CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP047591	Aminipila sp. CBA3637 chromosome, complete genome	2 crisprs	WYL,cas3,csa3,RT	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP047591_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047591_1

837078-837157

Orphan

Consensus_repeat	Method
GCATTCTGCGCTTTCGTTGCTTCTCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047591_1

>merge|NZ_CP047591|1|837078-837157|CRISPRCasFinder
GCATTCTGCGCTTTCGTTGCTTCTCTGTTGGCTTTCATCTCTGTTCTAAGGTCTGCATTTTGCGCTTTCGTTGCTTCTCT

>NZ_CP047591|1|1|837078-837157|CRISPRCasFinder
GCATTCTGCGCTTTCGTTGCTTCTCT	GTTGGCTTTCATCTCTGTTCTAAGGTCT
GCATTTTGCGCTTTCGTTGCTTCTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047591.1\|WP_162361411.1\|836264_836957_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP047591.1\|WP_162361416.1\|841609_842059_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
NZ_CP047591.1\|WP_162361404.1\|830298_830661_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP047591.1\|WP_162361405.1\|830663_832340_+\|peptidase-M56	unknown	unknown	gnl\|CDD\|310280
NZ_CP047591.1\|WP_162361408.1\|833915_834398_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP047591.1\|WP_162361402.1\|828436_828733_+\|DUF3892-domain-containing-protein	unknown	unknown	gnl\|CDD\|379026
NZ_CP047591.1\|WP_162361406.1\|832383_833175_+\|DUF4163-domain-containing-protein	unknown	unknown	gnl\|CDD\|379356
NZ_CP047591.1\|WP_162361410.1\|834855_836265_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP047591.1\|WP_162361422.1\|844733_845183_+\|DUF3955-domain-containing-protein	unknown	unknown	gnl\|CDD\|379038
NZ_CP047591.1\|WP_162361403.1\|828840_830031_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341458
NZ_CP047591.1\|WP_162361421.1\|844260_844737_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP047591.1\|WP_162361420.1\|843693_844053_-\|YxeA-family-protein	unknown	unknown	gnl\|CDD\|377665
NZ_CP047591.1\|WP_162361414.1\|838422_840357_+\|DUF4825-domain-containing-protein	unknown	unknown	gnl\|CDD\|310280
NZ_CP047591.1\|WP_162361407.1\|833250_833841_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP047591.1\|WP_162361417.1\|842080_842671_-\|hydrolase	unknown	unknown	gnl\|CDD\|223489
NZ_CP047591.1\|WP_162361415.1\|840454_841381_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP047591.1\|WP_162361418.1\|842704_842941_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378913
NZ_CP047591.1\|WP_162361419.1\|842958_843540_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP047591.1\|WP_162361413.1\|838055_838421_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP047591.1\|WP_162361409.1\|834438_834843_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP047591.1\|WP_162361411.1\|836264_836957_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.92258e-85
NZ_CP047591.1\|WP_162361419.1\|842958_843540_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.94218e-13
NZ_CP047591.1\|WP_162361404.1\|830298_830661_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	8.34634e-22
NZ_CP047591.1\|WP_162361405.1\|830663_832340_+\|peptidase-M56	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	2.62111e-53
NZ_CP047591.1\|WP_162361402.1\|828436_828733_+\|DUF3892-domain-containing-protein	gnl\|CDD\|379026	pfam13031, DUF3892, Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length.	2.48795e-14
NZ_CP047591.1\|WP_162361406.1\|832383_833175_+\|DUF4163-domain-containing-protein	gnl\|CDD\|379356	pfam13739, DUF4163, Domain of unknown function (DUF4163). The structure of this domain is and alpha-beta-two layer sandwich, identified from a Fervidobacterium nodosum Rt17-B1 like protein. The function is not known except that it is found in association with Heat-shock cognate 70kd protein 44kd ATPase, pfam11738.	3.68254e-07
NZ_CP047591.1\|WP_162361410.1\|834855_836265_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.49082e-66
NZ_CP047591.1\|WP_162361422.1\|844733_845183_+\|DUF3955-domain-containing-protein	gnl\|CDD\|379038	pfam13127, DUF3955, Protein of unknown function (DUF3955). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 68 and 87 amino acids in length. There are two completely conserved residues (G and E) that may be functionally important.	4.54241e-13
NZ_CP047591.1\|WP_162361403.1\|828840_830031_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341458	cd08179, NADPH_BDH, NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria. NADPH-dependent butanol dehydrogenase (BDH) is involved in the butanol and ethanol formation pathway of some bacteria. The fermentation process is characterized by an acid producing growth phase, followed by a solvent producing phase. The latter phase is associated with the induction of solventogenic enzymes such as butanol dehydrogenase. The activity of the enzyme requires NADPH as cofactor, as well as divalent ions zinc or iron. This family is a member of the iron-containing alcohol dehydrogenase superfamily. Protein structure has a dehydroquinate synthase-like fold.	0
NZ_CP047591.1\|WP_162361421.1\|844260_844737_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	7.29461e-32
NZ_CP047591.1\|WP_162361420.1\|843693_844053_-\|YxeA-family-protein	gnl\|CDD\|377665	pfam06486, DUF1093, Protein of unknown function (DUF1093). This family consists of several hypothetical bacterial proteins of unknown function.	7.45165e-17
NZ_CP047591.1\|WP_162361414.1\|838422_840357_+\|DUF4825-domain-containing-protein	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	6.30545e-61
NZ_CP047591.1\|WP_162361407.1\|833250_833841_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.73187e-15
NZ_CP047591.1\|WP_162361417.1\|842080_842671_-\|hydrolase	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	1.28336e-24
NZ_CP047591.1\|WP_162361415.1\|840454_841381_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.07108e-55
NZ_CP047591.1\|WP_162361418.1\|842704_842941_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378913	pfam12674, Zn_ribbon_2, Putative zinc ribbon domain. This domain appears to be a zinc binding DNA-binding domain.	2.7272e-13
NZ_CP047591.1\|WP_162361413.1\|838055_838421_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	3.26321e-22
NZ_CP047591.1\|WP_162361416.1\|841609_842059_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	3.97563e-34

>NZ_CP047591.1|WP_162361411.1|836264_836957_-|response-regulator-transcription-factor
MGTQRILIVDDDKNICKLMELYLGNAGYLTACCHDGSSALDKINKEDYNLVILDLMLPAINGWEVCRLIKMEKNIPIIMVTARDMIDDKINGFEAGADDYLVKPFEPKELVARVKARLKNAAPSDCKQINKSIMVDDLMVDINKYEVRINNQMINLKPKETQLLYFMLINKNIVFTREQLLEKIWDYSYQGDTRTVDVHIKCLREKLNSESKVWEIKTVWGVGYKLEVNE
>NZ_CP047591.1|WP_162361410.1|834855_836265_-|HAMP-domain-containing-histidine-kinase
MKSIFSRLLITYFIVVLMIIVILTSAISFMYKTIVMEEKKESFQSMAKRIGILTEKYAKGAMSQEELNAVINGMSYSADAMIYVIQIDKESFSKEKNLKFQGFTDKFVYNDLSEILKGNQIFRKNQYSEKLETYVAYMGYPLKINAEIKGAILMFCPIYNINQNIMRMNLILWTCGGIIFLMSVPFIFINSRRISKPIEQVEIAARTIAKGERTAPVMVHSKDELGMLAHSFNNMKEQLEMNDQVRREFIANVSHELRTPLTSIGGFVQGMLDGIIPMKESTEYLKIIHGETKRLEHLTSDLLDMAKIQSGVVELKIEEINLYEIVSEAILLVKDKTEEKHIKVKTQVETKLKIAMDRERLMQILINLLNNAVKFSKTHGSISISAAERKHLVVISITDTGIGIPQQDLPFIFDKFYRSNKEHSSERESSGLGLSIVKNLVVLSGGNIWAQSKEGQGTNISFTVNKVEG
>NZ_CP047591.1|WP_162361409.1|834438_834843_-|hypothetical-protein
MKNRKFLMYLLLILLVIILGAGCNKSDHKSAEIKDVSGGEKKVESPDKSQDESEKSKEQKEDKKVSEPQKEQAGSSPIQKKEPESGDNQEAAKKNVVTVIAKSENNLSDSEKQEMVNQLSDEVDGLVKEINSME
>NZ_CP047591.1|WP_162361408.1|833915_834398_-|hypothetical-protein
MKKIVYIFCICILALSVIQTAYAGANKNPDKGIKEEIVVLNDQIRQNKDEIIQLKQQVASVTASIQAKVSQLASNKTAITQSKAADLKTVLSIIKNSKKSLKGIKGDGLKQYIADSKADRENKSFEQARDKMNKVLELQETRKQTLNQILNDLNTANQLL
>NZ_CP047591.1|WP_162361407.1|833250_833841_-|helix-turn-helix-domain-containing-protein
MDCNKVGELILSLRKEKGMTQKQLADVMNISDKAISKWERGMGCPDVSLLRELSKVLEVNIEKILLGNLEPNDADGGNMKKLKFYVCPNCGNILTATGEGEVYCCGRKLAGLVPKPADDNHGLTIEEVENDFYITFNHEMTKEHFIGFVAYISYDRVLLIKLYPEQSPEVRFPRMNRGKLYYYCSQHGLWVKDKLI
>NZ_CP047591.1|WP_162361406.1|832383_833175_+|DUF4163-domain-containing-protein
MKKCKIVLILALILSLCLAGCSQNKSSSDETKKEVQKKETKKVEAMYELKSETFKDKDVVINYPQLINLSDTTAQDKINKIIKDQAFLTYNDVLKQGEEFSYELKYDVKYCSPELLSIRFNGYINFIQSAHPSNFVQTLNINIKDQKTVKLNDIVNINEGFVDLFKKGKYLSPYPDQPPELMESINSFLKETDTKGWIELLKTSDSLDINNGGQYSYFTKDGLVIVVSVPHFMGDFAEFQINYKDLSDYKKTDNEVWQFLNEK
>NZ_CP047591.1|WP_162361405.1|830663_832340_+|peptidase-M56
MNELFFSVLHMSMTASYVILFIMILRLPLKRVPKNISYALWSIAAFRLLCPFSFKSIISFIPSGADKIPQYIIQSQSPHINSNAINTVTQKAAMASAADYGVSPVQTFFNSWGWQIWVTGMVLMLIYSIFCILILKNRLKDSNHLQLNIYEAYNIKTPFVLGIVNPKIYLPAGLTEGEKRYIIEHEKTHIARLDHMVKLFAFIILSIHWFNPLVWISFLLMGTDMELSCDERVIQKMGVGVKKEYSTSLLSLATNHRIINGSPLAFGERNVKGRIKNVLNYKKPVPWIIAISIIIVCIIGAGLLADPKAEALSNIKPLGESTSNLEQSISNALLSHYKTEFNSPWYEVASEGHVTLGTEDKGGLTNVYLLEQYYEFSFENGDLTVSSGHGSNVAVLSFKKDKNGKYIYHGFKAPLTDEEYYSFIKNSFSSAALDKLNTTDREKSKSDLDSQCEAYASAYLKKIGRSADIDIYAKEKQRPAINSEVSNFLFKNYKDYPYWIGTRETVEKGTRYIYETGWKDQGKLNGIITFTKKRDNGDIIKTIKIQIQDNKILPISNT
>NZ_CP047591.1|WP_162361404.1|830298_830661_+|BlaI/MecI/CopY-family-transcriptional-regulator
MSSYKLTKTESKFADLIWQNEPVSSGELARICEKEMNWKKSTTYTVLKKLCEKGIFKNENALVTSCFKKEEFYAKQSRYFVEDFFGGSLPKFLTAFIGGNKLSIKQAEDLKKLIDEYKED
>NZ_CP047591.1|WP_162361403.1|828840_830031_-|iron-containing-alcohol-dehydrogenase
MGRFTLPRDIYHGSGSLSELKNLKGQKAFLVVGGGSMKRFGFLDKAVGFLKEAGMEVELFENVEPDPSVDTVMRGAEAMKKFQPDWIVSMGGGSPIDAAKAMWAFYEYPETTFEDLITPFNFPELRTKAKFCAIPSTSGTATEVTAFSVITDYEKGIKYPLADFNITPDVAIVDPELAETMPPKLIAYTGMDAMTHAIEAYVSTLHCDYTDPLALHAIKMVHEFLKKSYDGDKEAKERMHNAQCLAGMAFSNALLGIVHSMAHKTGAAYSGGHIVHGCANAMYLPRVIQFNAKNADAAKRYADIARFMGLNAGSDEELIDALVKEIKAMNESLDIPCCIKKYEDGIIKEEEFMEKLSRVAELAIGDACTGSNPRIPTQEEMEKLLKACYYGEDINF
>NZ_CP047591.1|WP_162361402.1|828436_828733_+|DUF3892-domain-containing-protein
MNDQKNTMDASLARNTLDEIPTPASDAKRITALVKHSGRVTGYQLSDDSILSKEECIDLARRGGIMGVGVAHRGDTEYLKSIPDGSENNNLSTLPTIH
>NZ_CP047591.1|WP_162361413.1|838055_838421_+|BlaI/MecI/CopY-family-transcriptional-regulator
MSEELKLCESDYRLACIIWENEPLGSGDLVKLCQKNLGWKKSTTYTVLKKLCDRGFFKNEDALVTSLIEKEQVQKYESEQFIDRTFGGSLPGFIAAFMNDKTISKQEAEELKKLIDSYREV
>NZ_CP047591.1|WP_162361414.1|838422_840357_+|DUF4825-domain-containing-protein
MEGFLENLFLHILNMSITASYITLFVILARFLLKKSPKIFSYALWSVVLFRLICPFSFTSVFSFLHVFGMGSGKMEYIPSEIGTMALPQVNTGIKSMDSTINSSLPAALPEASYNPMQIIIFVLSVLWVIGVAAIFVYSIISYVKLKHKVCTAIRIENNVYETGSISSPFVLGIIKPKIYLPADIDQKQRTYILMHEQTHINRRDHLIKPLAFLSLCLHWFNPLVWISFVLMTKDMEMSCDESVLKKLGTNIKKDYSSSLLSMALNNHRINAIPLAFGESNVKMRIKNILDYKKPGIFLMVMLAAFCTIVIFVCISNPKETDIPATVNPIQTADQLYENRTPYLGNNSKVITLLDTLPLPEGITRSEVQLNTSTKPYSATIHYSTKNDSLVTDKKDFFKISALLMATVDNMDSITHIGHWSNPALSSSQFYYSFTRSEIETVLRCDVREYGKSPKDLSKLMERLDQINLSEKSQTELVPLQAQWTAKQSLGADMAVLDYASDTTVIFHGYFGLYVYDLNTLQIVRSLDLKALKCDATQGDNYCEVSVSEDGSTVQLHPVSSKKMFVYTVSDNNLVEIPYKPLNNPFKGSLVPVEKVIHSDTGKYSYNAVDFKNGEYGLLYTPDGTIGTLTYMRADMLYSLFKVN
>NZ_CP047591.1|WP_162361415.1|840454_841381_-|diguanylate-cyclase
MYNIKEYNRYKYVLENIKDIIWEMDASLVFTFVSEASEETAGYKAEELVGRCMLDFLTPESKNYVAQKWRERFTGTENLKKIILYDVQFVCKDGSLIWVEVSVKPIINNDKLMGYIGVTRDISEKKSHEEELKKYIEELKYANKRLEEMATFDMLTGAYNRRKFEYFVKMSIEKKENSGISFCIIMFDIDFFKKVNDTFGHREGDRILKEITAIVKSSLREQDKVFRWGGEEFIILLPELPLERTEEIAESLRKAVEQNDFGIKNHPVTISLGIGEYVINDSIEQFVSRVDNGLLKAKSTGRNRVIIG
>NZ_CP047591.1|WP_162361416.1|841609_842059_+|Hsp20/alpha-crystallin-family-protein
MFGLTPLNRNQLQKRDGHDFIDFYNMLDDFFSDNPFSLRNPGSQAFKLDVKDQGNAYLVEAEMPGTKKEEIKLDYQNDYLIIKVEKNEEINEEKENFLHRERRSSSMQRSVYLKDIDVATVEAKLEDGILKISLPKIEQPSNKLQIEIK
>NZ_CP047591.1|WP_162361417.1|842080_842671_-|hydrolase
MLKYINHNQMACIVLHEIYGINDFIRNICLQYHQEGADVYCPDLLKKESHFHYGEAAEAYSYFTSEIGFEVYRDILDLIKELKESYERVVVIGFSIGATIAWRCCQSSYCDAVVACYGSRIRDYLHLEPKCKTYLMFAEMDSFDVDFVCKELLKKQNTEILRINAHHGFLDKYSASFDQEKSDYFNLQRKKWGVFH
>NZ_CP047591.1|WP_162361418.1|842704_842941_-|AraC-family-transcriptional-regulator
MKMCIACGMPMKAKEDFAMGDESKDYCRYCARPDGSMQSYDEKLEGMTDFIVRTQGLDKAAGENAARGMMEKLPAWKK
>NZ_CP047591.1|WP_162361419.1|842958_843540_-|TetR/AcrR-family-transcriptional-regulator
MSKRDEQKAKTRQIIIHAAFEQFSKGGLINTPTASVAKAAGVSHGTIFAHFPTREDLLDAVIEEFGIRVSERMHELAQGACGMREILQVHLKGISEYENFYIRLISETPLLHEDTKNTLIMIQSAVSFHLTQVAEREMEKHIIKRMPLNLMFNTWLGLIHYYLANRDLFAPEGSVISRYGEEWVQHFMNLISL
>NZ_CP047591.1|WP_162361420.1|843693_844053_-|YxeA-family-protein
MKKFLLVIGVIILVISAYFIMSFDSDKLDPDNPSGKTVYYTTINNDKVELNGDNRYEYKLSCYDEKGKEKSLDFTTGKELKAGAYVKLFHATFRGVTHWEEVKQSDLPERVQKIYKNNK
>NZ_CP047591.1|WP_162361421.1|844260_844737_+|sigma-70-family-RNA-polymerase-sigma-factor
MTEFEEIYSKYFKDVYRYVLCLSKNENIAEDITQETFFKALKSIDSFKGNCKMSVWLCQIAKNAYFSYLRKEKINFENIDDIGDYSDSGFEQLLAGNEGAFEIHKLLHNLEEPYKEVFTLRFFGDLSFLKIAELFGKTESWSRVTYHRARIKLKEKLK
>NZ_CP047591.1|WP_162361422.1|844733_845183_+|DUF3955-domain-containing-protein
MKLSCEVIKDLLPLYYDKVCSKESALLVEEHLADCPQCRDELQKLNMHLESPTISNQEVKFMENISEKWKKDKRVSFTRGSMLISALAALICFVSYNLIGSKLLPDGTLVEPFALIPIGYLFILLFIISLIFNLLFLLIAKLKKNNKKS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP047591_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP047591_2

3374146-3374250

Orphan

Consensus_repeat	Method
AACAGGTTTTTCTACTACTGGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP047591_2

>merge|NZ_CP047591|2|3374146-3374250|CRISPRCasFinder
AACCGTTTTATCTACTACAGCTGGTATTTCTACTGGAGTTCCTGTAGCTGGTTTACTTACATTAACAGCCGGTGTGTCCACTACAGGTTTTTCTGTTGCAGGTTG

>NZ_CP047591|2|2|3374146-3374250|CRISPRCasFinder
AACCGTTTTATCTACTACAGCTGG	TATTTCTACTGGAGTTCCTGTAGCTGGTTTACTTACATTAACAGCCGGTGTGTCCAC
TACAGGTTTTTCTGTTGCAGGTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP047591.1\|WP_162363494.1\|3380578_3381874_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP047591.1\|WP_162363802.1\|3371980_3372841_+\|4Fe-4S-binding-protein	unknown	unknown	gnl\|CDD\|223425
NZ_CP047591.1\|WP_162363496.1\|3383051_3383984_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP047591.1\|WP_162363481.1\|3366046_3367834_-\|lysylphosphatidylglycerol-synthetase-family-protein	unknown	unknown	gnl\|CDD\|225451
NZ_CP047591.1\|WP_162363493.1\|3379820_3380561_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP047591.1\|WP_162363483.1\|3368772_3369573_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377924
NZ_CP047591.1\|WP_162363479.1\|3364989_3365529_+\|rubrerythrin-family-protein	unknown	unknown	gnl\|CDD\|153100
NZ_CP047591.1\|WP_162363486.1\|3371823_3371976_+\|thioredoxin	unknown	unknown	unknown
NZ_CP047591.1\|WP_162363491.1\|3378888_3379203_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366664
NZ_CP047591.1\|WP_162363490.1\|3375811_3378667_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP047591.1\|WP_162363482.1\|3367827_3368193_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223469
NZ_CP047591.1\|WP_162363489.1\|3374594_3375713_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|227268
NZ_CP047591.1\|WP_162363497.1\|3384014_3385976_-\|DNA-mismatch-repair-endonuclease-MutL	unknown	unknown	gnl\|CDD\|234630
NZ_CP047591.1\|WP_162363484.1\|3369701_3370499_+\|copper-amine-oxidase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377924
NZ_CP047591.1\|WP_162363485.1\|3371193_3371808_+\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP047591.1\|WP_162363480.1\|3365621_3366092_-\|DUF2156-domain-containing-protein	unknown	unknown	gnl\|CDD\|225451
NZ_CP047591.1\|WP_162363498.1\|3385968_3388629_-\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|235444
NZ_CP047591.1\|WP_162363495.1\|3381942_3383073_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|234698
NZ_CP047591.1\|WP_162363492.1\|3379355_3379778_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319924
NZ_CP047591.1\|WP_162363487.1\|3373111_3373690_+\|50S-ribosomal-protein-L25	unknown	unknown	gnl\|CDD\|235534

Protein	Function_ID	Function_description	E-value
NZ_CP047591.1\|WP_162363494.1\|3380578_3381874_-\|hypothetical-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP047591.1\|WP_162363802.1\|3371980_3372841_+\|4Fe-4S-binding-protein	gnl\|CDD\|223425	COG0348, NapH, Polyferredoxin [Energy production and conversion].	3.90532e-21
NZ_CP047591.1\|WP_162363481.1\|3366046_3367834_-\|lysylphosphatidylglycerol-synthetase-family-protein	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	1.72251e-61
NZ_CP047591.1\|WP_162363493.1\|3379820_3380561_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	5.12271e-20
NZ_CP047591.1\|WP_162363483.1\|3368772_3369573_+\|hypothetical-protein	gnl\|CDD\|377924	pfam07833, Cu_amine_oxidN1, Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.	1.817e-23
NZ_CP047591.1\|WP_162363479.1\|3364989_3365529_+\|rubrerythrin-family-protein	gnl\|CDD\|153100	cd01041, Rubrerythrin, Rubrerythrin, ferritin-like diiron-binding domain. Rubrerythrin domain is a nonheme iron binding domain found in many air-sensitive bacteria and archaea and member of a broad superfamily of ferritin-like diiron-carboxylate proteins. The homodimeric rubrerythrin protein contains a binuclear metal center located within a four helix bundle. Many, but not all, rubrerythrin proteins have a second domain with a rubredoxin-like hexacoordinated iron center. Rubrerythrin is thought to reduce hydrogen peroxide as part of an oxidative stress protection system but its function is still poorly understood.	8.09328e-50
NZ_CP047591.1\|WP_162363496.1\|3383051_3383984_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	8.87228e-149
NZ_CP047591.1\|WP_162363491.1\|3378888_3379203_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|366664	pfam01476, LysM, LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.	2.9989e-09
NZ_CP047591.1\|WP_162363485.1\|3371193_3371808_+\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.14454e-23
NZ_CP047591.1\|WP_162363482.1\|3367827_3368193_-\|hypothetical-protein	gnl\|CDD\|223469	COG0392, COG0392, Predicted integral membrane protein [Function unknown].	0.00389356
NZ_CP047591.1\|WP_162363489.1\|3374594_3375713_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	2.2169e-22
NZ_CP047591.1\|WP_162363497.1\|3384014_3385976_-\|DNA-mismatch-repair-endonuclease-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
NZ_CP047591.1\|WP_162363484.1\|3369701_3370499_+\|copper-amine-oxidase-N-terminal-domain-containing-protein	gnl\|CDD\|377924	pfam07833, Cu_amine_oxidN1, Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.	2.71462e-26
NZ_CP047591.1\|WP_162363490.1\|3375811_3378667_-\|hypothetical-protein	gnl\|CDD\|227268	COG4932, COG4932, Predicted outer membrane protein [Cell envelope biogenesis, outer membrane].	2.28293e-13
NZ_CP047591.1\|WP_162363480.1\|3365621_3366092_-\|DUF2156-domain-containing-protein	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	6.63333e-39
NZ_CP047591.1\|WP_162363498.1\|3385968_3388629_-\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|235444	PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional.	0
NZ_CP047591.1\|WP_162363495.1\|3381942_3383073_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|234698	PRK00236, xerC, site-specific tyrosine recombinase XerC; Reviewed.	7.62585e-53
NZ_CP047591.1\|WP_162363492.1\|3379355_3379778_-\|VOC-family-protein	gnl\|CDD\|319924	cd07263, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	4.92041e-44
NZ_CP047591.1\|WP_162363487.1\|3373111_3373690_+\|50S-ribosomal-protein-L25	gnl\|CDD\|235534	PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed.	7.41285e-48

>NZ_CP047591.1|WP_162363487.1|3373111_3373690_+|50S-ribosomal-protein-L25
MKDTAVIKIEKRTQCSSGENKRLRKNGYLPGNIFGRGTESTAVIVNRSELRKKISEMGRNAIFTLTLPGEKDFPVIIKEIQISPKGEELHIDFQQVSLSQEIKTDVMLKITGKEALEAQKLISTYQMDFISVKGLPQDIPDSIDIDVSDLHMGSVITVGDIKLPKGITCENNPEHIVITVNQSKIKTVEAIA
>NZ_CP047591.1|WP_162363802.1|3371980_3372841_+|4Fe-4S-binding-protein
MNNNKNFRYSIQAFWALVTNSFLIGFVQGKIYQGKIKNVCVPGLNCYSCPGAIASCPIGSLQAVIGSYEFKWSFYVAGFLIFIGAIMGRFACGWLCPFGFIQELLYKIPFVNKIKTFKGDRAMRKLKYMFLVVFVILMPIFIVDIIGQGAPYFCKLICPAGTLEGGLPLVLMNKSLQETVGWLYAWKNLLLIITIIGSVIIYRPFCKYVCPLGAIYSLFNPISVFKYHVDKEKCNNCHACSNSCKMNVDLVKNPNDLECIRCGSCKTICPTHAIEYKCLQKTSKKD
>NZ_CP047591.1|WP_162363486.1|3371823_3371976_+|thioredoxin
MHIQERHINLISLLIVLIGVSSMVFGVFRGETPVMFEKAINICLECIGIG
>NZ_CP047591.1|WP_162363485.1|3371193_3371808_+|TlpA-family-protein-disulfide-reductase
MKKLFLLLLISILTLTMFTGCSQPNNNNMNLNKNKNDTVLSAKDTIQPVASSSTPIGDFKAQDVKGNQVTKDIFSNYDLTLVNLFTTWCSPCVKEIPELNEVAKEMANKKVNVVGIVLDVNENGKIDQSKMDKLNKIIEATKADYTILLPDEVLRSGPLKGVNSVPETFFVDKNGNIVGENYLGSHTKEEWIKIINDELAKLNK
>NZ_CP047591.1|WP_162363484.1|3369701_3370499_+|copper-amine-oxidase-N-terminal-domain-containing-protein
MKKKIFMLLMAATLILSMPSFSFAQDSSIHVKVDGEVVNFDSSPFIQNNKTYIPVRGVFEKMGAKVLWNNNSKEIIVYKGRTVLVLILNNIWSVIDDRYVDADATPIMINSKTYVPVRFISEALGATVKWDQQTQTINIVQNPVDDSEKSLIPLYNIKERFTTKGLDTPPQIHIFKDTFYVPYQLSPERDRLAALEKQHNLIRGQIIAAKQCIENDKKNIIDGSGSEELLKMDEANLKELEPKLVPLTEELKKFEENILKTISTL
>NZ_CP047591.1|WP_162363483.1|3368772_3369573_+|hypothetical-protein
MKKTVLILFVVCTLILALPSLSFAQNSKIHVNVNGEAVNFDAAPFIENNVTYVPVRGVFEKLGAKVVWKNNTKEIIVYKGRTVLVLILNNRWTVINDGLVNANATPKIVNSKAFVPIRLISENLGATVTWNQQTQTINIVQNPVDDSGKSLLPLYYLKDRITRTESVSISGTGMEYPDKLLVYQPSSEEGIRLADLEAQQRLLKDQIIAAKEGIENDKKHIIDGSGTEDLLAIDEENLKQLEPKLVSVTEELKKFEESILKTVSTL
>NZ_CP047591.1|WP_162363482.1|3367827_3368193_-|hypothetical-protein
MEIIKSSQIQLVKHYRGLLKLVFAFALSALILYEGHEQIQSIHPATTLHTMRSIPLLSIGRFFILGIIASVSMVLYDVFGMKAFQFDIEKKQLFSISFLSNSLNTLLGFGGLTGLQSNHYC
>NZ_CP047591.1|WP_162363481.1|3366046_3367834_-|lysylphosphatidylglycerol-synthetase-family-protein
MLKRQNIELKETLSYNTLLVTSTITGLSFIIILSLFNFPSIASLVSQHKWLMLCLIGFSCYLLVYFFLDKMIKQLRSWACSFGVTKLLVLRFELLGVSILEWFLAGLLFYNLVYYFQRDQNFFNILSIFAVASAAGILSFMPGGVGSFDLIAIIGLQFMGLTDNEALTVVILYRVFYFILPSCVAIVNFSLQVLRRSEQKGYVIKSQIYGQLVATVMAIIVITCGLLLLISALTPSLISRSKLITNMEAVVFLQYSRSISIAIGFMLLFLAEEVFFRVKRAYNTTMILLLSGGIFTFIKGFDIEEFLFLLIAMGILRLSKTNFYRRSILVKPSHIVVVVISVPILLTIYLKISHILFTSYIKTFHYPHLIFHDVQAFIHSGILAYVLFLAFIIFWYLKRDRIEKNPLFQTLDLVKVNKFFDTNIGHHLSHLIYLGDKNLFWAEDDQVLIAYSLFSDKAVVLGDPLGEESLLSDGIQEFQRFIDTYGYRAVFYEVDEDKLSLYHDNGLFFFKLGEEAIVNLQEFDMVGSSRRSFRNIVKRFEKDGYIFEVLSPPFDDQLLYNLESISKEWLDNRKEMGYSVGWFQKDYLQKAPLPS
>NZ_CP047591.1|WP_162363480.1|3365621_3366092_-|DUF2156-domain-containing-protein
MVPKRLPTEGPLAVIRKQSNYEIIAFVSMTLQGKDSVNIGIDLMRFRSHVPNSTMDFMFIQLLLHFKELGYHYFSLGVAPLAKVGFALRSHKVEKIAHFIYEHGKLIYSFEGLRKFKDKFDPKWEPRYLAYPQLVSLPALLIELSMLVNMKKKKNI
>NZ_CP047591.1|WP_162363479.1|3364989_3365529_+|rubrerythrin-family-protein
MDFKQSQTYQNLKNAYNGERMASTKYAIYGSKAREDGYEQIGNIFDETSSNEREHAEIWLKQLNGGEVPSTLDNLKESIAGEDYEWTTMYREFSDTARKEGFDEIANLFDGVASIEYNHDNRFKQLVYNIENDQVFCKERNMVWVCLNCGNLYWGECAPEFCPVCGYPQAFYQLYVINY
>NZ_CP047591.1|WP_162363489.1|3374594_3375713_-|LPXTG-cell-wall-anchor-domain-containing-protein
METLKYTKVTDKKGTIQFGRLNSGKYKLVEVTAPVGYEIDKDSASRIIELDTSKNDTRIVTLNITNKPLLRAIQLLKTDDLGKALPGAEFTLFKKAIANENVVAKSESAVNGSVTFNNVAMGEYYIVETKAPTGYSASTAGAIIKAVVDKDGKVSYFSGENFANAVTDVPTIKNAAYKGNVIISKTDKTGSPLKGAEFTLYDENQKVVAKAVSEGDKGIAKFENIRFGNYIIKETSAPSGYIASDKVINITEKDFVKNNVEFAYTVENEKRPDGGSSGGSHNKPNNPEEKPQVNIPDEDVPLNKPTENPQKPDPVIIENQETPRGEGTIDEDKVPLGKLPATGGIGEEIFFGFGAGLVALGAGLRRKANKER
>NZ_CP047591.1|WP_162363490.1|3375811_3378667_-|hypothetical-protein
MKRDLKVRISFLLIVLMILMGMPTAAFAGSISNLNVERIEGNDVTKDIQMKVQITNNNAKVEEGDTIDPTKDMTMKVDFSIPDTLILKAGDYMQVELPDYLRFSNLHETEIYMKVGDGEVLLGNVTVSGSKAILTFADSAQNEEYSGRAGWFSAGLSFDKTKVETSEDKVVVTILGNDFTILVKDPDKGVISLKKSGNPDIANEEITWTITATPSKEDKKYEGYVLKDTLPSNTSYVKDSFEIKPSALNKDNLKIDEAQGTIEYTFDKDVKGIQTITYKTKIKDVAQNNNKDMTITNNVSLTDPDTTTSAAATVKVKPQLISKSGTYIVSNHSVDWTITVNSSKATLKNVVVTDELAPEMTLGDIIIEKNKLTNDVTKPQYYTLNGQTVKIHLGDKDKQVVIKLNTKLDNTIKAKVTNKATITWNDKGSSITGGNDGSTVLSPVDTQGQVDITSGFITKSAIGKYDFKENEMPWQITINSAQKEIKNATVVELFAYNKNEVSKINSAPNASKFDKYKGNAITLNQKYIAETLKIDGSEGIKISENAEFSQKGQYRIKTIQLNSTVEAQIVEIYLGDIEEKQEVTLNTKVTDKTAYGVNSKSTEYILKNTAYLYYGDGDGNSPLSASATEKHYSCILDKDCAVGYNYVDHTITWRLYVNHNSLNIEDGVITDTLPKYWDVNGDDFYEIYKGKDFKLGGGIATIQNGDKLTEDEVKALVKEVRVTEKDDVKTIQFEFNKISSKYVILIKTKLPNQAALDRQFAENGDVTIRNNASMIGDSINGSQGDWEDVTIKNSLVSKTGALDKDSKGNYTGDATWTIDVNRNAIHLPQKDELSKVYVIDKLQNYLEPKMENGNYKIRIWEMKLKADGSWEKADEVSQETVQSGITYKDKELRIKLPKTDGSYRIELVTRLTSDTVTEINNTASLEGVKTDIVSKNETIKIEYADGVHGQI
>NZ_CP047591.1|WP_162363491.1|3378888_3379203_-|LysM-peptidoglycan-binding-domain-containing-protein
MTNRKKSYRIKSKFRFTTSITIALILIMFMANTAFGLNNVSSLTKTNPIEIEIQSGDSLWNIACEYGPGHTDPRKTVYDICSLNNITADNIYPGQTILIPDYSK
>NZ_CP047591.1|WP_162363492.1|3379355_3379778_-|VOC-family-protein
MVQSIVHIALVVRDYDEAIEFYTKKLHFTLIEDTYQKEQDKRWVVVSPPGSLGTTILLARASKSEQEPFVGNQSGGRVFLFLGTDDFWRDYNEMKGLGIEFVRPPKEQDYGIVAVFKDLYGNLWDLVQFKENHPMFKRIK
>NZ_CP047591.1|WP_162363493.1|3379820_3380561_-|TVP38/TMEM64-family-protein
MKSISENKNKVRIRVKRMITIIKFLLLIIVIVGIPLYIMIYERAFISQFKSLDTVNAYLLKYKTASVFAYIGIQILQIVICIIPGQAMQFAAGYAYTFWLGYLYSIIGTALGTIFAFYLARFLGKDAIRLLFDEKKVTKFVDKLNSKRAFILVFVIFLIPGLPKDLFTYAAGVSEMKLKVFLIISLVGRTPAMMASIMIGSMFNKGSYVGIVILTVVMAILFIWGAKHHEKLTLMMDKWYEKLVHM
>NZ_CP047591.1|WP_162363494.1|3380578_3381874_-|hypothetical-protein
MQKNTYELLTKKMGIAPEVIKIIDESENAVSDLFTELDDIMAFNQYKVLEAFQKNKISDMHFSWNTGYGYDDPGREAIEKVYCDIFKTQAALVRPIIVNGTHALTLTLTGILRPGDELIYCTGAPYDTLEEVIGLRGEGKGSLKEFGITYNQVELTSEGNIDLEALKKVITEKTRIITVQRATGYGWRKAITIAEIEEWASFVHGINPNIVCMVDNCYGEFLDTKEPTEVGADIIAGSLIKNPGGGLALAGGYITGRADLVENISYRMTSPGIGGECGLMFGQTRTMFQGLFLAPKAVNAAVKGAILCAQAFDSLGYEVCPKASEKRSDIIEAVKLNNPEAMCAFAEGIQSAAPIDSHVKPVPWAMPGYDSDVIMAAGAFVQGSSIELSADGPLREPYIIYFQGGLTYEHSKFGVIKALQALYEKNLLKNI
>NZ_CP047591.1|WP_162363495.1|3381942_3383073_-|tyrosine-type-recombinase/integrase
MAEGKQIKIQNKTGKPENILKKEQDIYDQCKEIEQELPSFMNGFFAYLRGSVLPMTRLAYLNDIRFFCNYLIDSCMFKAEKVSELNSSNFESIRARDINTFLDFARRYQKEKENSIYIYENDNRSLARKKSSISVLFKYLFRDEILSKNITDGLDPIRVPKPGEREIKALTDEEVRLMLNTVSEGVGMTKKQLEFWKKTKKRDKAILVLFITYGLRLSELQQLNVDSFNFDRGEYKIYRKRGKESIMPINKSCELVIREYLEQERPSDDTLDEENREALFLSLQGRRMTERQIRELVKKYTAYALKTTQKSGYSPHKLRATAATSLIGRGEDIYDVQVLLDHENVTTTQLYAKHKENVKRDLVNNMEWELERKGEK
>NZ_CP047591.1|WP_162363496.1|3383051_3383984_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MNREIIIVAGPTAVGKTKYAIEIAKNFNGEIVSSDSMQLYKFMDIGSAKPTQEEQNQVKHYLVDEIDPREPFSVAEYQKRARDAIEQIFSKGKTPVISGGTGLYVNSLIYEMDFSAPPVGNEYRKKLENLAAKHGNEYVHQLLSKQDSEAAARIHPNNLKKVIRALEVAENSEQGIQPFEKSFVKTSDYAYKLIGLSRNREELYERINLRVDMLLDMGLVDEIKGLLDMGLTSDSISMKGIGYKEIIGYLNGEYDLEHAVYLVKRNTRHYAKRQITWFKRYDDIKWFNISEYNSDDEAVKEIITWLRENR
>NZ_CP047591.1|WP_162363497.1|3384014_3385976_-|DNA-mismatch-repair-endonuclease-MutL
MIKILSKNVADKIAAGEVVDRPLSIVKELVENAIDAGATNITVEIRNGGKTYIRVTDNGCGIGENEVELAFLRHATSKITTDEDLNSILTLGFRGEALSSIAAVSRVELITKTVDAKTGVSLKIHGGEVFEKSATGCPDGTTIIVSDLFYNTPARLKFMKTDATESTLIIDFISKIALAYAAIKIRLINNGTILFSTNGKGDKYSNIITVYSKSFSEGLIHISSESESMSLEGYISRPDFSKTNRKQQIFFVNGRSISNRIMDLAVQEGYTERLFEGRYPIAYLFFRIKPELVDVNIHPNKKEVRFNQDMEVKNFIAQSIKRGLLSQQAIPQVTESHITRNKIDLTPKVYDYKLEESPLKGKSIEDKGVASQHQHLQVKTIFSESNQEEVVKQKIQEAEVNEKVLNVLNENKQEIKKSEENQEQVDIKKILSTLVKEREELDYNPDHVENSVTAEQTPPTDTFFMKLNLTGTIFNTYITAVDENCFYLIDQHAAHERIFYEKLLKQYKDEEKLHQTILTPIMAEVPYAIKSTEKSWVQLLRNMGFEIEPFGTRTYIIKEIPMFMELSEAQNMVDYFLENIGEDVDIENEAKVSRIITRSCKSAVKANDVLSMAECRQLMNDLAKCENPYSCPHGRPTFIKMTKYEIEKMFKRV
>NZ_CP047591.1|WP_162363498.1|3385968_3388629_-|DNA-mismatch-repair-protein-MutS
MMQQYMEIKQNHQDCILFFRLGDFYEMFFEDAITASKEMEITLTGKNCGQEERAPMCGVPFHSADTYIAKLVDKGYKVAICEQVEDPATAKGIVKREVIQIITPGTIVNQTMLNEKENNYLASIFLNEDGAGISYCDISTGELYTTSIKDSGALEVLLNELVKIKAKEVIINETAENIVSIEEMKKVTDAYFNLLPESYHNIITANDVILKQFNIKSLVGLGLENAELSCLSLGALLSYLFETRKHNLSHITNVTVYDIGSHMSLDKATIRNLEITETLYEKNVQGSLLGVLDKTHTAMGSRKMKQWLREPLNSSSQINERLDAVEVLCDEIIIRNNIKECLKKVYDLERLAGRIACGNANGKDLIALRNSLFILPELKAEMGSLDNELFNRLNNQINSSLMEVHDLIENAIVEEPPFTIKEGGLIKPDFSKELDDLRFSIKDGQSWIAELEGKERERTGIKNLKVRFNKVFGYYIEITKSNLDLAPEDYIRKQTLVNCERFITPELKEMENLVLNAESKINQMEYEIFTEIRNNIQEYIGTIQKASSAIAVIDVLTSFAHVSSALGYVKPDVNDSGSLIITKGRHPVIEQMIKDGIFVSNDAYVNDKDSSLLLITGPNMAGKSTYMRQTALIVLMAQAGCFVPCESASVGVVDRIYTRIGASDNLAQGQSTFFVEMSELAYILNTATSKSLVILDEIGRGTSTYDGLSIAWAVVEYLCNERNKIRTLFATHYHELTALEESIPGVRNLNVDVAEENGNIVFLHKIVSGSASKSYGIHVAKIAGVPKKVLEAAENKLVGLESGQYDDESNLDFGSNVLAEKVAEQEAVTSEKKNLKYNDSSQGEQLSLFSFAPNPVIERLKSIDLMKLAPWEALKILGELQEAAND

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

625412 : 633595

Clostridium_phage(33.33%)

plate,tail,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162363646.1\|625412_626027_-\|plate	baseplate J/gp47 family protein	A0A0A7S0L4	Clostridium_phage	2.4e-47	52.5
WP_162361233.1\|625936_626452_-	hypothetical protein	E5DV64	Deep-sea_thermophilic_phage	6.8e-11	35.3
WP_162361234.1\|626448_626871_-	DUF2634 domain-containing protein	NA	NA	NA	NA
WP_162361235.1\|626870_627188_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_162361236.1\|627189_628179_-	hypothetical protein	NA	NA	NA	NA
WP_162361237.1\|628153_628588_-	hypothetical protein	NA	NA	NA	NA
WP_162361238.1\|628596_630519_-	hypothetical protein	A0A0E3Y5G6	Fusobacterium_phage	2.9e-30	35.7
WP_162361239.1\|630706_631087_-	hypothetical protein	NA	NA	NA	NA
WP_162361240.1\|631161_631584_-\|tail	phage tail tube protein	A0A2H4J032	uncultured_Caudovirales_phage	1.2e-08	27.3
WP_162361241.1\|631595_632684_-\|tail	phage tail protein	A0A0A8WJR2	Clostridium_phage	1.3e-43	33.0
WP_162361242.1\|632676_633189_-	hypothetical protein	NA	NA	NA	NA
WP_162361243.1\|633346_633595_-\|holin	phage holin	A0A1Q1PW49	Staphylococcus_phage	1.1e-09	42.0

DBSCAN-SWA_2

1841972 : 1847916

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162362243.1\|1841972_1842452_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	7.5e-28	45.9
WP_162362244.1\|1842510_1843215_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	9.6e-40	38.8
WP_162362245.1\|1843277_1844705_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.5e-55	32.6
WP_162362246.1\|1844716_1845748_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.5e-68	44.5
WP_162362247.1\|1845741_1846329_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.0e-23	37.1
WP_162362248.1\|1846383_1847916_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.4e-66	45.8

DBSCAN-SWA_3

2341908 : 2377973

Clostridium_phage(47.37%)

tail,integrase,terminase,plate,portal,head

attL 2341816:2341846|attR 2383869:2383899

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2341816:2341846	attL	NA	NA	NA	NA
WP_162362634.1\|2341908_2343063_-\|integrase	site-specific integrase	S5MNZ2	Brevibacillus_phage	3.9e-54	34.6
WP_162362635.1\|2343222_2343660_-	YHYH domain-containing protein	NA	NA	NA	NA
WP_162362636.1\|2343965_2344295_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162362637.1\|2344534_2344717_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_162362638.1\|2344727_2344934_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162362639.1\|2345041_2345314_+	stage V sporulation protein S	A0A1J0GVV0	Streptomyces_phage	4.2e-12	53.2
WP_162362640.1\|2345319_2345610_+	hypothetical protein	NA	NA	NA	NA
WP_162362641.1\|2345620_2346124_+	hypothetical protein	NA	NA	NA	NA
WP_162362642.1\|2346113_2346293_+	hypothetical protein	NA	NA	NA	NA
WP_162362643.1\|2346241_2346784_+	hypothetical protein	A0A217ER34	Bacillus_phage	1.0e-09	43.8
WP_162362644.1\|2346780_2346948_+	hypothetical protein	NA	NA	NA	NA
WP_162362645.1\|2346962_2347484_+	hypothetical protein	NA	NA	NA	NA
WP_162362646.1\|2347483_2348668_+	DUF2800 domain-containing protein	H7BVP9	unidentified_phage	4.9e-97	48.8
WP_162362647.1\|2348670_2349378_+	DUF2815 family protein	A0A0A7RVM4	Clostridium_phage	6.4e-36	47.2
WP_162362648.1\|2349374_2351348_+	DNA polymerase	H7BVQ1	unidentified_phage	1.4e-229	59.6
WP_162362649.1\|2351354_2353745_+	virulence-associated protein E	A0A0A7RTG3	Clostridium_phage	7.4e-217	46.9
WP_162362650.1\|2354306_2355707_+	DEAD/DEAH box helicase	S5MA26	Brevibacillus_phage	1.4e-146	55.6
WP_162362651.1\|2355755_2355968_+	hypothetical protein	NA	NA	NA	NA
WP_162362652.1\|2355987_2357157_+	hypothetical protein	NA	NA	NA	NA
WP_162362653.1\|2357131_2357332_+	hypothetical protein	NA	NA	NA	NA
WP_162362654.1\|2357853_2358546_+	DUF559 domain-containing protein	NA	NA	NA	NA
WP_162362655.1\|2358765_2359719_+	hypothetical protein	NA	NA	NA	NA
WP_162362656.1\|2359724_2360279_+	hypothetical protein	NA	NA	NA	NA
WP_162362657.1\|2360700_2361459_+\|terminase	terminase	A0A2H4J4R0	uncultured_Caudovirales_phage	4.2e-49	45.7
WP_162362658.1\|2362740_2364159_+\|portal	phage portal protein	A0A0A7S0I9	Clostridium_phage	3.6e-171	63.8
WP_162362659.1\|2364139_2365690_+\|head	phage head morphogenesis protein	H7BWE7	unidentified_phage	4.4e-61	31.6
WP_162362660.1\|2365893_2366205_+	hypothetical protein	NA	NA	NA	NA
WP_162362661.1\|2366652_2367303_+	hypothetical protein	A0A0A7S0J5	Clostridium_phage	3.8e-43	73.5
WP_162362662.1\|2368377_2368785_+	DNA-packaging protein	NA	NA	NA	NA
WP_162362663.1\|2368781_2369117_+	hypothetical protein	NA	NA	NA	NA
WP_162362664.1\|2369113_2369527_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_162362665.1\|2369516_2369924_+	hypothetical protein	NA	NA	NA	NA
WP_162362666.1\|2369939_2370977_+\|tail	phage tail sheath protein	A0A0A7RTT5	Clostridium_phage	9.1e-47	32.2
WP_162362667.1\|2370993_2371470_+\|tail	phage tail tube protein	A0A0A7RVP1	Clostridium_phage	1.7e-19	36.7
WP_162362668.1\|2372105_2374076_+	tape measure protein	S6AVU8	Thermus_phage	1.1e-64	31.6
WP_162362669.1\|2374078_2374750_+	LysM peptidoglycan-binding domain-containing protein	A0A0A7RVP5	Clostridium_phage	2.7e-31	36.9
WP_162362670.1\|2376023_2376416_+	DUF2634 domain-containing protein	A0A0A7RTH1	Clostridium_phage	4.0e-27	53.2
WP_162363743.1\|2376427_2377432_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	4.6e-80	48.8
WP_162362671.1\|2377433_2377973_+	YmfQ family protein	A0A0A7RUW8	Clostridium_phage	6.9e-30	38.5
2383869:2383899	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3381942 : 3446314

Bacillus_phage(18.52%)

holin,tRNA,tail,capsid,integrase,terminase,plate,portal,head

attL 3375088:3375105|attR 3440637:3440651

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3375088:3375105	attL	NA	NA	NA	NA
WP_162363495.1\|3381942_3383073_-\|integrase	tyrosine-type recombinase/integrase	A0A2R2ZHE2	Clostridioides_phage	1.3e-09	25.2
3375088:3375105	attL	NA	NA	NA	NA
WP_162363496.1\|3383051_3383984_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_162363497.1\|3384014_3385976_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.0e-67	31.0
WP_162363498.1\|3385968_3388629_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	3.5e-50	25.2
WP_162363499.1\|3388679_3389879_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_162363500.1\|3392657_3393554_-	polyprenyl synthetase family protein	A0A1V0SE37	Indivirus	4.4e-05	23.4
3391602:3391619	attR	NA	NA	NA	NA
WP_162363501.1\|3393568_3393763_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
3391602:3391619	attR	NA	NA	NA	NA
WP_162363502.1\|3393765_3394977_-	exodeoxyribonuclease VII large subunit	A0A1V0SC03	Catovirus	2.5e-40	30.0
WP_162363503.1\|3394967_3395936_-	hypothetical protein	NA	NA	NA	NA
WP_162363504.1\|3395941_3396349_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_162363505.1\|3396352_3396736_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
WP_162363506.1\|3396866_3397514_-	SpoIIIAH-like family protein	NA	NA	NA	NA
WP_162363507.1\|3397506_3397722_-	hypothetical protein	NA	NA	NA	NA
WP_162363508.1\|3397764_3397932_-	hypothetical protein	NA	NA	NA	NA
WP_162363509.1\|3397945_3399040_-	stage III sporulation protein AE	NA	NA	NA	NA
WP_162363510.1\|3399226_3399667_-	Fe-S cluster assembly scaffold protein NifU	A0A2H4N7M4	Lake_Baikal_phage	1.2e-29	54.5
WP_162363511.1\|3399673_3400843_-	cysteine desulfurase NifS	H7BUW1	unidentified_phage	4.9e-41	39.6
WP_162363512.1\|3401082_3401529_-	hypothetical protein	NA	NA	NA	NA
WP_162363513.1\|3401607_3401817_-	DUF896 domain-containing protein	NA	NA	NA	NA
WP_162363514.1\|3401861_3402419_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	1.6e-37	45.4
WP_162363515.1\|3402804_3404178_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.9e-05	28.1
WP_162363803.1\|3404381_3405194_-	sporulation transcription factor Spo0A	W8CYM9	Bacillus_phage	4.0e-05	30.7
WP_162363516.1\|3405320_3406412_-	SpoIVB peptidase	NA	NA	NA	NA
WP_162363517.1\|3406427_3406877_-	hypothetical protein	NA	NA	NA	NA
WP_162363518.1\|3406920_3407646_-	hypothetical protein	NA	NA	NA	NA
WP_162363519.1\|3407733_3408420_-	DUF2344 domain-containing protein	NA	NA	NA	NA
WP_162363520.1\|3408412_3410254_-	TIGR03960 family B12-binding radical SAM protein	NA	NA	NA	NA
WP_162363521.1\|3410263_3410518_-	hypothetical protein	NA	NA	NA	NA
WP_162363522.1\|3410619_3410796_-	hypothetical protein	NA	NA	NA	NA
WP_162363523.1\|3410854_3411112_-	hypothetical protein	NA	NA	NA	NA
WP_162363524.1\|3411214_3412510_-	GTPase ObgE	NA	NA	NA	NA
WP_128745471.1\|3412599_3412860_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_162363525.1\|3412942_3413305_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_162363526.1\|3413459_3414548_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.2e-118	65.7
WP_162363527.1\|3415316_3415856_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_162363528.1\|3415858_3417208_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_162363529.1\|3417360_3417537_-	hypothetical protein	NA	NA	NA	NA
WP_162363530.1\|3417739_3417952_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162363531.1\|3418057_3418306_-\|holin	phage holin	H9A138	Staphylococcus_phage	2.6e-08	39.5
WP_162363532.1\|3418302_3418572_-	hypothetical protein	NA	NA	NA	NA
WP_162363533.1\|3418583_3419324_-	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_162363534.1\|3419366_3419600_-	hypothetical protein	NA	NA	NA	NA
WP_162363535.1\|3420216_3420618_-	hypothetical protein	NA	NA	NA	NA
WP_162363536.1\|3420631_3421186_-	hypothetical protein	NA	NA	NA	NA
WP_162363537.1\|3421200_3422106_-	hypothetical protein	NA	NA	NA	NA
WP_162363538.1\|3422117_3422648_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_162363539.1\|3422647_3423730_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	7.1e-42	34.5
WP_162363540.1\|3423872_3424202_-	hypothetical protein	NA	NA	NA	NA
WP_162363541.1\|3424216_3424582_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_162363542.1\|3424582_3425593_-\|terminase	terminase	NA	NA	NA	NA
WP_162363543.1\|3425595_3426018_-\|portal	phage portal protein	NA	NA	NA	NA
WP_162363544.1\|3426034_3427696_-	hypothetical protein	A0A218KCH0	Bacillus_phage	2.2e-26	30.8
WP_162363545.1\|3427927_3428365_-	hypothetical protein	NA	NA	NA	NA
WP_162363546.1\|3428382_3428799_-	hypothetical protein	A0A090DCP2	Clostridium_phage	2.1e-10	32.6
WP_162363547.1\|3428821_3429913_-\|tail	phage tail sheath protein	A0A0A8WJL8	Clostridium_phage	1.1e-45	32.8
WP_162363548.1\|3429927_3430371_-	hypothetical protein	NA	NA	NA	NA
WP_162363549.1\|3430383_3430788_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_162363550.1\|3430797_3431130_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_162363551.1\|3431141_3431432_-\|head,tail	phage gp6-like head-tail connector protein	A0A075KJE2	Lactobacillus_phage	3.7e-22	56.8
WP_162363552.1\|3431587_3432766_-\|capsid	phage major capsid protein	A0A2P1CCA5	Lactobacillus_phage	4.9e-97	50.8
WP_162363804.1\|3433347_3434535_-\|portal	phage portal protein	A0A075KQ80	Lactobacillus_phage	3.4e-98	47.7
WP_162363553.1\|3437161_3437533_-	HNH endonuclease	A0A0D4DD69	Staphylococcus_phage	1.9e-07	39.5
WP_162363554.1\|3437817_3438375_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	9.2e-38	46.7
WP_162363555.1\|3438553_3439540_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J4W0	uncultured_Caudovirales_phage	2.5e-22	40.3
WP_162363805.1\|3439574_3439778_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162363556.1\|3439860_3440130_+	CRISPR-associated protein Cas2	A0A0N9STP5	Staphylococcus_phage	3.4e-14	44.2
WP_162363557.1\|3440092_3440284_-	hypothetical protein	NA	NA	NA	NA
WP_162363558.1\|3440317_3440590_-	hypothetical protein	NA	NA	NA	NA
WP_162363559.1\|3440608_3441139_-	hypothetical protein	NA	NA	NA	NA
WP_162360752.1\|3441171_3441357_-	hypothetical protein	NA	NA	NA	NA
WP_162363560.1\|3441376_3441769_-	hypothetical protein	Q24LD2	Clostridium_phage	1.1e-16	40.7
WP_162363561.1\|3441831_3442341_-	hypothetical protein	NA	NA	NA	NA
WP_162363562.1\|3442337_3443171_-	DUF4373 domain-containing protein	A0A0H4TKJ7	Bacillus_phage	2.9e-11	35.5
WP_162363563.1\|3443260_3443635_-	hypothetical protein	NA	NA	NA	NA
WP_162363564.1\|3443665_3443884_-	hypothetical protein	NA	NA	NA	NA
WP_162363565.1\|3443914_3444106_-	hypothetical protein	NA	NA	NA	NA
WP_162363566.1\|3444118_3444511_-	single-stranded DNA-binding protein	S5MNH0	Brevibacillus_phage	9.7e-26	45.3
WP_162363567.1\|3444503_3445487_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_162363568.1\|3445510_3446314_-	ParA family protein	H7BUL8	unidentified_phage	5.2e-42	39.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP047591

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection