-\|transposase	transposase	NA	NA	NA	NA
WP_036771330.1\|2263506_2264481_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_26

2336052 : 2382759

Synechococcus_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875859.1\|2336052_2336847_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_036773621.1\|2337136_2338060_-	EamA family transporter RarD	NA	NA	NA	NA
WP_017377984.1\|2338327_2338621_-	hypothetical protein	NA	NA	NA	NA
WP_017377983.1\|2339823_2340747_+	hypothetical protein	NA	NA	NA	NA
WP_017377982.1\|2340882_2341725_-	isopenicillin N synthase family oxygenase	NA	NA	NA	NA
WP_017377981.1\|2341812_2342463_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.7e-20	34.6
WP_026063695.1\|2342476_2343535_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SR00	Cyanophage	3.0e-69	45.3
WP_036773623.1\|2343639_2344725_+	DUF2066 domain-containing protein	NA	NA	NA	NA
WP_162038674.1\|2344751_2345861_+	AI-2E family transporter	NA	NA	NA	NA
WP_017377976.1\|2346165_2346483_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_017377975.1\|2346479_2346839_-	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_017377974.1\|2346941_2349674_-	hypothetical protein	NA	NA	NA	NA
WP_052106250.1\|2351163_2351688_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_144420807.1\|2352087_2352306_+	hypothetical protein	NA	NA	NA	NA
WP_144420716.1\|2352450_2353659_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_065653755.1\|2354086_2355544_-	hypothetical protein	NA	NA	NA	NA
WP_017375695.1\|2356378_2356654_+\|transposase	transposase	NA	NA	NA	NA
WP_036773050.1\|2359357_2359537_+	hypothetical protein	NA	NA	NA	NA
WP_026063690.1\|2359533_2359905_+	hypothetical protein	NA	NA	NA	NA
WP_144420717.1\|2359915_2360998_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420718.1\|2360994_2361216_-	hypothetical protein	NA	NA	NA	NA
WP_075275437.1\|2362201_2362420_+	hypothetical protein	NA	NA	NA	NA
WP_016212534.1\|2362910_2363177_-	hypothetical protein	NA	NA	NA	NA
WP_144420719.1\|2363435_2363756_+	hypothetical protein	NA	NA	NA	NA
WP_027243154.1\|2365141_2366392_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_017377905.1\|2366380_2367262_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_017377906.1\|2367254_2368340_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	41.2
WP_017377907.1\|2368336_2369596_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_017377908.1\|2369764_2370424_+	hypothetical protein	NA	NA	NA	NA
WP_065653730.1\|2370594_2371257_+	outer membrane lipoprotein LolB	NA	NA	NA	NA
WP_026063691.1\|2371603_2372551_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	3.4e-40	34.3
WP_017377911.1\|2372647_2373274_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_017377912.1\|2373279_2373861_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_017377913.1\|2373932_2375024_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_017377914.1\|2375113_2375827_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_027243155.1\|2375920_2376745_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_144420808.1\|2376978_2377656_-	hypothetical protein	NA	NA	NA	NA
WP_017377920.1\|2379333_2379591_-	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|2379991_2380966_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_048876067.1\|2381140_2381785_+	hypothetical protein	NA	NA	NA	NA
WP_155046574.1\|2381964_2382759_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_27

2388454 : 2424733

Acinetobacter_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_087910651.1\|2388454_2388631_+\|transposase	transposase	A4JX31	Burkholderia_virus	5.5e-05	46.2
WP_053856762.1\|2388926_2389361_-	hypothetical protein	A0A0P0IY73	Acinetobacter_phage	7.7e-16	38.0
WP_017377929.1\|2389554_2391024_-	glycine dehydrogenase subunit 2	M4QFZ1	Prochlorococcus_phage	2.7e-84	41.7
WP_027243054.1\|2391017_2392394_-	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	E3SN07	Prochlorococcus_phage	4.2e-47	34.6
WP_017377930.1\|2392406_2392799_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_017377931.1\|2392795_2393899_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_144420809.1\|2394077_2395370_-	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
WP_017377933.1\|2395380_2396328_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.5e-37	37.6
WP_027243055.1\|2396339_2397152_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_087910662.1\|2397154_2397934_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_017377934.1\|2397948_2399007_-	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
WP_017377935.1\|2399003_2400014_-	lipopolysaccharide heptosyltransferase II	NA	NA	NA	NA
WP_016209904.1\|2400020_2400218_-	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_048876070.1\|2400278_2403185_-	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
WP_017377937.1\|2403226_2404078_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_144420810.1\|2404160_2404706_-	chorismate lyase	NA	NA	NA	NA
WP_027243057.1\|2404803_2405664_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_027243058.1\|2405755_2406172_+	hypothetical protein	NA	NA	NA	NA
WP_017377942.1\|2406253_2406760_+\|protease	protease inhibitor I42 family protein	NA	NA	NA	NA
WP_027243059.1\|2406805_2409757_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_017377945.1\|2409778_2410111_+	GIY-YIG nuclease family protein	D7F5V9	Apocheima_cinerarium_nucleopolyhedrovirus	4.7e-05	34.2
WP_047927125.1\|2410228_2410738_+	hypothetical protein	NA	NA	NA	NA
WP_155046571.1\|2411271_2411427_-	hypothetical protein	NA	NA	NA	NA
WP_036774650.1\|2412501_2413668_+	hypothetical protein	NA	NA	NA	NA
WP_017377687.1\|2413812_2414565_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|2414920_2415895_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_016209908.1\|2416027_2416738_+	response regulator	W8CYM9	Bacillus_phage	2.2e-31	34.8
WP_017377690.1\|2416734_2417769_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.3e-32	34.2
WP_017377691.1\|2417872_2418214_-	hypothetical protein	NA	NA	NA	NA
WP_048876071.1\|2418724_2419885_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.8e-25	32.0
WP_069971647.1\|2419853_2420450_-\|transposase	transposase	NA	NA	NA	NA
WP_155046570.1\|2421418_2421589_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|2421585_2422560_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_087910645.1\|2423579_2424733_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-59	44.2

DBSCAN-SWA_28

2469862 : 2535469

Staphylococcus_phage(18.18%)

transposase,tRNA,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027242858.1\|2469862_2471170_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027242859.1\|2471174_2471885_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_162038675.1\|2472337_2475067_+	hypothetical protein	NA	NA	NA	NA
WP_027242861.1\|2475132_2476269_-	hypothetical protein	NA	NA	NA	NA
WP_017376336.1\|2477131_2477989_+	hypothetical protein	NA	NA	NA	NA
WP_017376335.1\|2478130_2478931_-	adenosylmethionine decarboxylase	NA	NA	NA	NA
WP_017376334.1\|2479029_2479605_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	3.2e-57	50.0
WP_027242862.1\|2479687_2480359_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_027242863.1\|2480404_2481304_+	DUF3530 family protein	NA	NA	NA	NA
WP_017376331.1\|2481338_2481722_-	response regulator	NA	NA	NA	NA
WP_017376330.1\|2481871_2482636_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_017376329.1\|2482626_2483337_-	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_017376328.1\|2483333_2484359_-	phosphotransferase	NA	NA	NA	NA
WP_048876074.1\|2484489_2486994_+	LPS-assembly protein LptD	NA	NA	NA	NA
WP_017376325.1\|2487000_2488269_+	peptidyl-prolyl cis-trans isomerase SurA	NA	NA	NA	NA
WP_017376324.1\|2488270_2489254_+	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_017376323.1\|2489266_2490088_+	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_017376322.1\|2490132_2490525_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_017376321.1\|2490599_2491406_+	symmetrical bis(5'-nucleosyl)-tetraphosphatase	NA	NA	NA	NA
WP_036774104.1\|2491593_2492022_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|2492080_2493055_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017375660.1\|2493078_2493516_+	hypothetical protein	NA	NA	NA	NA
WP_048876012.1\|2493550_2494954_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376011.1\|2495534_2495696_+	hypothetical protein	NA	NA	NA	NA
WP_017376015.1\|2496916_2497288_+	hypothetical protein	NA	NA	NA	NA
WP_027242569.1\|2497395_2498946_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_017376017.1\|2498978_2499818_-	CBS domain-containing protein	NA	NA	NA	NA
WP_017376018.1\|2499814_2500330_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_017376019.1\|2500333_2501326_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	9.3e-49	45.1
WP_017376020.1\|2501704_2503075_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_027242570.1\|2503283_2504423_+	hypothetical protein	A0A0F6YPT7	Sinorhizobium_phage	9.3e-61	41.7
WP_075275355.1\|2504636_2505611_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.3e-30	33.2
WP_036816881.1\|2505634_2505853_+	hypothetical protein	NA	NA	NA	NA
WP_017376024.1\|2505930_2506179_+	hypothetical protein	NA	NA	NA	NA
WP_162034387.1\|2507037_2507196_-	hypothetical protein	NA	NA	NA	NA
WP_036772149.1\|2511832_2512513_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_017376634.1\|2512577_2513864_-	hypothetical protein	NA	NA	NA	NA
WP_017376633.1\|2514465_2514735_-	RNA-binding protein	NA	NA	NA	NA
WP_144420813.1\|2514918_2515890_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.0e-15	29.3
WP_017376631.1\|2515957_2516932_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-14	31.3
WP_017376630.1\|2517029_2518106_-	ABC transporter permease	NA	NA	NA	NA
WP_144420721.1\|2518186_2519179_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_036772145.1\|2519183_2520986_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027243119.1\|2521003_2522305_-	aspartate kinase	NA	NA	NA	NA
WP_157894744.1\|2522320_2523553_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_017376625.1\|2523736_2524129_+	RidA family protein	NA	NA	NA	NA
WP_017376624.1\|2524235_2525321_-	hypothetical protein	NA	NA	NA	NA
WP_017376623.1\|2525536_2526553_-	bifunctional UDP-4-keto-pentose/UDP-xylose synthase	D5GW02	Campylobacter_virus	1.9e-12	28.7
WP_017376622.1\|2526555_2527563_-	glycosyltransferase	B9UDL7	Salmonella_phage	2.2e-37	34.4
WP_026063550.1\|2527566_2528721_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L0G1	Tupanvirus	3.9e-38	33.0
WP_016209558.1\|2528735_2529098_-	small Multidrug Resistance family protein	NA	NA	NA	NA
WP_027243117.1\|2529094_2530810_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_026063546.1\|2530909_2531584_+\|tRNA	tRNA (guanosine(18)-2'-O)-methyltransferase TrmH	NA	NA	NA	NA
WP_017376619.1\|2531612_2532017_+	RidA family protein	NA	NA	NA	NA
WP_027243116.1\|2532041_2533001_-	response regulator	NA	NA	NA	NA
WP_017376616.1\|2533133_2533916_-	MFS transporter	NA	NA	NA	NA
WP_075275357.1\|2534017_2534977_+\|transposase	IS3 family transposase	A0A0N7C035	Escherichia_phage	1.2e-13	34.3
WP_017376613.1\|2535121_2535469_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_29

2539470 : 2603249

Planktothrix_phage(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_144420814.1\|2539470_2540388_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875883.1\|2540532_2541069_+\|transposase	transposase	NA	NA	NA	NA
WP_051929685.1\|2541328_2542231_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_017376607.1\|2543220_2544210_+	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G9BWD6	Planktothrix_phage	4.5e-19	32.4
WP_017376606.1\|2544378_2544717_+	hypothetical protein	NA	NA	NA	NA
WP_017376605.1\|2544713_2545289_+	ribonuclease HI	M4QMN0	Micromonas_pusilla_virus	1.1e-33	55.1
WP_017376604.1\|2545337_2545553_-	hypothetical protein	NA	NA	NA	NA
WP_017376603.1\|2545739_2546579_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.4e-45	43.6
WP_017376601.1\|2550275_2551184_-	hypothetical protein	NA	NA	NA	NA
WP_017375685.1\|2551314_2551779_-\|transposase	transposase	NA	NA	NA	NA
WP_053856764.1\|2552079_2553006_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036772137.1\|2553324_2553885_-	hypothetical protein	NA	NA	NA	NA
WP_017377036.1\|2554354_2555674_+	LbtU family siderophore porin	NA	NA	NA	NA
WP_017377037.1\|2555741_2556608_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	6.3e-25	31.1
WP_036772169.1\|2556600_2557476_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017377039.1\|2557534_2557753_-	hypothetical protein	NA	NA	NA	NA
WP_017377041.1\|2559153_2559483_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_026063593.1\|2559717_2560422_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
WP_017377043.1\|2560402_2562631_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.7e-82	34.8
WP_017377044.1\|2562902_2563916_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_017377045.1\|2564024_2564246_-	hypothetical protein	NA	NA	NA	NA
WP_017377046.1\|2564250_2565888_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	3.4e-88	37.8
WP_017377047.1\|2566026_2566560_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_017377048.1\|2566680_2567799_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_162038676.1\|2567857_2569114_+	hypothetical protein	NA	NA	NA	NA
WP_036772661.1\|2569100_2570237_+	hypothetical protein	NA	NA	NA	NA
WP_017377052.1\|2570467_2570893_+	hypothetical protein	NA	NA	NA	NA
WP_027242609.1\|2574222_2574576_-	hypothetical protein	NA	NA	NA	NA
WP_036772169.1\|2574610_2575486_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_051929903.1\|2575642_2576047_-	heavy metal-responsive transcriptional regulator	NA	NA	NA	NA
WP_051929897.1\|2576194_2577370_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_027242610.1\|2577629_2578133_-	peptide deformylase	A0A1D8KUY1	Synechococcus_phage	2.1e-09	33.1
WP_047927710.1\|2578172_2579675_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	8.6e-46	28.0
WP_017377060.1\|2579880_2580834_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	2.9e-31	27.9
WP_027242611.1\|2580814_2581906_-	AI-2E family transporter	NA	NA	NA	NA
WP_027242612.1\|2582208_2582451_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_155046568.1\|2583351_2583510_-	hypothetical protein	NA	NA	NA	NA
WP_017377064.1\|2583518_2584094_-	hypothetical protein	NA	NA	NA	NA
WP_144420722.1\|2584210_2584393_+	hypothetical protein	NA	NA	NA	NA
WP_017377065.1\|2584968_2585241_+	hypothetical protein	NA	NA	NA	NA
WP_017377066.1\|2585393_2585648_-	DUF493 domain-containing protein	NA	NA	NA	NA
WP_027242613.1\|2585762_2587166_-	hypothetical protein	NA	NA	NA	NA
WP_017377069.1\|2587250_2587757_-	hypothetical protein	NA	NA	NA	NA
WP_017377070.1\|2588320_2590141_+	hypothetical protein	NA	NA	NA	NA
WP_027242614.1\|2590207_2590738_-	hypothetical protein	NA	NA	NA	NA
WP_036774569.1\|2592284_2593001_+	hypothetical protein	NA	NA	NA	NA
WP_036774567.1\|2593043_2593481_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017377073.1\|2593518_2594898_-	MFS transporter	NA	NA	NA	NA
WP_017377074.1\|2595292_2597287_-	hypothetical protein	NA	NA	NA	NA
WP_017377075.1\|2597749_2598562_-	hypothetical protein	NA	NA	NA	NA
WP_144420815.1\|2598745_2600209_-	nuclease	NA	NA	NA	NA
WP_017377077.1\|2600568_2601948_+	hypothetical protein	NA	NA	NA	NA
WP_036772726.1\|2602700_2603249_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.1e-06	34.3

DBSCAN-SWA_30

2635037 : 2678382

Staphylococcus_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036773116.1\|2635037_2636012_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_069971661.1\|2636008_2636446_-	hypothetical protein	NA	NA	NA	NA
WP_048875878.1\|2636620_2638024_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017377105.1\|2638034_2638310_-	hypothetical protein	NA	NA	NA	NA
WP_017377106.1\|2638587_2639058_-	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	6.0e-22	36.6
WP_017377107.1\|2639360_2640731_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.5e-110	45.1
WP_075275363.1\|2641060_2641528_+	CBS domain-containing protein	NA	NA	NA	NA
WP_017377110.1\|2641540_2642551_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_053856766.1\|2642752_2644156_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_027242632.1\|2644582_2645371_-	ABC transporter permease	NA	NA	NA	NA
WP_047927448.1\|2645357_2646386_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-15	28.0
WP_017377113.1\|2646363_2646768_-	glycine-rich domain-containing protein-like	NA	NA	NA	NA
WP_017377115.1\|2646995_2648963_+	TonB-dependent receptor	NA	NA	NA	NA
WP_017377116.1\|2649158_2649650_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_026063598.1\|2649684_2650527_-	amidohydrolase family protein	NA	NA	NA	NA
WP_017377118.1\|2650572_2651025_-	hypothetical protein	NA	NA	NA	NA
WP_017377119.1\|2651314_2651947_+	LysE family translocator	NA	NA	NA	NA
WP_017377120.1\|2651947_2653198_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.7e-93	46.4
WP_027242633.1\|2653231_2654329_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.5e-49	34.9
WP_144420723.1\|2654658_2656044_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_036774495.1\|2656083_2656341_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_053856767.1\|2658756_2660160_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017375801.1\|2660156_2661197_-	hypothetical protein	NA	NA	NA	NA
WP_047927106.1\|2661589_2661985_+	YchJ family protein	NA	NA	NA	NA
WP_144420816.1\|2661981_2662770_-	DUF45 domain-containing protein	NA	NA	NA	NA
WP_017375804.1\|2662955_2663681_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_017375805.1\|2663925_2665113_+	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_017375806.1\|2665405_2665948_-	hypothetical protein	NA	NA	NA	NA
WP_017375807.1\|2665944_2666631_-	acireductone synthase	NA	NA	NA	NA
WP_017375808.1\|2666634_2667246_-	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_017375809.1\|2667292_2668312_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_017375810.1\|2668414_2669209_-	thymidylate synthase	A0A2R4A1R4	Microbacterium_phage	1.1e-103	69.0
WP_017375811.1\|2669222_2670023_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_017375812.1\|2670101_2671151_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_026063478.1\|2671326_2672607_+	inorganic phosphate transporter	E5ESL8	Bathycoccus_sp._RCC1105_virus	4.6e-24	34.7
WP_027242634.1\|2672652_2673330_+	TIGR00153 family protein	NA	NA	NA	NA
WP_017375815.1\|2673415_2673697_-	hypothetical protein	NA	NA	NA	NA
WP_075275366.1\|2673788_2674643_-	MFS transporter	NA	NA	NA	NA
WP_157894745.1\|2674582_2674948_-	MFS transporter	S4TR35	Salmonella_phage	3.8e-08	33.3
WP_027242636.1\|2675508_2676450_+	DMT family transporter	NA	NA	NA	NA
WP_017375821.1\|2677168_2677390_+	hypothetical protein	NA	NA	NA	NA
WP_048875923.1\|2677386_2678382_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

2686725 : 2742662

Staphylococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875873.1\|2686725_2688129_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017375570.1\|2688125_2688263_-	hypothetical protein	NA	NA	NA	NA
WP_048875872.1\|2688435_2689719_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875871.1\|2689923_2690127_-	hypothetical protein	NA	NA	NA	NA
WP_017376862.1\|2690301_2691306_-	hypothetical protein	NA	NA	NA	NA
WP_017376863.1\|2691663_2692899_-	MFS transporter	NA	NA	NA	NA
WP_017376864.1\|2693065_2694016_-	hypothetical protein	NA	NA	NA	NA
WP_048875857.1\|2694523_2695498_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.8e-29	33.2
WP_087910670.1\|2697313_2697499_+	hypothetical protein	NA	NA	NA	NA
WP_087910671.1\|2697592_2698057_-	hypothetical protein	NA	NA	NA	NA
WP_036771639.1\|2698444_2699419_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_032126138.1\|2699846_2700110_-	RNA-binding protein	NA	NA	NA	NA
WP_036771639.1\|2700551_2701526_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.6e-30	33.2
WP_048876253.1\|2701522_2702179_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.3e-10	35.7
WP_036772347.1\|2702340_2702757_-	hypothetical protein	NA	NA	NA	NA
WP_027242641.1\|2702759_2703101_-	hypothetical protein	NA	NA	NA	NA
WP_144420817.1\|2703131_2703665_-	hypothetical protein	NA	NA	NA	NA
WP_036772352.1\|2703846_2704074_-	hypothetical protein	NA	NA	NA	NA
WP_027242642.1\|2704116_2704593_-	hypothetical protein	NA	NA	NA	NA
WP_144420818.1\|2704604_2704793_-	hypothetical protein	NA	NA	NA	NA
WP_027242644.1\|2704994_2708321_-	DotA/TraY family protein	NA	NA	NA	NA
WP_017376870.1\|2708323_2709220_-	hypothetical protein	NA	NA	NA	NA
WP_017376871.1\|2709496_2711800_-	hypothetical protein	NA	NA	NA	NA
WP_036772357.1\|2711841_2713461_-	hypothetical protein	NA	NA	NA	NA
WP_027242646.1\|2713912_2715415_+	hypothetical protein	NA	NA	NA	NA
WP_027242647.1\|2715476_2718476_-	ATPase AAA	NA	NA	NA	NA
WP_048875870.1\|2718512_2718938_-	hypothetical protein	NA	NA	NA	NA
WP_017376878.1\|2718944_2719598_-	hypothetical protein	NA	NA	NA	NA
WP_027242649.1\|2719590_2720667_-	type IVB secretion system coupling complex protein DotM/IcmP	NA	NA	NA	NA
WP_027242650.1\|2720669_2721158_-	hypothetical protein	NA	NA	NA	NA
WP_144420726.1\|2723647_2723887_-	type IV secretion protein IcmT	NA	NA	NA	NA
WP_017376886.1\|2723891_2725022_-	Flp pilus assembly complex ATPase component	NA	NA	NA	NA
WP_017376887.1\|2725024_2725771_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_017376888.1\|2725763_2726267_-	DotD/TraH family lipoprotein	NA	NA	NA	NA
WP_027242651.1\|2726319_2726730_-	hypothetical protein	NA	NA	NA	NA
WP_027242652.1\|2726844_2727885_-	hypothetical protein	NA	NA	NA	NA
WP_027242653.1\|2727900_2728827_-	hypothetical protein	NA	NA	NA	NA
WP_027242654.1\|2728844_2730068_-	conjugal transfer protein TrbI	NA	NA	NA	NA
WP_017376891.1\|2730064_2730967_-	hypothetical protein	NA	NA	NA	NA
WP_144420727.1\|2731136_2731907_-	hypothetical protein	NA	NA	NA	NA
WP_027242655.1\|2732211_2733108_-	hypothetical protein	NA	NA	NA	NA
WP_017376894.1\|2733331_2733565_+	hypothetical protein	NA	NA	NA	NA
WP_155046566.1\|2733781_2734375_+	DedA family protein	NA	NA	NA	NA
WP_027242656.1\|2734392_2735211_-	hypothetical protein	NA	NA	NA	NA
WP_053856768.1\|2735502_2736297_+	hypothetical protein	NA	NA	NA	NA
WP_027242658.1\|2736372_2737836_-	hypothetical protein	NA	NA	NA	NA
WP_053856766.1\|2739178_2740582_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_144420729.1\|2740701_2741340_-	hypothetical protein	NA	NA	NA	NA
WP_036774259.1\|2741687_2742662_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_32

2768733 : 2803822

Escherichia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048875864.1\|2768733_2769759_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_027242662.1\|2770172_2771000_+	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_017377694.1\|2771169_2771898_+\|transposase	IS6-like element ISPsa2 family transposase	A0A077SL39	Escherichia_phage	7.8e-45	42.7
WP_048876012.1\|2772098_2773502_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017376920.1\|2773647_2774145_+	hypothetical protein	NA	NA	NA	NA
WP_048875863.1\|2774214_2775117_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_162038680.1\|2775449_2775707_+	hypothetical protein	NA	NA	NA	NA
WP_036772950.1\|2775768_2776305_-	hypothetical protein	NA	NA	NA	NA
WP_017376923.1\|2776403_2777570_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.3e-25	26.7
WP_017376924.1\|2777874_2780673_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.1e-179	45.1
WP_017376925.1\|2780731_2781952_+	ribonucleotide-diphosphate reductase subunit beta	A0A1V0EEL7	Caulobacter_phage	4.2e-35	28.7
WP_017376926.1\|2782201_2782468_-	hypothetical protein	NA	NA	NA	NA
WP_017376927.1\|2782457_2782595_-	hypothetical protein	NA	NA	NA	NA
WP_017376929.1\|2783021_2783309_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_017376930.1\|2783465_2783795_+	integration host factor subunit beta	NA	NA	NA	NA
WP_017376931.1\|2783829_2785467_-	response regulator	NA	NA	NA	NA
WP_017376932.1\|2785568_2786618_+	hypothetical protein	NA	NA	NA	NA
WP_017376933.1\|2786690_2787335_+	hypothetical protein	NA	NA	NA	NA
WP_026063581.1\|2787331_2788585_-	UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase	NA	NA	NA	NA
WP_017376935.1\|2788602_2789874_-	hypothetical protein	NA	NA	NA	NA
WP_017376936.1\|2789898_2790489_-	UPF0149 family protein	NA	NA	NA	NA
WP_017376937.1\|2790633_2790858_+	TIGR02449 family protein	NA	NA	NA	NA
WP_016209991.1\|2790838_2791168_+	cell division protein ZapA	NA	NA	NA	NA
WP_026063582.1\|2791394_2791958_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_017376939.1\|2791994_2792456_+	EVE domain-containing protein	NA	NA	NA	NA
WP_017376940.1\|2792533_2794219_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-26	29.6
WP_026063583.1\|2794268_2795096_-	3'(2'),5'-bisphosphate nucleotidase CysQ	NA	NA	NA	NA
WP_016210000.1\|2795095_2795644_-	ADP compounds hydrolase NudE	NA	NA	NA	NA
WP_017376942.1\|2795773_2796166_+	ribosome-associated heat shock protein Hsp15	NA	NA	NA	NA
WP_017376943.1\|2796416_2796674_-	hypothetical protein	NA	NA	NA	NA
WP_155046564.1\|2796670_2797282_-	hypothetical protein	NA	NA	NA	NA
WP_087910653.1\|2797486_2797702_-	hypothetical protein	NA	NA	NA	NA
WP_155046563.1\|2797718_2797856_+	hypothetical protein	NA	NA	NA	NA
WP_069971662.1\|2798325_2799300_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.5e-30	33.2
WP_027242664.1\|2799583_2800786_-	hypothetical protein	NA	NA	NA	NA
WP_162038681.1\|2801297_2801525_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_053856769.1\|2801842_2802409_+	hypothetical protein	NA	NA	NA	NA
WP_048875862.1\|2802553_2802808_+	hypothetical protein	NA	NA	NA	NA
WP_048875861.1\|2802952_2803822_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_33

2815933 : 2842284

Staphylococcus_phage(40.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017376964.1\|2815933_2818414_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	3.8e-192	43.8
WP_036772765.1\|2818476_2818908_-	hypothetical protein	NA	NA	NA	NA
WP_017376966.1\|2819108_2819399_-	hypothetical protein	NA	NA	NA	NA
WP_027242666.1\|2819458_2821057_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-06	30.1
WP_017376969.1\|2821221_2821557_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_017376970.1\|2821585_2823250_-	ubiquinone biosynthesis regulatory protein kinase UbiB	E5ERK4	Ostreococcus_lucimarinus_virus	6.4e-34	28.8
WP_027242667.1\|2823249_2823891_-	lipoprotein	NA	NA	NA	NA
WP_017376972.1\|2823890_2824634_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_017376973.1\|2824692_2824929_-	hypothetical protein	NA	NA	NA	NA
WP_017376974.1\|2825079_2826447_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.6e-43	29.9
WP_017376975.1\|2826457_2827009_-\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_065653729.1\|2827089_2828193_-	SPOR domain-containing protein	NA	NA	NA	NA
WP_017376977.1\|2828194_2829952_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_062312189.1\|2830174_2830798_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_016210574.1\|2830852_2831272_-	prokaryotic dksA/traR C4-type zinc finger family protein	NA	NA	NA	NA
WP_047927116.1\|2831412_2832027_+	hypothetical protein	NA	NA	NA	NA
WP_027242668.1\|2832084_2832870_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017376980.1\|2833501_2834518_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_144420820.1\|2834520_2835033_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_017376982.1\|2835074_2835548_-\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_162038682.1\|2835603_2836353_-	DUF21 domain-containing protein	NA	NA	NA	NA
WP_036771653.1\|2836432_2837173_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.9e-09	33.2
WP_017376985.1\|2837262_2837511_+	hypothetical protein	NA	NA	NA	NA
WP_087910654.1\|2837886_2838540_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_144420733.1\|2838508_2838688_+	hypothetical protein	NA	NA	NA	NA
WP_053856770.1\|2839085_2840300_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875859.1\|2840608_2841403_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017375625.1\|2841535_2841763_+	hypothetical protein	NA	NA	NA	NA
WP_036772490.1\|2842005_2842284_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_34

2925945 : 3037079

102

Staphylococcus_phage(13.33%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017378106.1\|2925945_2926890_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_017378107.1\|2926889_2927243_-	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_162038683.1\|2927291_2929967_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	3.9e-25	23.9
WP_017378109.1\|2929983_2931501_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_016209273.1\|2931577_2932030_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_017378110.1\|2932248_2933688_-	NADH-quinone oxidoreductase subunit NuoN	NA	NA	NA	NA
WP_017378111.1\|2933687_2935226_-	NADH-quinone oxidoreductase subunit M	NA	NA	NA	NA
WP_017378112.1\|2935240_2937211_-	NADH-quinone oxidoreductase subunit L	NA	NA	NA	NA
WP_016209309.1\|2937214_2937520_-	NADH-quinone oxidoreductase subunit NuoK	NA	NA	NA	NA
WP_017378113.1\|2937543_2938167_-	NADH-quinone oxidoreductase subunit J	NA	NA	NA	NA
WP_017378114.1\|2938186_2938675_-	NADH-quinone oxidoreductase subunit NuoI	NA	NA	NA	NA
WP_027242679.1\|2938688_2939714_-	NADH-quinone oxidoreductase subunit NuoH	NA	NA	NA	NA
WP_017378117.1\|2939718_2942112_-	NADH-quinone oxidoreductase subunit G	NA	NA	NA	NA
WP_016209307.1\|2942161_2943451_-	NADH-quinone oxidoreductase subunit NuoF	NA	NA	NA	NA
WP_017378118.1\|2943457_2943958_-	NAD(P)H-dependent oxidoreductase subunit E	NA	NA	NA	NA
WP_017378119.1\|2943957_2945211_-	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_017378120.1\|2945212_2945890_-	NADH-quinone oxidoreductase subunit C	NA	NA	NA	NA
WP_016209262.1\|2945907_2946393_-	NADH-quinone oxidoreductase subunit B	NA	NA	NA	NA
WP_016209283.1\|2946383_2946752_-	NAD(P)H-quinone oxidoreductase subunit 3	NA	NA	NA	NA
WP_017378122.1\|2947430_2947793_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_017378123.1\|2947806_2948568_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_017378124.1\|2948869_2950216_+	hypothetical protein	NA	NA	NA	NA
WP_036771461.1\|2950312_2950855_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	NA	NA	NA	NA
WP_017378126.1\|2950970_2951804_+	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_027242680.1\|2951825_2952419_+	thymidine kinase	A0A0B7MRR0	Enterobacteria_phage	6.4e-53	53.6
WP_048875856.1\|2952594_2953614_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_017375571.1\|2953884_2954286_+	hypothetical protein	NA	NA	NA	NA
WP_017378129.1\|2954296_2954620_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_065653735.1\|2954643_2955654_-	lipase	NA	NA	NA	NA
WP_017378132.1\|2955720_2956569_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_026063707.1\|2956685_2957597_-	Nudix family hydrolase	NA	NA	NA	NA
WP_036772169.1\|2958363_2959239_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_026063708.1\|2959297_2959678_-	hypothetical protein	NA	NA	NA	NA
WP_026063709.1\|2959824_2960061_-	hypothetical protein	NA	NA	NA	NA
WP_017378135.1\|2960357_2960828_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_017378136.1\|2960882_2961737_-	SIS domain-containing protein	NA	NA	NA	NA
WP_017378137.1\|2962208_2962427_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_027242681.1\|2964123_2964606_-	hypothetical protein	NA	NA	NA	NA
WP_144420735.1\|2964842_2965250_-	hypothetical protein	NA	NA	NA	NA
WP_036773116.1\|2965606_2966581_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.6e-29	32.9
WP_017378141.1\|2966639_2967692_-	hypothetical protein	NA	NA	NA	NA
WP_017378142.1\|2968010_2968976_-	hypothetical protein	NA	NA	NA	NA
WP_017378143.1\|2969278_2970103_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_017378144.1\|2970304_2971381_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_017378145.1\|2971465_2972452_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_017378146.1\|2972470_2973115_+	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_027242684.1\|2973126_2974236_+	histidinol-phosphate transaminase	A0A142C026	Faustovirus	1.6e-17	23.5
WP_027242685.1\|2974302_2974965_-	hypothetical protein	NA	NA	NA	NA
WP_027242686.1\|2975224_2977108_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_017378149.1\|2977421_2978921_+	bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase	NA	NA	NA	NA
WP_017378150.1\|2979011_2979794_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	1.8e-31	33.0
WP_017378151.1\|2979921_2980842_+	SPFH/Band 7/PHB domain protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	2.2e-20	27.5
WP_017378152.1\|2980865_2981324_+	NfeD family protein	NA	NA	NA	NA
WP_048875854.1\|2981445_2982321_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017378154.1\|2982354_2983620_-	hypothetical protein	NA	NA	NA	NA
WP_036772169.1\|2983807_2984683_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_048875853.1\|2984880_2985072_-	hypothetical protein	NA	NA	NA	NA
WP_048875852.1\|2985276_2986572_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275379.1\|2986891_2987110_+	hypothetical protein	NA	NA	NA	NA
WP_017375941.1\|2987146_2988526_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	3.0e-53	30.9
WP_017375942.1\|2988553_2989012_-	dUTP diphosphatase	G0YQD9	Erwinia_phage	3.5e-51	68.0
WP_036773720.1\|2988989_2990207_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	6.3e-39	34.3
WP_017375944.1\|2990399_2990636_+	50S ribosomal protein L28	NA	NA	NA	NA
WP_016210730.1\|2990649_2990805_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_017375945.1\|2990885_2991848_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_017375947.1\|2992007_2993324_+	MATE family efflux transporter	NA	NA	NA	NA
WP_017375948.1\|2993333_2994002_-	hypothetical protein	NA	NA	NA	NA
WP_017375949.1\|2994412_2996227_+	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	3.8e-24	45.1
WP_144420736.1\|2996942_2997128_+	hypothetical protein	NA	NA	NA	NA
WP_017375951.1\|2997309_2997768_+\|transposase	transposase	NA	NA	NA	NA
WP_036772169.1\|2998486_2999362_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_144420737.1\|2999593_2999992_+\|transposase	transposase	NA	NA	NA	NA
WP_081000012.1\|2999995_3000238_+\|transposase	transposase	NA	NA	NA	NA
WP_017375794.1\|3001127_3002879_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_017375795.1\|3002889_3003690_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-33	39.1
WP_017375796.1\|3003792_3004281_-	dihydrofolate reductase	A0A1B2IDT7	Erwinia_phage	4.5e-28	43.1
WP_047927156.1\|3004780_3005704_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017375799.1\|3005800_3006145_+	DMT family protein	NA	NA	NA	NA
WP_162034387.1\|3007057_3007216_-	hypothetical protein	NA	NA	NA	NA
WP_017377528.1\|3011839_3012802_-	hypothetical protein	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	7.0e-17	28.1
WP_036772663.1\|3012840_3013716_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_026063646.1\|3013975_3015235_-	transcription termination factor Rho	NA	NA	NA	NA
WP_016210045.1\|3015457_3015784_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	1.5e-16	46.2
WP_048875850.1\|3015978_3016929_+	hypothetical protein	NA	NA	NA	NA
WP_027242725.1\|3016986_3019053_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_017377534.1\|3019058_3020054_-	porphobilinogen synthase	NA	NA	NA	NA
WP_027242724.1\|3020811_3022392_+	APC family permease	NA	NA	NA	NA
WP_016210041.1\|3022539_3023949_-	glutamate--ammonia ligase	NA	NA	NA	NA
WP_017377536.1\|3024008_3025142_-	cation transporter	NA	NA	NA	NA
WP_017377537.1\|3025280_3026105_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_027242723.1\|3026332_3026632_-	hypothetical protein	NA	NA	NA	NA
WP_017377539.1\|3026628_3026841_-	hypothetical protein	NA	NA	NA	NA
WP_155046561.1\|3026854_3026992_+	hypothetical protein	NA	NA	NA	NA
WP_017377540.1\|3027129_3027363_-	hypothetical protein	NA	NA	NA	NA
WP_016210044.1\|3028414_3028786_-	isochorismatase	NA	NA	NA	NA
WP_017377542.1\|3029096_3029384_-	hypothetical protein	NA	NA	NA	NA
WP_017377543.1\|3029535_3030384_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_048875849.1\|3030506_3031478_+\|transposase	transposase	NA	NA	NA	NA
WP_017377545.1\|3031580_3032621_+	succinylglutamate desuccinylase	NA	NA	NA	NA
WP_017377550.1\|3035159_3035450_-	hypothetical protein	NA	NA	NA	NA
WP_017377551.1\|3035717_3035978_-	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|3036104_3037079_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

DBSCAN-SWA_35

3070072 : 3130719

Staphylococcus_phage(37.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075278722.1\|3070072_3070948_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_017377392.1\|3071472_3072069_+	biotin/lipoyl-binding protein	NA	NA	NA	NA
WP_017377391.1\|3072339_3072918_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_017377386.1\|3077440_3078946_-	YifB family Mg chelatase-like AAA ATPase	NA	NA	NA	NA
WP_016209709.1\|3079402_3079744_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_017377384.1\|3079864_3081769_+	biosynthetic arginine decarboxylase	NA	NA	NA	NA
WP_047927397.1\|3081901_3083473_-	hypothetical protein	NA	NA	NA	NA
WP_047927396.1\|3083490_3084708_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_017377379.1\|3084829_3085828_-	3-deoxy-7-phosphoheptulonate synthase	NA	NA	NA	NA
WP_144420826.1\|3085831_3086590_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_017377377.1\|3086591_3087791_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_036771983.1\|3087774_3088446_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_017377374.1\|3089245_3090244_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	2.7e-40	32.4
WP_017377373.1\|3090245_3090824_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-44	44.5
WP_016209719.1\|3092332_3092620_-	trp operon repressor	NA	NA	NA	NA
WP_026063627.1\|3092820_3093741_+	DMT family transporter	NA	NA	NA	NA
WP_017377369.1\|3093856_3094411_+	hypothetical protein	NA	NA	NA	NA
WP_017377368.1\|3094526_3094952_+	hypothetical protein	NA	NA	NA	NA
WP_036771981.1\|3095222_3095573_+	hypothetical protein	NA	NA	NA	NA
WP_027242711.1\|3095766_3096306_+	peroxiredoxin	NA	NA	NA	NA
WP_017377365.1\|3096390_3096927_+	hypothetical protein	NA	NA	NA	NA
WP_027242710.1\|3097586_3097889_-	hypothetical protein	NA	NA	NA	NA
WP_027242709.1\|3098337_3098907_+	hypothetical protein	NA	NA	NA	NA
WP_036771979.1\|3098999_3099320_+	hypothetical protein	NA	NA	NA	NA
WP_017376171.1\|3099498_3100473_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_155046560.1\|3100739_3100913_+	hypothetical protein	NA	NA	NA	NA
WP_048876031.1\|3101018_3102422_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_048875844.1\|3102426_3103446_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_075275373.1\|3104062_3104392_+	hypothetical protein	NA	NA	NA	NA
WP_017378398.1\|3104617_3105016_-	DUF3135 domain-containing protein	NA	NA	NA	NA
WP_017378399.1\|3105883_3106834_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_017378400.1\|3106833_3108912_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_017378401.1\|3109053_3109569_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_017378402.1\|3109577_3110141_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_017378403.1\|3110121_3110868_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_017378404.1\|3111006_3111459_+	hypothetical protein	NA	NA	NA	NA
WP_047927132.1\|3111594_3112431_+	sterol desaturase family protein	NA	NA	NA	NA
WP_027242707.1\|3112427_3113324_+	DMT family transporter	NA	NA	NA	NA
WP_017378407.1\|3113356_3114424_+	4-oxalomesaconate tautomerase	NA	NA	NA	NA
WP_016210352.1\|3114442_3114811_-	diacylglycerol kinase	NA	NA	NA	NA
WP_080963575.1\|3114836_3116288_-	potassium transporter	NA	NA	NA	NA
WP_017378410.1\|3116294_3117674_-	Trk system potassium transporter TrkA	NA	NA	NA	NA
WP_036773239.1\|3117714_3119028_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_026063734.1\|3119017_3119992_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.3e-10	35.9
WP_017378413.1\|3120085_3120589_-	peptide deformylase	E3SLL2	Synechococcus_phage	5.4e-13	37.1
WP_017378414.1\|3120723_3121875_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_016210342.1\|3121871_3122351_+	DUF494 domain-containing protein	NA	NA	NA	NA
WP_027242705.1\|3122497_3124819_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	7.9e-99	35.9
WP_080963576.1\|3124763_3125390_+	hypothetical protein	NA	NA	NA	NA
WP_017378416.1\|3125394_3126294_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_036773242.1\|3126474_3127029_+	DUF4823 domain-containing protein	NA	NA	NA	NA
WP_036771330.1\|3127068_3128043_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9
WP_017378420.1\|3128632_3129010_+	hypothetical protein	NA	NA	NA	NA
WP_036771330.1\|3129744_3130719_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.6e-29	32.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP048053

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP048055

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP048052

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection