CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	0 crisprs	RT,PD-DExK,DinG	0	0	0
NZ_CP048286	Paenibacillus sp. 14171R-81 chromosome, complete genome	15 crisprs	csa3,WYL,DEDDh,DinG,RT,cas3	5	7	4
NZ_CP048288	Paenibacillus sp. 14171R-81 plasmid unnamed2	0 crisprs	cas4	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048286_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_1

1674607-1674727

Orphan

Consensus_repeat	Method
AAGTTTCAGTCCTGGTGAAACGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP048286_1

>merge|NZ_CP048286|1|1674607-1674727|CRISPRCasFinder
AAGTTTCAGTCCTGGTGAAACGCGAACCGCCATTCTTTTGGCGGCGGTACAAGTTTCAGTCCTGGTGAAACGCCAATCACCATCCTAACTGGTGATGCAAGTTTCATTCCTTCCGAAAATA

>NZ_CP048286|1|1|1674607-1674727|CRISPRCasFinder
AAGTTTCAGTCCTGGTGAAACGC	GAACCGCCATTCTTTTGGCGGCGGTAC
AAGTTTCAGTCCTGGTGAAACGC	CAATCACCATCCTAACTGGTGATGC
AAGTTTCATTCCTTCCGAAAATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162639573.1\|1675979_1676210_-\|alpha/beta-type-small-acid-soluble-spore-protein	unknown	unknown	gnl\|CDD\|365990
NZ_CP048286.1\|WP_162639577.1\|1678789_1679794_+\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP048286.1\|WP_162639563.1\|1667620_1668064_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639564.1\|1668312_1669524_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP048286.1\|WP_162645123.1\|1680100_1682014_-\|beta-propeller-fold-lactonase-family-protein	unknown	unknown	gnl\|CDD\|274824
NZ_CP048286.1\|WP_162639566.1\|1670439_1671384_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP048286.1\|WP_162639571.1\|1674204_1674501_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639575.1\|1676558_1677545_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|234866
NZ_CP048286.1\|WP_162639562.1\|1666391_1667561_-\|transglutaminase-domain-containing-protein	unknown	unknown	gnl\|CDD\|376628
NZ_CP048286.1\|WP_162639569.1\|1673144_1673567_+\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NZ_CP048286.1\|WP_162639574.1\|1676327_1676504_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639576.1\|1678238_1678553_-\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NZ_CP048286.1\|WP_162639568.1\|1672065_1672929_-\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
NZ_CP048286.1\|WP_162639570.1\|1673606_1674227_+\|spore-coat-protein-GerQ	unknown	unknown	gnl\|CDD\|370609
NZ_CP048286.1\|WP_162639565.1\|1669863_1670235_+\|DNA-primase	unknown	unknown	gnl\|CDD\|224572
NZ_CP048286.1\|WP_162639572.1\|1674818_1675805_+\|metal-dependent-hydrolase	unknown	unknown	gnl\|CDD\|377294
NZ_CP048286.1\|WP_162639567.1\|1671387_1672008_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266
NZ_CP048286.1\|WP_162639579.1\|1684345_1685272_+\|permease	unknown	unknown	gnl\|CDD\|223773
NZ_CP048286.1\|WP_162639578.1\|1682063_1684091_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224250
NZ_CP048286.1\|WP_162639580.1\|1685284_1685617_+\|DUF1980-domain-containing-protein	unknown	unknown	gnl\|CDD\|370431

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162639573.1\|1675979_1676210_-\|alpha/beta-type-small-acid-soluble-spore-protein	gnl\|CDD\|365990	pfam00269, SASP, Small, acid-soluble spore proteins, alpha/beta type.	9.21172e-25
NZ_CP048286.1\|WP_162639577.1\|1678789_1679794_+\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	5.60275e-72
NZ_CP048286.1\|WP_162639576.1\|1678238_1678553_-\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	3.08004e-22
NZ_CP048286.1\|WP_162645123.1\|1680100_1682014_-\|beta-propeller-fold-lactonase-family-protein	gnl\|CDD\|274824	TIGR03866, PQQ_ABC_repeats, PQQ-dependent catabolism-associated beta-propeller protein. Members of this protein family consist of seven repeats each of the YVTN family beta-propeller repeat (see TIGR02276). Members occur invariably as part of a transport operon that is associated with PQQ-dependent catabolism of alcohols such as phenylethanol.	3.99019e-30
NZ_CP048286.1\|WP_162639566.1\|1670439_1671384_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.04758e-29
NZ_CP048286.1\|WP_162639564.1\|1668312_1669524_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.85637e-35
NZ_CP048286.1\|WP_162639575.1\|1676558_1677545_-\|tryptophan--tRNA-ligase	gnl\|CDD\|234866	PRK00927, PRK00927, tryptophanyl-tRNA synthetase; Reviewed.	0
NZ_CP048286.1\|WP_162639562.1\|1666391_1667561_-\|transglutaminase-domain-containing-protein	gnl\|CDD\|376628	pfam01841, Transglut_core, Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.	3.70544e-23
NZ_CP048286.1\|WP_162639569.1\|1673144_1673567_+\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	3.59955e-38
NZ_CP048286.1\|WP_162639568.1\|1672065_1672929_-\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	1.06039e-125
NZ_CP048286.1\|WP_162639570.1\|1673606_1674227_+\|spore-coat-protein-GerQ	gnl\|CDD\|370609	pfam09671, Spore_GerQ, Spore coat protein (Spore_GerQ). Members of this protein family are the spore coat protein GerQ of endospore-forming Firmicutes (low GC Gram-positive bacteria). This protein is cross-linked by a spore coat-associated transglutaminase.	6.3541e-55
NZ_CP048286.1\|WP_162639565.1\|1669863_1670235_+\|DNA-primase	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.33119e-16
NZ_CP048286.1\|WP_162639572.1\|1674818_1675805_+\|metal-dependent-hydrolase	gnl\|CDD\|377294	pfam04307, YdjM, LexA-binding, inner membrane-associated putative hydrolase. YdjM is a family of putative LexA-binding proteins. Members are predicted to be membrane-bound metal-dependent hydrolases that may be acting as phospholipases. It is a member of the SOS network, that rescues cells from UV and other DNA-damage. Expression of YdjM is regulated by LexA.	1.17786e-30
NZ_CP048286.1\|WP_162639567.1\|1671387_1672008_-\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	1.59538e-40
NZ_CP048286.1\|WP_162639579.1\|1684345_1685272_+\|permease	gnl\|CDD\|223773	COG0701, COG0701, Predicted permeases [General function prediction only].	1.43764e-56
NZ_CP048286.1\|WP_162639578.1\|1682063_1684091_-\|hypothetical-protein	gnl\|CDD\|224250	COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones].	0.000626878
NZ_CP048286.1\|WP_162639580.1\|1685284_1685617_+\|DUF1980-domain-containing-protein	gnl\|CDD\|370431	pfam09323, DUF1980, Domain of unknown function (DUF1980). Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function, has not, as yet, been defined.	1.51563e-08

>NZ_CP048286.1|WP_162639571.1|1674204_1674501_-|hypothetical-protein
MFICFVEYRIDSAAELTYREWIAEKQDEFPGFKLFEGTDQPLLFVEVWEAPNVEEAERIKKERCGERSSWRDMADWVPGGSAKIHAWTFKPINGRAER
>NZ_CP048286.1|WP_162639570.1|1673606_1674227_+|spore-coat-protein-GerQ
MSNGYGYNTAVSPASTGGFPGYGYGGGFQQPVATPFPAQMPTQMNAQQIPMQMPVQMPVQMPVQMPVQSPMVAGASTQPPNIPSGSFVTPAGGNIVAVPVTEESYVENILRLNRGKMATFYMTYENNREWNAKVFRGIIEAAGRDHIIISDPSTGMRYLLLTLNLDYVTFDGPINYEYTFNGVTISNTTAMPTTGTTTTTTAPLGR
>NZ_CP048286.1|WP_162639569.1|1673144_1673567_+|cell-wall-hydrolase
MAVIKTNSEQTKLLARLLRAEAEGEGELGMLMVGNVGVNRVLGNCIDFKNIRTIQQMVYQSPGGFEATQKGYFYQSARDSEIALAKRVINGERRWPATNALWYFRPAGNCPATWWDQRLVDKFKSHCFYAPKASECPAVY
>NZ_CP048286.1|WP_162639568.1|1672065_1672929_-|protoheme-IX-farnesyltransferase
MLKDYVALTKPGIIRLNAIAAFGGFWVASKWDIDWLLLLYMLIGSALTMASACVINNYWDRELDTKMERTKNRALPTKRLNPTGVLIYGIVLGIIGVTVLFTLVNPLTGWLGLLGFFVYVVIYTMWLKRTSTWSTSIGGVSGAMPPVIGYCAVTGVVDEGAWILFALLFLWQPAHFWSLAIRRVEEYRAAGFPLLPVVKGIPRTKLQMLPYILLLIPTGILMFAYDYVGYTYLIISLVCGIVWLVHTIMGIRATDTTKWARTNFLISINYLMVVFLIMIADTNGAIG
>NZ_CP048286.1|WP_162639567.1|1671387_1672008_-|SCO-family-protein
MHVIRKYGFAIAVLLLCAAMGLYLYLSSTKGSDVKLDNIMNAPSFSLNDLDNNKVTLDDTNGKVRVVYFFYANCPDICPPTTALMTQVQNKLKDKGTFGKDVDFLWVTFDPKRDTTEALKSYSSKFDIDTSGWKFLREDNAEETEKLMRDFGLSLLKDEKSNTFTHTDTITFVDRKGVVRKYMTGSIDESQNADKITDVINALVKE
>NZ_CP048286.1|WP_162639566.1|1670439_1671384_-|AEC-family-transporter
MAIFVSILWNNVIPLSVMIALGITLHRVFSLDIKTLSKLNFYLFSPAMIFNLLYSTDISFPVMFKVLLFFFLFMILMYGCVEAVIRIRKTPNAMKGAVRNSILFYNSANYGIPLNQLAFASNPYTLSVQVLIMMMQSLLPNTYGIYNVNSHKLQAREIVRTILGLPVIYAIPVGLLMHNLHVPIPLALSTPLGYLANAFIGIALITLGVQLGSMKLTFRHPKLKDVLISCALRLIGGPLLALAVVWLLRTNSYTDIDSLMAKALIVSSCVPTSLSSVLLAVEFDNEPEFASQVVLLSTTLSIVTVTAVIYLLHI
>NZ_CP048286.1|WP_162639565.1|1669863_1670235_+|DNA-primase
MDIVLIVEGKNDRSRLRRVLQEEVPILCTYGTPGTQQIEKLRRQAGDGQVYIFTDNDASGRRIRGMLRDAFPDAEHIHTRRGYPGVEKTPEEYLIEQLEKAGLEAYILYPPQSAAQWSKEDGI
>NZ_CP048286.1|WP_162639564.1|1668312_1669524_+|MFS-transporter
MRTAIWLYLFLFVAFFDLHAQYPILTPFAVSLGAAPSFIGLMMGLYSITHLPGNLIAGFGVDRFGSRLFIVFSLGAAGGILLLQSHVTNPWQLLTLRSISGFVLAFLSPACMSLLARIATSRVKQRKLMAGNGLVHTLASVVSPAAGAYLVAQIGFTTAFSVLGWVLIVTAVCALFFIRDVPMQSALPIGSLHQAKAQAELIGMRGEEAKKERPPAIPWLIFLLPIAMSCAQGILSFELPLMSTTKEGMMTTGLLFSIVSLGALFTLSLLFLNKISPFLRSLWGAFLLALTYFAIAAGAPLPFYLLLFFLGMAKGVIFPALSSLLIERSGGERYGRIFSILSIAFSIGAFLGPMLAGQLRNYVSPYYIAFVGLMIAVAVLPFFADSNRTRDARDAGAHFSHTG
>NZ_CP048286.1|WP_162639563.1|1667620_1668064_-|hypothetical-protein
MSFDFNYDTDTWVQFFQDKWLILVIALVVLLLVVRVVKTVVKWLLVVAILAGVVVYSGYSLEDVKSIGTKVADSVKQEAIAAMAGEAKDATFTYNDDGTFTVSTKNLELNGTPGDGEVKVSFRGTSLGTWKIDATIQSLIDQAKKNV
>NZ_CP048286.1|WP_162639562.1|1666391_1667561_-|transglutaminase-domain-containing-protein
MHTWVQTLLKPEPVALMVVLILLVSLFSGMRRGASGSAKHLFFFIWQAATVVVSLLLAGRGAVYASPFVRDWLIDRGITVPKEDLSALKQFWFTAVTSLRDFDLLRFGVLFLLLYSVLRLLLHALEPFVFGLVDGVLARGRAGRGRMAESPLISGTASRTTGAMIGALLGGGRAFIVMACLFVYVSILPHAYGTDIIRASALYTKTASELLNPVAGDVLKQGPVFTEAVEAEFRHVLERKYDVIDAAIPPNIEEAAAAVTKNSSTDEQKARALYSWVGTRIAYDWDKADNYTEHGIWKEQTPTETFTTRKGVCIDVARLYAVMARSAGLEVRVVTGEGATGDGGYGPHAWNEVKLTDAGGEWIPLDATWASSGDWFNPDGFSKSHIRDA
>NZ_CP048286.1|WP_162639572.1|1674818_1675805_+|metal-dependent-hydrolase
MDSGTHLVFGIGLAGLASIDPAVASDQTLYAAVLLGTVIGSQAPDLDGLLRLKSNAAYIRNHRGASHSIPAIAIWAVVITLLIETIFRFSPSWLHLGGWVLLAVCVHVFSDLFNTYGTQAARPFTQKWISWNIIHIFDPVIFVSHLIAITLWALRIGDPTIIFPLLYAFLIVYYIWRTVTHKALQKRLVQLDPGYQNGDQFILIPTISLYDWNVVKRRPDGRFFIGDFRQGKLRWIDDAKCEEHPAIDRSRNDPSIRAFLYFTSFACAEVQEHPWGYEVRWSDVRYRHRKQYPFVGVLVMDKEFKTLGSYVGWLSDERLQKRLRMNTY
>NZ_CP048286.1|WP_162639573.1|1675979_1676210_-|alpha/beta-type-small-acid-soluble-spore-protein
MAGRNSNSNTLVVPQASAALSQLKYEAAQELGIQIPQDGYYGNFSTRDAGSLGGYITRKLVQIAEQQLSGGSSQFR
>NZ_CP048286.1|WP_162639574.1|1676327_1676504_+|hypothetical-protein
MSKPMALFFSILSVLLMCATAISISYNGWVALLFSLLTIFSIGAGFIVNAKMRRRRQG
>NZ_CP048286.1|WP_162639575.1|1676558_1677545_-|tryptophan--tRNA-ligase
MRRVLSGIQPSGQLTLGNYIGAIQNFVKLQDTHECYFMVVDLHAITVPQEPAALREQTESVAALFIAAGIDPAKASVFAQSHVSAHAELGWLFTTLAYMGELERMTQFKDKSTGKDSVGAGLFVYPTLMAADILLYNADLVPVGDDQKQHLELTRDLAQRFNQRFGDLFTIPEPYIPKVGARIMSLDDASKKMSKSNPNPASYIALLDPPDVIRKKISRATTDSGRDVLFNPAEKPEVSNLMSIYMHCADMTLEEIQAKYEGQGYGAFKKDLAEAVVAKLEPIQKRYADIRNSGEIHDILKQGADNVSTVANDMLRSAKEKMGFLLPR
>NZ_CP048286.1|WP_162639576.1|1678238_1678553_-|DUF2087-domain-containing-protein
MQDQAIKNEKLKQSVLRNFITEQGSIVHLPSQLKKRLIVLEHLANQLDARKKYSEKEINAFIKPLNEDFATIRRELFIHKFVNRENDIYEVNESKEWRDWKTLG
>NZ_CP048286.1|WP_162639577.1|1678789_1679794_+|YihY/virulence-factor-BrkB-family-protein
MASPWSTPGSESKTAGSGSTKPVGARSVPTAQPSKKRGRMGMLSFSKHLYCRFQDDDVQAMGAQLTYYLILSFFPFLIFIIAVLSFADLTVNDVIDRIRPVMPQVSTKTISDAFTEIQNSRSGSLLSLGLLVTLWSASSGVGAVMKALNKAYDVEETRPFWKVKAYALLFTIVLALVIVFSLAMLIFGRVTGDMLYKQTRLPGNLDAIWSVAQFVLPVAVMAIVFAALYLYVPNLRLRFREVIPGALFATFGWIITSLAFSFYVNNFGNYSKTYGSIGGIIVLLTWLYLSSIVIVVGGEINAVLHFDRHGKSKEYNKQFSIPIPFFNRNKKQKH
>NZ_CP048286.1|WP_162645123.1|1680100_1682014_-|beta-propeller-fold-lactonase-family-protein
MALLSGCSHSGDSASPAPQSGSSIVMSKDGDTLYIANGDTNTVSVVDAKERKVKKEISVGKEPRELALSADGSTLYVTCRYANSVEWVDIDKGTVLGTVKTGIEPYGIVESPDGKLLYVTNYRSGTVAVVDTESRAVLKEVKAGTNPRAVAIAADGGKLYVSDYLTSATTIFDTASMDPLSAKKLADSPDLPDRKKSQGKPNTVEQLRLTPDGKSLWEAHLLTNTDTPVQFEEVIFPALSVVDAQTGQEDAKSRKELFKAIDVKDKFGKTIIVSNPTDIVFSPDGNKAYALMGGSEDLLVFDIARGGRAGQIIHHLPGDLPIGMVMSKDGGSLYIHNSSSHDLTVVTLPPADEEGGQARVDGKPLKLIGQDRLNAQQRLGKTLFYSANSDDFALTGSNWMSCASCHSDGEVDQLSIMTAKGPRNIPSNVLAFETGLFMWDGSRDEFDDYIHTVQGEMGGLSDVDPAKPLPADAKKLFDALKAYMTMPDAFPVPQSPFRTEDGQLTADAERGKAIFEGKAQCVMCHAADVMTDSVKATGSDGKLTTDNTSFLHNVGTVNSADVDYGGDARGAFSNKRERGLFDTPTLRGVYATAPYLHDGSAATLEDVIKRAGDEHGHTSDLSEKEISDLVSYLKQIQ
>NZ_CP048286.1|WP_162639578.1|1682063_1684091_-|hypothetical-protein
MNWSKRTTGAAAISALLACSVALTACDDNDVHVKVSDYNFDTAGNMFAYAEFELSGEPLAESLGVDLDVLDAGKIDQPTAFDYKAGIESYEYSEEAMYEVVEKSGLGLHLANGPATAEEAKQAGVSNNELLASRFQHMAESVGQPAEDIQQNMFPTFIEYASGDPEYNQDVDTAKFADGEDGAYIPNYQVNFASLRWNRDKMKKQLIPAAYGGTMLKQSLWAGDFLGNLHDAKSDEEVDASTAKEGSEDDQGLKLGVSSVDGMQGMILTDEVWNKLLYVRDNLFYNPANKNIGTLANAQGGYLPHAVDVEENGDKDFTAAKSLKVSDDRSLLQDQWLMLWPTSEFFGMTDQRTANPNRNPAFARVFDGDPFPAAPAVNVDADDSNDIASTDPYTVTRDVLLSVFDNVKNRHWNDKAGAFVTESNGDKQGTEVDTFEAGYTIEALRMFERAIDGLPVGYASGEAAEGLKTEQGAAAKEMIQKQADFILNTLINKDGLAVTGYDTAKGKANSDTTLKAQIGAIRGLTSAFLVTEDEKYRDAARKLYVAMDEKLWDNDLKAYKTNGKEANYDAFTAGGVSAVFRLALEHLKNTSGDTDAPKALEQNAIQDRYVSFFRQVINGPTLDEGMQASEFWDTGDVYKEGDDSGNTDGDTVPQPQKGHGDHGIAPILLPVKITK
>NZ_CP048286.1|WP_162639579.1|1684345_1685272_+|permease
MHEFQHIFISIIIEAFPFILLGVLVSAVLQVFVSDRLIAQLTPRNPIAGVLFGSLLGLLLPLCECGMIPIVRRLIRKGMPAYIGMVFIFAGPIINPIVFVSTFNAFRAEPSIAYARMGLAFAVCILLGMVLYAFMKRNPLKLGLQSFVSQGSRLPDDDNYQYNHGHVNGGIQDRIQATFTHASEELFDIGKYLIIGAFITALAQSALDPSLLHQVSGSPALASLFMMAAGFVLSLCSTSDAFVASSLHGIFGPGALLAFLVFGPMVDVKSLLLLFAAFRSKIVVVIVAFLIAAVWIGSMLTEKLVFGI
>NZ_CP048286.1|WP_162639580.1|1685284_1685617_+|DUF1980-domain-containing-protein
MITLSTKQRRNIVHHLIRCGILGAFGLYIVYLARTGTLVLFVEPNLAVPVKLSAIGLFATAIYQFQSAVQEWQGIEAAACDCNHEPPRSLLANLVVYTLFLLPLAIGIIF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_2

1826668-1826743

Orphan

Consensus_repeat	Method
TGTAGTGTACGGGGTGCAGCTCTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_2

>merge|NZ_CP048286|2|1826668-1826743|CRISPRCasFinder
TGTAGTGTACGGGGTGCAGCTCTTTCTCGTTTTTCGCTGCGTTTTCGAGTATGTAGTGTACGGGGTGCAGCTCATT

>NZ_CP048286|2|2|1826668-1826743|CRISPRCasFinder
TGTAGTGTACGGGGTGCAGCTCTTT	CTCGTTTTTCGCTGCGTTTTCGAGTA
TGTAGTGTACGGGGTGCAGCTCATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162639697.1\|1834383_1834899_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP048286.1\|WP_162639686.1\|1819942_1820575_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP048286.1\|WP_162639682.1\|1814742_1816764_-\|YhgE/Pip-domain-containing-protein	unknown	unknown	gnl\|CDD\|224428
NZ_CP048286.1\|WP_162639689.1\|1822824_1823319_-\|zinc-ribbon-domain-containing-protein	unknown	unknown	gnl\|CDD\|237756
NZ_CP048286.1\|WP_162639694.1\|1831301_1832192_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162639685.1\|1818767_1819883_+\|UDP-N-acetylglucosamine--LPS-N-acetylglucosamine-transferase	unknown	unknown	gnl\|CDD\|340861
NZ_CP048286.1\|WP_162639691.1\|1825228_1826152_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841
NZ_CP048286.1\|WP_162639688.1\|1822382_1822619_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639699.1\|1837191_1838193_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176217
NZ_CP048286.1\|WP_162645136.1\|1834985_1836239_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|349941
NZ_CP048286.1\|WP_162639683.1\|1817377_1817968_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP048286.1\|WP_162639693.1\|1828794_1831164_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379971
NZ_CP048286.1\|WP_162639690.1\|1823535_1825158_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|237894
NZ_CP048286.1\|WP_162639700.1\|1838264_1839212_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176196
NZ_CP048286.1\|WP_162639696.1\|1833210_1834287_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274934
NZ_CP048286.1\|WP_162639698.1\|1836326_1836968_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379658
NZ_CP048286.1\|WP_162639687.1\|1820777_1822061_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|366353
NZ_CP048286.1\|WP_162639695.1\|1832230_1833004_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227604
NZ_CP048286.1\|WP_162639692.1\|1826826_1827993_+\|virulence-factor	unknown	unknown	gnl\|CDD\|379361
NZ_CP048286.1\|WP_162639684.1\|1818184_1818571_-\|kinase	unknown	unknown	gnl\|CDD\|378054

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162639697.1\|1834383_1834899_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	6.51961e-09
NZ_CP048286.1\|WP_162639686.1\|1819942_1820575_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	4.27579e-22
NZ_CP048286.1\|WP_162639682.1\|1814742_1816764_-\|YhgE/Pip-domain-containing-protein	gnl\|CDD\|224428	COG1511, COG1511, Predicted membrane protein [Function unknown].	4.7476e-108
NZ_CP048286.1\|WP_162639689.1\|1822824_1823319_-\|zinc-ribbon-domain-containing-protein	gnl\|CDD\|237756	PRK14559, PRK14559, serine/threonine phosphatase.	5.07019e-05
NZ_CP048286.1\|WP_162639694.1\|1831301_1832192_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	6.77163e-26
NZ_CP048286.1\|WP_162639685.1\|1818767_1819883_+\|UDP-N-acetylglucosamine--LPS-N-acetylglucosamine-transferase	gnl\|CDD\|340861	cd17507, GT28_Beta-DGS-like, beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	3.52776e-82
NZ_CP048286.1\|WP_162639691.1\|1825228_1826152_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	3.50897e-91
NZ_CP048286.1\|WP_162639699.1\|1837191_1838193_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176217	cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.	3.6709e-30
NZ_CP048286.1\|WP_162645136.1\|1834985_1836239_-\|amidohydrolase	gnl\|CDD\|349941	cd08021, M20_Acy1_YhaA-like, M20 Peptidase aminoacylase 1 subfamily, includes Bacillus subtilis YhaA and Staphylococcus aureus amidohydrolase, SACOL0085. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine). This family includes Staphylococcus aureus amidohydrolase, SACOL0085, which contains two manganese ions in the active site, and forms a homotetramer with variations in interdomain orientation which possibly plays a role in the regulation of catalytic activity.	9.82223e-135
NZ_CP048286.1\|WP_162639683.1\|1817377_1817968_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.2145e-11
NZ_CP048286.1\|WP_162639693.1\|1828794_1831164_-\|hypothetical-protein	gnl\|CDD\|379971	pfam17389, Bac_rhamnosid6H, Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.	2.37252e-25
NZ_CP048286.1\|WP_162639690.1\|1823535_1825158_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
NZ_CP048286.1\|WP_162639700.1\|1838264_1839212_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176196	cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.	6.08069e-41
NZ_CP048286.1\|WP_162639696.1\|1833210_1834287_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274934	TIGR04036, family_protein, putative luciferase-like monooxygenase, FMN-dependent, CE1758 family. This tightly conserved subfamily of the bacterial luciferase-like monooxygenase (LLM) family, with members showing > 60 % pairwise sequence identity, includes proteins from both species with and species without the ability to make coenzyme F420. Therefore, the like cofactor is FMN rather than F420. The presence of three members in Kineococcus radiotolerans SRS30216 and two in Saccharopolyspora erythraea NRRL 2338 suggest closely related (subfamily) rather than exactly conserved (equivalog) function. Gene neighborhoods around members are not conserved. [Unknown function, Enzymes of unknown specificity].	9.18713e-94
NZ_CP048286.1\|WP_162639698.1\|1836326_1836968_-\|thioredoxin-family-protein	gnl\|CDD\|379658	pfam14595, Thioredoxin_9, Thioredoxin.	5.07316e-29
NZ_CP048286.1\|WP_162639687.1\|1820777_1822061_-\|C40-family-peptidase	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	5.70131e-20
NZ_CP048286.1\|WP_162639695.1\|1832230_1833004_-\|hypothetical-protein	gnl\|CDD\|227604	COG5279, CYK3, Uncharacterized protein involved in cytokinesis, contains TGc (transglutaminase/protease-like) domain [Cell division and chromosome partitioning].	6.79382e-21
NZ_CP048286.1\|WP_162639692.1\|1826826_1827993_+\|virulence-factor	gnl\|CDD\|379361	pfam13769, Virulence_fact, Virulence factor. This domain is found in conserved virulence factors. It is often found in association with pfam02985 and pfam08712.	3.49936e-25
NZ_CP048286.1\|WP_162639684.1\|1818184_1818571_-\|kinase	gnl\|CDD\|378054	pfam08810, KapB, Kinase associated protein B. This bacterial protein forms an anti-parallel beta sheet with an extending alpha helical region.	2.36964e-49

>NZ_CP048286.1|WP_162639691.1|1825228_1826152_-|MBL-fold-metallo-hydrolase
MRYTNSDPAAVPKTFREVRQWRRQRGGKMKDKDYSYQVPFVDPDLVYLHGNSTEPTLTWVGHSTFFMQLAGLNIITDPIWAEKLAFHRRLTRPGISAADVPPVDVILISHSHYDHLNIASLKQLTGSKVLIVPVGLADKLRRKGFSSIIELDWWQSAEVSGVKFTFVPAQHWTRRTLVDTNSSLWGGFVIECKDAPTVYFAGDSGYFDGFKQIGMRFPDIDVALMPIGAYDPEWFMGPQHVTPEEALKAFRDTGARCFVPMHYGSYKLADDTPREALDRLEAEMNRLRLTAETVRILPHGETWQLKK
>NZ_CP048286.1|WP_162639690.1|1823535_1825158_-|ATP-binding-cassette-domain-containing-protein
MISTSGITLRYGKRALFEDVNIKFNPGNCYGLIGANGAGKSTFLKILSGEVEQSHGEVHITPGERIAVLKQNHYEYDNFLVLETVIMGHKKLYEVMKEKDAIYAKAEFTDEDGMRAGELEAEFADMNGWEAESEAAGMLNGLGIPPELHDKQMAELSGNEKVRVLLAQALFGNPQILLLDEPTNHLDMQSIEWLENFLGSYEGTVIVVSHDRHFLNQVCTHIADIDFGKIQMYVGNYDFWYESSQLALTLMRDNNKKKEDKIKELQAFIQRFSANKSKSKQATSRKKLLDKISLDDIRPSNRKYPFIHFKPEREAGKQLLLTDGLTKAIDGTKLIDNLTIAINKGDKIALVGPNTLPKSLLFQLLMGEVEADAGTYQWGITTTQAYFPKDNAEYFDGVELNLVDWLRQYSKDQDESFIRGFLGRMLFSGDEALKKASVLSGGEKVRCMLSKMMLSGSNVLLMDEPTNHLDLESITALNNGLIDFDGTLIFTSHDHQFVQTIANRIIEITPNGIIDRIMTYDEYLESAEVKALRERMYPAE
>NZ_CP048286.1|WP_162639689.1|1822824_1823319_-|zinc-ribbon-domain-containing-protein
MSFFDKVKQGASDAAKKAQQTVEITKMKAQISGKEKDIERLCAQIGAAVYRGHQAGDIASTEQEVMECCHQADELHTEIKLLEERIKLTRNEKTCTCGKVVTLETRFCPDCGASLAEEPKAAHTTVGEIVVICNQCHTENELNAKFCVSCGAGLNSGSAAEEVY
>NZ_CP048286.1|WP_162639688.1|1822382_1822619_-|hypothetical-protein
MLVPVESKQIAFCSYNEDESSLYLYYHTGDVAIFSSIGKQEYQSVIDSPNRYDTLMNLMKKGQTEGPLPELYEEFEQN
>NZ_CP048286.1|WP_162639687.1|1820777_1822061_-|C40-family-peptidase
MKKSTALLATLVLSASLLLLAAASAATASQTVGQVQSSVSFRSLPSTSSTVYKYLKQGEQVVILEQVNAYWYKVQDVTGAIGYISADDKYIEIVASGSNGSSAANSATIAASVSFRTGPSTDNARIRYLSKGEKVTITGQPNSSWYAVTAADGTKGYVSSDPQYITVNGTITQPGGSTSGGSGAATGNATIVASVSFRTGPSTDNARIRYLSKGETVTITGQPNSYWYAVTAADGTKGYVSTDTQYIKVTGSIPSGNNTGNSSGGNASGGTGGSNSGSSDQAVIIERVIAAGMKYWGTPYEYGSDRNTTTTFDCSDFVRTAYREGANLTLPSDSRKQGDYVRNLGSVKTDWHQLKRGDLMFFMDSKGTSAAAYANVNKAAETITHVGIYLGDGQILHTYSTASGGVKTSVIAGSQWEYRFLFGGSVL
>NZ_CP048286.1|WP_162639686.1|1819942_1820575_-|class-I-SAM-dependent-methyltransferase
MTEIWESSFIENQMMWGFEPSESAILIKDLFLAKNVKDILIPGFGYGRNAKIFMDNGIRVTGIEISQTAIDLARKAGLANPVFHGSVSDMPFDDKQYDGIFCYALIHLLNKDEREKFIQACYNQLKPGGTMVFTTISKDAPMYGKGKQLGKDYYEIMDGMKMFFYDAESVDQEFGKYGQIDCSEIVEPHKNAENKPAFPFIMIKCHKELG
>NZ_CP048286.1|WP_162639685.1|1818767_1819883_+|UDP-N-acetylglucosamine--LPS-N-acetylglucosamine-transferase
MHKKRVLLLSEGFGSGHTQAAYALAVGLRSLDSSIQTRVIELGNFLNPVLGPLIVSAYRRTVTKQPKLLGRLYRRQYKKSLNRFTQLALHRLFYTHTSQVITQLKPDLIVCTHPVPNAVVSRLKRLGLTTPLYTLITDYDAHGTWTSSEVNKYLVSTNEVKNKLLERGISASRIQVTGIPVHPNFWQTHDKSELQAQFDLKPMPTVLIMGGGWGIMYSDDLLSYMTRWRDRVQLIYCVGSNEKVRERMLADPVYQHPNIKVLGFTKEINKLMDVSDLLITKPGGMTCTEGLSKGIPMLFYEPIPGQEEVNCEYFVASGFGEMLESRDTIDRWFELMQEPYSSVKFRNDLLTKRNQQYNPMECSRVVLQLMQ
>NZ_CP048286.1|WP_162639684.1|1818184_1818571_-|kinase
MQEQQRRIPELGAIVAFTNKTGRYAGEVMEINGPRALVKVLAVLKHPEQGDLHNPYNPDVPMFHERRALSYTEKTNVLFGEIEPFYGEVPDYKESRARALAAEIEGLDRLKRWAERGLDALRTLEKEY
>NZ_CP048286.1|WP_162639683.1|1817377_1817968_-|TetR/AcrR-family-transcriptional-regulator
MTGTKKPVDRRAQIVEAAGKSFAMFGYKATTMELVSKIAAVGKGTIYTFFATKEELFSEIIGELAKELREIADRTIDHDRPFFDNLSAALHELLLFREKHELIVKLSQEVRDFGTPMAKDGIAKLEQAIVAVLEQEVSYAIRKGELRSANPKMTAFVMLKLYLALGTEWSKHQEPLTRGELADYFSGLMRDGLLQR
>NZ_CP048286.1|WP_162639682.1|1814742_1816764_-|YhgE/Pip-domain-containing-protein
MQGLSLFGKELSRIVRNPKLLIPILGILFIPIMYSGMLIGAFWDPYGKLDKMPVAVVNADAGADFKGKPLSVGADLVKELKANPSFKWTFVDAKQAEDGLKNGNYYYVIEIPSEFSQQATTLLDKEPHPAALKYLTNDSENFLAAKIGASAIEKLQTDISQQVTKAYAEAVFGSIGEAADGFTQASEGAGKLADGAKDAEQGAAQLRDNIAKLASSTKQLVGGVDALGSGAGQLKAGTAAVSDGSAKLSAGLGKLAAAGERLGDGADSAVSAGAKLADGLASAQQSSADLAGAAAKLSAALDAYAAAQEGAAREDSALQGLIGAARELSAGAAGLSGGSAKLAAGGAQLQQGQRSLQQGLDALHAQLAAAAQSGAELSAGAKTAAAGAAKLADGAAAAGRGAAQLSGGADKLASGSAALASGASQLAGGSAELSGKLGYAASQTEGVIGTDALYDMFANPVHVEERKLTNVPNYGTGFAPYALSLGLFVGALLSTMVVPMRETGTKPRSAWSWFVSKALLFAGVGVIQALIADAILLYGIGMHANHMGAFVGMSVLTSIAFMMIIQFLVTLLDQPGRFVSVILLILQLTGSAGTYPPELVPAWLQRIGVWLPMTYAIRSFREILTGNELQTTGGNAAFLAVVAILFAALSLIVFVMMRRKEQRQTAVPSELAL
>NZ_CP048286.1|WP_162639692.1|1826826_1827993_+|virulence-factor
MKLIGIEPTPSPNTMKLNVDEKLAPNQRLSYAPADASGAPEPLRSLLAIEGVRGLFRTADFIALDRKPGADWERILTAARALLQSGEAGGAGNVGGPGAADAFGEAHAFVQLYRGIPMQVRVRTPGGESRAAMPAAFTEAVTRAAAASMIRERKLEELGVRYGEPEEIAAELVRELEAAYPQERLEVLVEAALALGASAEGEAPPAVRPAPLTAAQLTERLADADWSVRYEALNRTAPTPEMLPLLAQAIADDNASIRRLAVVYLGELRLPESMPLLFAALRDASASVRRTAGDTLSDLGDPAAVGPMIEALRDRNKLVRWRAARFLYEAGDDTAVEALEQAASDPEYEVSLQARIALERIQRGEEAAGSVWQQMTRSREGGDGGTVE
>NZ_CP048286.1|WP_162639693.1|1828794_1831164_-|hypothetical-protein
MEHRHTWTAAWIWPSGDSNNGSARKQQRTFFRKSFLVANPAESKLRVEVTADSKYRLYVNGTFVLRGPCKGDDFSQYYDTIDLVPFLREGSNVIAVEVVHYPRILVGGPSEGGPMSEWRSDIGGLWLQGNLQDKNGEVLEKLDTDGSWLMTGSAAVHIQRETQTLFVGGTEEVQGSLIPADWRQAEFDDSSWGVCGRPIEPLDRFWGQLLPWQLKPRPIPELRETERSFTRIMRASGIKGDADVNAIFPLRLNPGESVWLELDAGLLTTGYVQLDVFEGGGGQIDLLYAEAYEYEHPEEHGGQKKTVRDDPEGKILIGNEDRYSPAGWGRPGKPETYEPMGRRAFRFVRAVLKAGDEPLTLASLRWRATSYPLQELGGVRTSDPLTDDMWRISLNTLRNCMQDTYEDTPYYEQMQYIMDAKSQALFTYSVSGDDRLARKTIYDFHSSLIPSGMLQSRYPSVDRQVIPGFALYWVQMVHDHYAHFGDAAMVRRYLPTIDAVLGWFDRLVEDGLVGYIPEPYWAFVDWVEAWHPTAGAPPARMHGALTAYNLMYAMTLQQGAVLNESAGRTDTAAEYRARAQAVNEAVLAACYDEESGLFRDGPSVAMFSQHSQLWAVLSGAVEGEAAGELMDRMLARTDLAAASFSMSHFLFRALAKAGRYGRTEQLWQVWKDQIALGLTAWVEDPVHQRSDNHAWSSLPLYEYPAETLGVKPARPGFASIRIEPKPAGQTWAEGVVPTLQGEVRVRWVIAGSKFVLDAEVPAGVPVVVVLPDGTVHEQDQAAFRVECSV
>NZ_CP048286.1|WP_162639694.1|1831301_1832192_+|AraC-family-transcriptional-regulator
MTEETKFTQAQFIHPEERIRIHHLNNDIYQSVSWHKHDFVELFYVRSGKAVHRLNEKTFRAGAGDVFVIQAGDMHAFEPITPHFEWIDCMFMPAFIDYDVRTLLSSRKYFASDGMEIEYLMQTMLREYEDKKPAYLTKLRGYLLALLAELGRQGEQDEGVDYVKRKKTRLLQEAIEYVHLHYRDKIKLDDAAGKLGISRSSLNRLFRSQLHDSFAGFVNAYRLEQCSSLLRSGDAPIRDAALECGFVDGKHFRTQFRRRFGMTPGEFRKAAISGDGGTTMLAETDYGPQQPLAIPR
>NZ_CP048286.1|WP_162639695.1|1832230_1833004_-|hypothetical-protein
MLRWLIRLGIAAILITGLGSQFYGIGMASSEQTLDQLRASIFTQLEERKTDISFDYVGDRQELSAQIGSLLREVFAEDDYAAYNVDAYLYTIRTWNGAAKINLSVTYRESAEEMAVVDGKIRELLPGILKDAVGEQQQARAIHDWIVTHVAYDTNLEHYTAYDALTSGTAVCQGYSLLAFRMLELAGFETRIVEGSVDSGSHVWNLVKVNGRWYHMDATWDDPVPDRAGQTSYAYFLKTDAQMKQDHRWTKPYPAAG
>NZ_CP048286.1|WP_162639696.1|1833210_1834287_-|LLM-class-flavin-dependent-oxidoreductase
MKIAVFSLIMNMPNAVTGESLTPLAKISNVLRQAILTESLGFDAYGIGERHGAPFLSSSPPVMLAAIAASTSRIRLLTTVTVLSVLDPVRVAEDYATLDHLSRGRLELVIGKGNDPRHYPLFGIAEEDQWESLAERYGLLRRLWDEENVSWEGRFRPKLAGVTTQPRPLQQPIPVWHGSASSTLSTELAAKYGEPIFSSNAFHPMAKYKALIDHYRERWAHYGRDPKDAVVGAGSGSLYIARTPEEALRRFRPYYEAMQATAAAQHNQSPFRDLEDAIANGPALIGSPESVIEKILAYREAFGNGVLSISVDGLTEDEQREQLAWFAEEVAPVLRREAPSKVWEKRPSAGAVEELPIQ
>NZ_CP048286.1|WP_162639697.1|1834383_1834899_-|GNAT-family-N-acetyltransferase
MSEQYRLAAEADAERLLAITYDAYVTIRELELHWPAANADLALIVDNVRTNDCYVLEVDGDIKATVTLSKGNELKGLTDLPFLKWFAVDPACQGQGLGGKLLDWVERTVTEQLQVSGVTLATAEKHPWLLPMYERRGYERFYAFDPGNGDGMMHLLRKTVHPGRLQASPSS
>NZ_CP048286.1|WP_162645136.1|1834985_1836239_-|amidohydrolase
MTLNALFDGAGKPAEAAAYEREVEAETIRLRRDFHRHPETMFGVDRTAAEVAKQLIAYGLEVEQGVGKHFGKGVVATLRGSRPGRTVLLRADMDALPIQEQNEAPYRSASDGVMHACGHDAHMAMLLGAANMLSRYRGELAGTVKFAFQPAEEGALPIEDGSMVSGGRDMIEDGLLDDVDLCFALHVWPELPLGTVGVHRAYAMAASTHFRVAFQGVSGHHGTPHLAVDALLMAAQFVTEMKVAMASEINPLEPGVLSFGTLRAGTALNAIAENSEITGSYRVFEEETVLRVRDAIVRRSSAIAASFGGGSEARFRLGTALKNDPRAAQLALTAGTAVFGAERALALEQPSLAGEDFALYLKKVPGAFAFLGSGTPACKQPLHHPNFDIDERMLLAGAKLHVRFVLEAMASNDVQER
>NZ_CP048286.1|WP_162639698.1|1836326_1836968_-|thioredoxin-family-protein
MAGFPKNRISRERQEQALRESLSFGDFIESAQANRETLRENYAAYELNEQDLDFFAELEKPVVVLALAHDWCGDVAANLPLFARLEQATGKLNLRIIPRDPGNRDIADLYPYKDGQSRIPTYLFFSEAGEELGYFIERPDDITVLLKVWQEQFWTTHPELEGRGKPFGELAEDVRGALLADLKTRRQEVRNLEKSAILGHIRGILSPQAERAV
>NZ_CP048286.1|WP_162639699.1|1837191_1838193_-|zinc-binding-dehydrogenase
MKAEAVVFDDRERVSFKHVEVPEPGEHDVVVEVEYSWISIGTESSYLRGERISGEVPYRPGDPWPFPQVAGYQKVGVATRVGSAVTHIRPGDRVFATVSRIEGMFFDYAGHVNPAVTDGRQVWKLPEGDVPAVAYAGAVLTQVGYNCGSRPPVERGDTAVVIGDGLVGQWAAQTLHARGAAVCMLGRREDRLRLAEAGGYARPLHTRAVDPAEELRSAGVSIGIVVDTVGSLETFRALQPLMKHDSHLVSAGYLGERGGIDIQTLREQEITLHTPSGWTTPRMDETIRGIAEGWLKTEPLITHRFPASEAAAAWQLITAKGSPCLGVILEWGS
>NZ_CP048286.1|WP_162639700.1|1838264_1839212_-|zinc-binding-dehydrogenase
MKALQITGMGEYGIVDIPVPAIMDDQVLVKLTLVSTCPRWDIAMLGGKDMFDHSRPPAYPLPPGFPGHEAVGVVEAIGASVQGLKPGDRVAALEHLFPGQGAYAQYLAYRERDLLKLPDSVSDKKAVSSELLKCVVFGLDQFEEVKGRSMLVAGLGPAGILAIQVASLWGARVIGIDVSAERVAAVNALGIGEAVLTDSLGDRTFDLGYDCVGAAASVQNVLDRTNEHVVIFGVLRGELTYRDRFWFNGIKLESFKGRPVTERYRRLLLDALTRPDFNTECLQTKQISFANYAEGVETLKQQQAVKICFNPQEAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_3

1848473-1848548

Orphan

Consensus_repeat	Method
ATTCGCCGAAACTTGCCGGATACGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_3

>merge|NZ_CP048286|3|1848473-1848548|CRISPRCasFinder
ATTCGCCGAAACTTGCCGGATACGCCGCATGTAATGCACCCCGTACATTACATTCGCCGAAACTCGCCGGATACGC

>NZ_CP048286|3|3|1848473-1848548|CRISPRCasFinder
ATTCGCCGAAACTTGCCGGATACGC	CGCATGTAATGCACCCCGTACATTAC
ATTCGCCGAAACTCGCCGGATACGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162639701.1\|1839482_1840295_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP048286.1\|WP_162639702.1\|1841219_1842089_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|381314
NZ_CP048286.1\|WP_162639708.1\|1850053_1850998_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP048286.1\|WP_162639710.1\|1852834_1853710_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374209
NZ_CP048286.1\|WP_162639713.1\|1855938_1858158_-\|copper-amine-oxidase-N-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|377924
NZ_CP048286.1\|WP_162639699.1\|1837191_1838193_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176217
NZ_CP048286.1\|WP_162639698.1\|1836326_1836968_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|379658
NZ_CP048286.1\|WP_162639715.1\|1860651_1861173_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|379237
NZ_CP048286.1\|WP_162639714.1\|1858532_1860566_-\|Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP048286.1\|WP_162639700.1\|1838264_1839212_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|176196
NZ_CP048286.1\|WP_162645136.1\|1834985_1836239_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|349941
NZ_CP048286.1\|WP_162639712.1\|1854802_1855756_-\|aminoglycoside-phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|366736
NZ_CP048286.1\|WP_162639704.1\|1842600_1843518_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|366736
NZ_CP048286.1\|WP_162639711.1\|1853891_1854746_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
NZ_CP048286.1\|WP_162639705.1\|1843655_1845767_-\|right-handed-parallel-beta-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|379079
NZ_CP048286.1\|WP_162639707.1\|1849105_1850035_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NZ_CP048286.1\|WP_162645137.1\|1852243_1852771_+\|DUF3502-domain-containing-protein	unknown	unknown	gnl\|CDD\|378792
NZ_CP048286.1\|WP_162639709.1\|1851176_1852355_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270298
NZ_CP048286.1\|WP_162639703.1\|1842323_1842533_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639706.1\|1845998_1848344_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162639701.1\|1839482_1840295_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.38475e-32
NZ_CP048286.1\|WP_162639702.1\|1841219_1842089_+\|oxidoreductase	gnl\|CDD\|381314	cd19088, AKR_AKR13B1, AKR13B family of aldo-keto reductase (AKR). Xylella fastidiosa phenylacetaldehyde dehydrogenase is a founding member of aldo-keto reductase family 13 member B1 (AKR13B1). phenylacetaldehyde dehydrogenase (EC 1.2.1.39) catalyzes the NAD+-dependent oxidation of phenylactealdehyde to phenylacetic acid.	2.36717e-148
NZ_CP048286.1\|WP_162639708.1\|1850053_1850998_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	6.89426e-57
NZ_CP048286.1\|WP_162639710.1\|1852834_1853710_-\|hypothetical-protein	gnl\|CDD\|374209	pfam15902, Sortilin-Vps10, Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.	1.03244e-06
NZ_CP048286.1\|WP_162639713.1\|1855938_1858158_-\|copper-amine-oxidase-N-terminal-domain-containing-protein	gnl\|CDD\|377924	pfam07833, Cu_amine_oxidN1, Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.	1.14384e-13
NZ_CP048286.1\|WP_162639699.1\|1837191_1838193_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176217	cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.	3.6709e-30
NZ_CP048286.1\|WP_162639698.1\|1836326_1836968_-\|thioredoxin-family-protein	gnl\|CDD\|379658	pfam14595, Thioredoxin_9, Thioredoxin.	5.07316e-29
NZ_CP048286.1\|WP_162639715.1\|1860651_1861173_-\|acetyltransferase	gnl\|CDD\|379237	pfam13523, Acetyltransf_8, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	4.93805e-13
NZ_CP048286.1\|WP_162639714.1\|1858532_1860566_-\|Na+/H+-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	6.58137e-91
NZ_CP048286.1\|WP_162639700.1\|1838264_1839212_-\|zinc-binding-dehydrogenase	gnl\|CDD\|176196	cd08234, threonine_DH_like, L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation. THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.	6.08069e-41
NZ_CP048286.1\|WP_162645136.1\|1834985_1836239_-\|amidohydrolase	gnl\|CDD\|349941	cd08021, M20_Acy1_YhaA-like, M20 Peptidase aminoacylase 1 subfamily, includes Bacillus subtilis YhaA and Staphylococcus aureus amidohydrolase, SACOL0085. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine). This family includes Staphylococcus aureus amidohydrolase, SACOL0085, which contains two manganese ions in the active site, and forms a homotetramer with variations in interdomain orientation which possibly plays a role in the regulation of catalytic activity.	9.82223e-135
NZ_CP048286.1\|WP_162639712.1\|1854802_1855756_-\|aminoglycoside-phosphotransferase-family-protein	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	1.82624e-08
NZ_CP048286.1\|WP_162639704.1\|1842600_1843518_-\|phosphotransferase	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	8.55545e-06
NZ_CP048286.1\|WP_162639705.1\|1843655_1845767_-\|right-handed-parallel-beta-helix-repeat-containing-protein	gnl\|CDD\|379079	pfam13229, Beta_helix, Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.	2.47828e-13
NZ_CP048286.1\|WP_162639707.1\|1849105_1850035_+\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	2.55793e-110
NZ_CP048286.1\|WP_162645137.1\|1852243_1852771_+\|DUF3502-domain-containing-protein	gnl\|CDD\|378792	pfam12010, DUF3502, Domain of unknown function (DUF3502). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 140 amino acids in length. This domain is found associated with pfam01547.	9.43658e-46
NZ_CP048286.1\|WP_162639709.1\|1851176_1852355_+\|hypothetical-protein	gnl\|CDD\|270298	cd13580, PBP2_AlgQ_like_1, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	1.4809e-23
NZ_CP048286.1\|WP_162639711.1\|1853891_1854746_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	1.3792e-30
NZ_CP048286.1\|WP_162639706.1\|1845998_1848344_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.46549e-21

>NZ_CP048286.1|WP_162639706.1|1845998_1848344_+|helix-turn-helix-domain-containing-protein
MKMLHFYKSKRYLLRMLLSITILLVILLSLSSAVIHYSAEHRVLQMQQEANRKVMSQINHNMTFMQEIVNNISLSLYNDERFYFPLMSNSAQEDIDIIYSINQLNKVMDSQSFLHSILVYNGHNDKTYALGPLADWMEESYMTSRLVDMIKKPEKLPQLQLIPMNFSGRPHAVDFFSVIIYESFNNVNDHESAIVLNVKPEWVFDNLKVVNGFSAPNASSIFLMDKDGGFILSGEEKNLPELNDLSYALSRDQSGNDESFGFFSHKFRGSGNSIVSYLQMGIPGWKVIGVQPYNAVLGGISQMRETFAIVIASFLLLAVVVSFALAHKLYRPIEALLSRITRHGGVTEHAPEPIHDELAYVGRVYGQMAEKLIVVTDEKEKQKDIVRHSYLRSILTSSSSFSRHQFESCIDKYGLGVDPAGPFLVAVAKVDDYAAVLSRTNESERRLYAFAVTNIAGEILVPLKISCEMVDARGDHLVLLLSGGALGAELPELPDLLRRLQDIMLDYYKLSLSLSFSVISRSHDTITDQYADALHYSMYKIVHGRRSLLTPDLVRPNAAHTEHAVSSDMEKKLTEAIKTNDLSAMEASADHLLASLRDCHYDSIIHGALHVVDVIKTTIREINQNRISSLPVDLSTLSRQVLDEETLVDISALIQSALRDIHDKRRGAEQDTNAALVDAIKDIIDNHYADMNLSLQGISATLKMTSAYVGRLFKQSELVSVGEYLNEVRLTRAREYLETKNFSIKEIMELVGYVNESTFFKLFKKKYGVTPKEYRLKSNIG
>NZ_CP048286.1|WP_162639705.1|1843655_1845767_-|right-handed-parallel-beta-helix-repeat-containing-protein
MEYFVKCIEGGAAEDGSRERPWSSIAKARDAVRRDRSAGYAGQVTVWIGEGRYMLDGPLAFDAGDSGAGEEGRTIYRAMPDASPVISGGRLLKEWEPAGDGLYRCFVGAEALRDCGHTLFENGERACEARSPKQGYHVVAGKWDGGNGSGFRFKRGDFPPIADAAACGLKVFIWPGEGEWNWFSETKPVAAVDWEQDTVAFHDPAPWGIDQGSRYRMQGARELLTEPGEWYRDAREGYVYYMPRTLPIEEQDIILPFMKSVIAIRGGEGRPDSGAGRIDNGGDRLDTSGSKDGIVRHLEFRGLTIEMSDFVPAYRMPVSNREREEAREGLIRIDNAADIVIADCNLRHAGLSGIVLNGHCKEIRIENNRIERLGFNGIYAIGFAPGEGGFGSASESDVNGGHAVVGNRIRSGGELIGHGTGIQLYQSGGCAIEGNVIHGFPRYGISLKGLRYKAMDPSYYGTTVTWDNHWTFLHARNNTIARNDISDVMKDSQDGGMFEAWGAGLGNRIVDNRFHDSGIYFSVGYGIYLDDAADGFLVARNVLHDMYSEGKGKLWFAIFAKGIGNVIENNLLVRNAAKAAIGTQEMAGEPNRDLTVRRNIVIDSGEQLYHFINWNDARLAEADGNLFFRSGGEAPTVSGFYGGDTYGKIPIPWEEWRAFLGGRFDANTIAVDPMLEEPVRGQFRFGPDSPVWGLGWQALDTED
>NZ_CP048286.1|WP_162639704.1|1842600_1843518_-|phosphotransferase
MPDKGKLIAELLLVAEKAGLTEIAPIELSSGGNLIVHLAPHPVVARIAIVLSQEDEDAAYRLLERELRAARHLHARGVPVLLPTDDMDAGPRDIGGIWTTFWKYAAPAPLQPPSPGEAVELVHALTLAMEDFACEIPQLGVWERTCQSAARLMDHADERVQALLKRFVQVDKRMRLETKLFPCHGDAHRGNLLPSPEGWIWADFEDLSRMPAYWDLASWVANPALFGGVEEPTFRYIWNRLDNRTELEAFGFAITARILMSTLGNLDFALAGNGDLDFAMQQLALAGDFLTQIELLISYGNGTPV
>NZ_CP048286.1|WP_162639703.1|1842323_1842533_-|hypothetical-protein
MKCLNCNSKNIGKIGKQHYYCWDCCIEFTVHAEKLDLYQVEKDGTVSSLNDLFIEEIRNYADQQAMSPA
>NZ_CP048286.1|WP_162639702.1|1841219_1842089_+|oxidoreductase
MTNQQPTAALSGTYAIGGDLTVNRLGYGTMQLTGPGVWGDPKDPEEAVRVLQRTAELGVNFIDTADAYGPFTADLLLHKALHPYKDDLVIATKAGLTRSGPNDWRPVGRPEYLRQQALLSLRHLGLERIDLFQLHRIDAKVPLEEQIGELAKLREEGIIRHIGLSQVSVAEIKAASEIAPIASVQNLYNLSNRESEDVLNYCEANDIAFIPWFPLATGALAKEGGPLDAIATKYEAKPSQIALAWLLKRSKVMLPIPGTSRVAHVEENIAAAGITLSDEDFAALSALAK
>NZ_CP048286.1|WP_162639701.1|1839482_1840295_+|helix-turn-helix-transcriptional-regulator
MKIRQNGFAEVVGGVGGRAGGVHPYCELLCILDGEADLEWSGVAYKADGLALFVILPNTPHQLVQRSHALRYWYAEFHADDADPLPAVDVIYKWNGLQGGIDWEADPYPALRAALHAAGMLMKAERSLPWDMFGEALASDLRKLLVLISSIAAARKPAPVHTSGEVVVSETMRFLESVFPQPLTLQTIADYTHYNPSYLVRLFRKQTGLTPFSYLNELRLNAASEYLQHSPMTVQQISQACGFQSIHYFSRTFKKRFGVAPSEWRRVRRG
>NZ_CP048286.1|WP_162639700.1|1838264_1839212_-|zinc-binding-dehydrogenase
MKALQITGMGEYGIVDIPVPAIMDDQVLVKLTLVSTCPRWDIAMLGGKDMFDHSRPPAYPLPPGFPGHEAVGVVEAIGASVQGLKPGDRVAALEHLFPGQGAYAQYLAYRERDLLKLPDSVSDKKAVSSELLKCVVFGLDQFEEVKGRSMLVAGLGPAGILAIQVASLWGARVIGIDVSAERVAAVNALGIGEAVLTDSLGDRTFDLGYDCVGAAASVQNVLDRTNEHVVIFGVLRGELTYRDRFWFNGIKLESFKGRPVTERYRRLLLDALTRPDFNTECLQTKQISFANYAEGVETLKQQQAVKICFNPQEAF
>NZ_CP048286.1|WP_162639699.1|1837191_1838193_-|zinc-binding-dehydrogenase
MKAEAVVFDDRERVSFKHVEVPEPGEHDVVVEVEYSWISIGTESSYLRGERISGEVPYRPGDPWPFPQVAGYQKVGVATRVGSAVTHIRPGDRVFATVSRIEGMFFDYAGHVNPAVTDGRQVWKLPEGDVPAVAYAGAVLTQVGYNCGSRPPVERGDTAVVIGDGLVGQWAAQTLHARGAAVCMLGRREDRLRLAEAGGYARPLHTRAVDPAEELRSAGVSIGIVVDTVGSLETFRALQPLMKHDSHLVSAGYLGERGGIDIQTLREQEITLHTPSGWTTPRMDETIRGIAEGWLKTEPLITHRFPASEAAAAWQLITAKGSPCLGVILEWGS
>NZ_CP048286.1|WP_162639698.1|1836326_1836968_-|thioredoxin-family-protein
MAGFPKNRISRERQEQALRESLSFGDFIESAQANRETLRENYAAYELNEQDLDFFAELEKPVVVLALAHDWCGDVAANLPLFARLEQATGKLNLRIIPRDPGNRDIADLYPYKDGQSRIPTYLFFSEAGEELGYFIERPDDITVLLKVWQEQFWTTHPELEGRGKPFGELAEDVRGALLADLKTRRQEVRNLEKSAILGHIRGILSPQAERAV
>NZ_CP048286.1|WP_162645136.1|1834985_1836239_-|amidohydrolase
MTLNALFDGAGKPAEAAAYEREVEAETIRLRRDFHRHPETMFGVDRTAAEVAKQLIAYGLEVEQGVGKHFGKGVVATLRGSRPGRTVLLRADMDALPIQEQNEAPYRSASDGVMHACGHDAHMAMLLGAANMLSRYRGELAGTVKFAFQPAEEGALPIEDGSMVSGGRDMIEDGLLDDVDLCFALHVWPELPLGTVGVHRAYAMAASTHFRVAFQGVSGHHGTPHLAVDALLMAAQFVTEMKVAMASEINPLEPGVLSFGTLRAGTALNAIAENSEITGSYRVFEEETVLRVRDAIVRRSSAIAASFGGGSEARFRLGTALKNDPRAAQLALTAGTAVFGAERALALEQPSLAGEDFALYLKKVPGAFAFLGSGTPACKQPLHHPNFDIDERMLLAGAKLHVRFVLEAMASNDVQER
>NZ_CP048286.1|WP_162639707.1|1849105_1850035_+|sugar-ABC-transporter-permease
MIKTRKPRSEWYYLKKNSELLLLLLPGALLVLVFAYVPMFGVLLAFKDFRYDLGFWDSPWVGFHNFKFFFVSDTAAMITRNTVVYGLTYMLLTTVIALLFAILMNEMGKRWLRIHQTAMFIPYCLSWVVVSYLALALLDSQNGYLNKLLETLGFSTHMWYLETAPWPYILISAYLWKNVGFSTLVYFAGIMGINQEYYEAAKIDGASRWQMATKITLPLLSTLITVLLILAIGHIFVGDFGLHYFIPNDSGMTFPTTDIIDTYVYRALRVNGDIGMSTAVGLYQSIVGLVLVVVANFVVRKINEENSLF
>NZ_CP048286.1|WP_162639708.1|1850053_1850998_+|carbohydrate-ABC-transporter-permease
MNTTPQALAAESASVRATGERREPFTIVSLLSHLLFILVTLAMVLPFVLVISISFTDESSIIEHGYLFIPADFSTKAYTYIFEAPTVLVRAYGITILTTVIGTLLSLLVTAMLGYVTSRRDFRYRTPASFFVFFTMLFNGGLVPSYILVKQYLHLDNTIWSLILPFLVSPFYIMVMKGFLSKIPFEIIESAKMDGAREIRIFFTIILPLSTPALATLGLFLSFGFWNSWFPALLYIDNEKLIPIQLLLVRMMQKLEFLTSNSDFISQFGMDMSKFPSLSARMAMAILAGGPMVCIFPFFQKYFVKGLTVGSLKG
>NZ_CP048286.1|WP_162639709.1|1851176_1852355_+|hypothetical-protein
MKVWRISMAPLVLASLMIMLLVSACGNNNNSNTNAPAADNNNNAAATNTTNATNTPDTTTTTNTDTTDATNDPAPAEEPPVELTYYYIVYDMPADQQAVEDAVNAYIKPKINATIKLKPIIESGYKDKINTMLAAGENFDLLWTSNWGGGDYDNKVAKGALLPLDDLLNNAPALKDAIPQVAWDDTRVDGKIYGVPNMQIAAKAEGFAIQKRFIEKYNIDVNSIHSQMDIEPVLKTIHDNEPDIIPIASTSNMFDFGRQYGYAAQGYKLGDPNYTIIDTVDKPEYKTFLDTMRRWYTSGYIYKDAATMKDDQLVALLGSGKVAVEWNTTMKPGGEVDDKKRFGNNDVVYVRVSEPEFTGVRATMNSISRTSKNPEKALEFLQLTSTPPRSSI
>NZ_CP048286.1|WP_162645137.1|1852243_1852771_+|DUF3502-domain-containing-protein
MHRRPRNDELHQPHVQESGESARVPAIDVDPPALFNLITFGIQDKHYKIVGDNTISINQDGGYKTDQGWVFGNVLIGYLKEGQAPDTWERTKQLNETAKRPEVNGFNFNTEPYKTESVNIFAVSEQYGKALNTGSVDPAKILPKYQSALKKAGVEKQTAEMQKQLDEWLKANGKK
>NZ_CP048286.1|WP_162639710.1|1852834_1853710_-|hypothetical-protein
MKRTVILIALPLLFFASILLSGCSSGERQAPERIAPAANDEQTLSAPAPAPPPVPAPSPSPTMEAAPVLENASPSSDPQAPEPDYRRSETFTLNDANAWTADYWATVGMHTEDMKLSRSTDGGKTWTTVADTSVPGSTLPLGGTKVGFMFLTPVVGWLALNSPLDDTVQVYRTEDAGRSWSLEKLPVPDAAKRSNIQSSLPFFFNDKQGILTTIVINDAQPQLFYLTSDGGKTWNMHLNEHDGKTGNLSWTTQRRENAVGRVEFNYHVTVGEDSWVGNSGQTWITEDNKMR
>NZ_CP048286.1|WP_162639711.1|1853891_1854746_-|NAD(P)-dependent-oxidoreductase
MRILIAGASGVVGRSLIPLLAEAGHEVVGLIRNPAQAAALERAGARSVIADVYDREAVFAALGETKPDAVIHQLTALGERNFADNARIRREGTRNLVDAALAAGVTRMIVQSISWVYVPGDGPAGEEELLDLAAPEPRSSTVEAVAVMEAAVAEMPEHVILRYGLLYGEGTWYAVEGLMADMVRAGQLPATDGVSSFVHVEDAARAALLALNWPSGAYNIVDNEPAAGAEWLPAFADSVGAPAPAVQSGSARGERGARNAKAIKQGWEPRYPSWREGFRTGLGH
>NZ_CP048286.1|WP_162639712.1|1854802_1855756_-|aminoglycoside-phosphotransferase-family-protein
MKNAVVIQAERIAADYLGEQVRSAYQIVGKGFVNQVCVVEGEQRKIVIRMNDRGTYPDYVKEQWCMEQAAAVGIPGPEVLAVGIADETAYMILTFVEGCNGLDLTSPANDVWRQLGAYARRMHVIPVHGYGEQLTDPAQGRFHSPPHPGSDGSWLGCVQYNIDSLTEDDRLIELGVITRAESQRVRELFERLKQTTFSFGLYHGDMSLKNTLVDEAGQAIVLDWGSAEVGVVPHGEVLQVLQSQMLGEGPNREEFQAFIDGYGLNEEDLAGMRPMQLLRAFDKLRWAIDRSPDLIEAYAAFAKRVVEMSAAEIGPGE
>NZ_CP048286.1|WP_162639713.1|1855938_1858158_-|copper-amine-oxidase-N-terminal-domain-containing-protein
MKSLKWILILSFLLLPITTAASRSASAAGNGLTTATPNTGTTSGTSTTSGTDATTGTGATSGTGTTSGTGTTAGDGTTPATGTTPGTGTTPGITTPGTGTTSGTGTEYPPATDRLDLTIGSATMLHNGATYTSAQPVKSINGRTFLPFSSIAARYGFKISYNAQTKESTATSDKHTLVFKIGSDYAFRDGIQTKLAGATFISNGYLMVPLRSWGEMAESTIAVVGKQITLKWSTVVIPPKPTADFEIQPAEIYAGQTTVTYIDHATNATGLPFVDERWDGRLDVFPMAGTYTVSRQVEDSNGVWSDPFSITVTVKAPNLPPVADFTTDKPQYRIGETITYTDISTDDENAIASSTFTGNEKVFFEPGDHSVTLSVTDKNGLTGSVTKTVTVTNEVLYTKDEYQRLFTPTGEIYSIDGASVLQFPAYNYVIQSEPSQMVRSNSPETLVQEGVAYRAQLSGQVRFMFHNVNNIGYPVTMHLLATNMGYADAKVNKTAIGMGGPTPSPELAGKLATARYLTSEASKPAPVWTTIAPGETKEILPDIAKVPLKAGDSFSSYADIFSDKELLYTIVVIAKDKDALTELPNLAVMPRDGLHVRGTFYNADRSIEVNDTLGATPQRIMIGEKNGVDKILDGIDEMTGELEYNRGNFGVLYKMHLSHVAPHTMISLNGRGGLYTGAFLVNGQLVTVANNQVLKDNNQAGVLYRTGDSEETVDIVFTVASGSNLPVAILFTPLPALRQ
>NZ_CP048286.1|WP_162639714.1|1858532_1860566_-|Na+/H+-antiporter
MELFLVVLVLLLLLAVSQVVQRLLPFIPLPVVQIALGGSVVYLPWDLHIHLEPELFFILFIAPLLFNDGKRTPREELWKLRLPILLLAVGLVFLTVFAGGYAIHAMIPVIPQAAAFALAAILSPTDAVAVSAIASRVHLPQNIHRLLEGESLMNDASGLVAFKFAIAAAVTGTFSIWTASWSFLVISLGGLLLGAVLALAIIWFRVALRRFGIEDVSVHVLIQVLTPFILFYVAEHLGLSGILAAVAGGILHAIEQDRSGFTTIEQKFVSEITWNVILFVMNGLVFVLLGLQIPEILHNIFSNLAYDNFQAIAHVLIIYVMLIALRFLWLALSEWLIKPLGGRSHDWRAIILTSLSGIRGAITLAGAFTIPLVLGSGAPFPERDLMIFLAAGVILVSLIIASIALPLLAGQPDEAEGEGSRREAELRVQKEAIKAANQAVRLAIDETNVHSAAIVISDNDQRLSDIKRTEYDMLSRKARNEEMYLRQLGIAEERRCVQLLREQGEIESEEAAVLENMFRSIEIVISNRFHIFYLLLYSLVNKVVMFFYPAKRRGYDILKAKDRKAFIRMRITTAAYALDRLQGNEACANASINRVCGHYRQMISLLNNRLAAPSPDDVVEEQVQMLRMLSIQAEREALQQQYQQGHIGRQQLSKLQFQVSMHEAEVLDINWGSFLQA
>NZ_CP048286.1|WP_162639715.1|1860651_1861173_-|acetyltransferase
MMHNVEVGLRRMTESDYDAMVRWRQDEEVRKFYSNPHTTYSREMIERKYASRIAGNDKKAPIIVEWDEQPVGYLQYYELDSEEKEEYGLAAHLRMYGMDILIGDPLFRNRGIAARAIRLVQCELEAKSAIHGILLKVHQANGSAIRCYEKCGFYIWKTISDTLLLMLYARGEF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_4

1996670-1996770

Orphan

Consensus_repeat	Method
GTTTTGTACGAAAAATCGTACAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_4

>merge|NZ_CP048286|4|1996670-1996770|CRISPRCasFinder
GTTTTGTACGAAAAATCGTACAACACTGCTTGCTCGGGCGGCGTACAACACTGCTTGCTCGGGCACCTGTCGCAGGCGTTTTGTACGAAAAATCGTACAAC

>NZ_CP048286|4|4|1996670-1996770|CRISPRCasFinder
GTTTTGTACGAAAAATCGTACAAC	ACTGCTTGCTCGGGCGGCGTACAACACTGCTTGCTCGGGCACCTGTCGCAGGC
GTTTTGTACGAAAAATCGTACAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162639816.1\|1992613_1992736_-\|sporulation-protein-YjcZ	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639825.1\|2006019_2008623_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371967
NZ_CP048286.1\|WP_162639814.1\|1991647_1991938_-\|DUF3817-domain-containing-protein	unknown	unknown	gnl\|CDD\|274878
NZ_CP048286.1\|WP_162639828.1\|2010759_2013396_+\|alpha-1,2-mannosidase	unknown	unknown	gnl\|CDD\|377950
NZ_CP048286.1\|WP_162639813.1\|1990938_1991463_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99836
NZ_CP048286.1\|WP_162639819.1\|1996858_1998007_-\|polysaccharide-pyruvyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|377253
NZ_CP048286.1\|WP_162645148.1\|1990655_1990859_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639822.1\|1999910_2000102_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639817.1\|1993044_1994628_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|163405
NZ_CP048286.1\|WP_162639827.1\|2009727_2010507_-\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|380322
NZ_CP048286.1\|WP_162639821.1\|1999151_1999880_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP048286.1\|WP_162639810.1\|1987495_1987894_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|334619
NZ_CP048286.1\|WP_162639826.1\|2008786_2009683_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197666
NZ_CP048286.1\|WP_162639812.1\|1989549_1990467_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162639824.1\|2000793_2005944_+\|DUF11-domain-containing-protein	unknown	unknown	gnl\|CDD\|375050
NZ_CP048286.1\|WP_162639823.1\|2000098_2000500_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162639815.1\|1992058_1992463_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|259873
NZ_CP048286.1\|WP_162639820.1\|1998016_1999162_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340846
NZ_CP048286.1\|WP_162639811.1\|1987953_1989279_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133433
NZ_CP048286.1\|WP_162639818.1\|1994624_1996556_+\|TOMM-precursor-leader-peptide-binding-protein	unknown	unknown	gnl\|CDD\|274674

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162639817.1\|1993044_1994628_+\|hypothetical-protein	gnl\|CDD\|163405	TIGR03693, ocin_ThiF_like, putative thiazole-containing bacteriocin maturation protein. Members of this protein family are found in a three-gene operon in Bacillus anthracis and related Bacillus species, where the other two genes are clearly identified with maturation of a putative thiazole-containing bacteriocin precursor. While there is no detectable pairwise sequence similarity between members of this family and the proposed cyclodehydratases such as SagC of Streptococcus pyogenes (see family TIGR03603), both families show similarity through PSI-BLAST to ThiF, a protein involved in biosynthesis of the thiazole moiety for thiamine biosynthesis. This family, therefore, may contribute to cyclodehydratase function in heterocycle-containing bacteriocin biosyntheses. In Bacillus licheniformis ATCC 14580, the bacteriocin precursor gene is adjacent to the gene for this protein. [Cellular processes, Toxin production and resistance].	1.1744e-102
NZ_CP048286.1\|WP_162639825.1\|2006019_2008623_-\|hypothetical-protein	gnl\|CDD\|371967	pfam12215, Glyco_hydr_116N, beta-glucosidase 2, glycosyl-hydrolase family 116 N-term. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 320 to 354 amino acids in length. This domain is found associated with pfam04685. It is found just after the extreme N-terminus. The N-terminal is thought to be the luminal domain while the C terminal is the cytosolic domain. The catalytic domain of GBA-2 is unknown. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335 in the downstream family pfam04685.	1.41588e-61
NZ_CP048286.1\|WP_162639814.1\|1991647_1991938_-\|DUF3817-domain-containing-protein	gnl\|CDD\|274878	TIGR03954, hypothetical_protein, integral membrane protein. This model describes a strictly bacterial integral membrane domain of about 85 residues in length. It occurs in proteins that on rare occasions are fused to transporter domains such as the major facilitator superfamily domain. Of three invariant residues, two occur as a His-Gly dipeptide in the middle of three predicted transmembrane helices. [Unknown function, General].	2.9543e-30
NZ_CP048286.1\|WP_162639828.1\|2010759_2013396_+\|alpha-1,2-mannosidase	gnl\|CDD\|377950	pfam07971, Glyco_hydro_92, Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.	0
NZ_CP048286.1\|WP_162639810.1\|1987495_1987894_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|334619	pfam01638, HxlR, HxlR-like helix-turn-helix. HxlR, a member of this family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis.	1.09508e-40
NZ_CP048286.1\|WP_162639821.1\|1999151_1999880_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	3.7411e-34
NZ_CP048286.1\|WP_162639815.1\|1992058_1992463_-\|hypothetical-protein	gnl\|CDD\|259873	cd04211, Cupredoxin_like_2, Uncharacterized Cupredoxin-like subfamily. Cupredoxins contain type I copper centers and are involved in inter-molecular electron transfer reactions. Cupredoxins are blue copper proteins because they have an intense blue color due to the presence of a mononuclear type 1 (T1) copper site. Structurally, the cupredoxin-like fold consists of a beta-sandwich with 7 strands in 2 beta-sheets, which is arranged in a Greek-key beta-barrel. Some of these proteins have lost the ability to bind copper. Majority of family members contain multiple cupredoxin domain repeats; ceruloplasmin and coagulation factors V/VIII have six repeats; Laccase, ascorbate oxidase, and spore coat protein A, and multicopper oxidase CueO contain three repeats; and nitrite reductase has two repeats. Others are mono-domain cupredoxins, such as plastocyanin, pseudoazurin, plantacyanin, azurin, rusticyanin, stellacyanin, quinol oxidase and the periplasmic domain of cytochrome c oxidase subunit II.	4.2456e-18
NZ_CP048286.1\|WP_162639827.1\|2009727_2010507_-\|NADPH-dependent-oxidoreductase	gnl\|CDD\|380322	cd02146, NfsA-like, nitroreductase similar to Escherichia coli NfsA. This family contains NADPH-dependent flavin reductase and oxygen-insensitive nitroreductase. These enzymes are homodimeric flavoproteins that contain one FMN per monomer as a cofactor. Flavin reductase catalyzes the reduction of flavin by using NADPH as an electron donor. Oxygen-insensitive nitroreductase, such as NfsA protein in Escherichia coli, catalyzes reduction of nitrocompounds using NADPH as electron donor.	1.13162e-76
NZ_CP048286.1\|WP_162639813.1\|1990938_1991463_-\|hypothetical-protein	gnl\|CDD\|99836	cd06133, ERI-1_3'hExo_like, DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins. This subfamily is composed of Caenorhabditis elegans ERI-1, human 3' exonuclease (3'hExo), Drosophila exonuclease snipper (snp), and similar proteins from eukaryotes and bacteria. These are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ERI-1 has been implicated in the degradation of small interfering RNAs (RNAi). 3'hExo participates in the degradation of histone mRNAs. Snp is a non-essential exonuclease that efficiently degrades structured RNA and DNA substrates as long as there is a minimum of 2 nucleotides in the 3' overhang to initiate degradation. Snp is not a functional homolog of either ERI-1 or 3'hExo.	0.000169317
NZ_CP048286.1\|WP_162639826.1\|2008786_2009683_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	1.46543e-24
NZ_CP048286.1\|WP_162639812.1\|1989549_1990467_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.1252e-22
NZ_CP048286.1\|WP_162639824.1\|2000793_2005944_+\|DUF11-domain-containing-protein	gnl\|CDD\|375050	pfam17210, SdrD_B, SdrD B-like domain. This family corresponds to the B-like domain from the SdrD protein. This domain has three calcium binding sites within a greek key beta sandwich fold.	3.58485e-13
NZ_CP048286.1\|WP_162639819.1\|1996858_1998007_-\|polysaccharide-pyruvyl-transferase-family-protein	gnl\|CDD\|377253	pfam04230, PS_pyruv_trans, Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.	8.70325e-17
NZ_CP048286.1\|WP_162639820.1\|1998016_1999162_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340846	cd03819, GT4_WavL-like, Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.	2.58015e-42
NZ_CP048286.1\|WP_162639811.1\|1987953_1989279_-\|hypothetical-protein	gnl\|CDD\|133433	cd05297, GH4_alpha_glucosidase_galactosidase, Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. Glucosidases cleave glycosidic bonds to release glucose from oligosaccharides. Alpha-glucosidases and alpha-galactosidases release alpha-D-glucose and alpha-D-galactose, respectively, via the hydrolysis of alpha-glycopyranoside bonds. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the alpha-glucosidases. Other organsisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. Alpha-glucosidases and alpha-galactosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	9.19551e-81
NZ_CP048286.1\|WP_162639818.1\|1994624_1996556_+\|TOMM-precursor-leader-peptide-binding-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	2.86928e-137

>NZ_CP048286.1|WP_162639818.1|1994624_1996556_+|TOMM-precursor-leader-peptide-binding-protein
MNTVLIIGEGVFADTVCQHLSGFRTVRKPDFGEGLASAELVLVLGGNASDHLQADEMLRPLGIPWLPCYVSKGEGVVGPLVHPGTTGCIQCAETRRTRAGRDLEVMDDELMRLLFPELPPSPPAVLPPSGLRHLACILSAEAAKVLQGEHAQSENRIYLVNLRTLRTSLHFVLPEHICRVCGRLPDDSMQEAAIALKPCKKLNRDSYRSRSMHELGQVLGRDYWDSRTGLLNGKQYDFLSAFASAVANLPMNISNEVTGGHSHSFADSELAAILEGLERYCGFAPRGKRTVVHDSYLRLKDIAMDPSQAGFHAQANFEQPDFPFVPFDPAAKMPWVWGYSFLRNRPILVPERLAYYSLSQPGSFVYEISNGCAIGGSLEEAIFYGLLEVVERDSFLLAWYARLPLPRLDYRSSGDKELFVMIERLRAVTGYDVQLYNSTMENGIPSIWAVAKGGADQALNLVCAAGAHLDPIRAATSAVHELAVTITRIEERLRDRREEAEAMFRDSSLVQQMEDHALLYGLPQSEERLAFLLDGHRPLRTFEESFGPVAMNDDLTDDLKRLLEVFHSLKLDVLVVDQSTSETLRNGLHCVKVLVPGMLPMTFGHRFARIHGLDRLLEVPMKLGYSDHKLSVEELNPYPHPFP
>NZ_CP048286.1|WP_162639817.1|1993044_1994628_+|hypothetical-protein
MSSQDEEVLAVGSGAILVSLVKAWYASGLTKVNVLVANAQSSIADELQTVKEQALLRDSEAELNILALAASSDVDWAAAVQPFSFILYAAQHGDLTELQQLQSACIACKKPLLPAMFIGGMCIAGPLLRQEGDSCPASAWRRLHASVFPADPESQPCSAAALSLLTNLTVNEWLNAVSDSDSDSDTDSDSDSGTDEIHCSNHCYVLHPLTLEGDWHPILPHPVLSGYQPARIVTDVVLNLEDEQEPAPEEWFEWFNGLTSEVSGIFRAWEEGALRQLPLAQCLVQPADPLSERPASLLPAIVGSGLTHVDARRDSALAGMESYVSRLKPLFVPELPSSRRDDVWIGAGLTFAEAAERGLHAYLTQELGKRPLHHGLKLARMDDAPVEDLQCQYLLRALTILEGEPRMASGEPLLGFPVAWVRSGAAWHGGVGLNMTLALRQSLQNALMQTASTPVASVIWNDHLHPPQSVAIPSEDPIARPSWIRSAIHTLRRHRKRLEVFDLRCESFLSEGPIAVVGILLGEEESP
>NZ_CP048286.1|WP_162639816.1|1992613_1992736_-|sporulation-protein-YjcZ
MSLLGGAGSCSCSCGGGFTSAGVILVLFILLVIISRAVIC
>NZ_CP048286.1|WP_162639815.1|1992058_1992463_-|hypothetical-protein
MFKQVLTTLLLAGLTLGMLTACSSESEPSAASGAASASETSGSQTIKLTLTEFSFSQKEITVKKGETVHFVLTNAGAYPHDINSEELALDKDVDPGQTAEFDWTAPDKAGTYQVICDKPGHMDKGMTMSLIVNG
>NZ_CP048286.1|WP_162639814.1|1991647_1991938_-|DUF3817-domain-containing-protein
MRTKAWKVFQWISYLEGTSFLVLLCIAMPLKYMADKPNAVSVTGGIHGFFFALYLVAVAVMAVRYRWKALRVVGAVIASLLPFGPFVFERRLAKKA
>NZ_CP048286.1|WP_162639813.1|1990938_1991463_-|hypothetical-protein
MDLEFESRRHFIYELGFVSYANKMLKTRYSTYVYDEQIESWTGDKIGKAAVARIKASGVPIDRAAGSLLAECKRLSINTVYTWGSQDKRELEIVLGGSSILGSMDFVDYRDEFKRFMGEAGANALSLKAAFQLCYPNHPYQVALHRAAYDAYVLAQIVYFVRTFPASVYRTEDR
>NZ_CP048286.1|WP_162645148.1|1990655_1990859_+|hypothetical-protein
MQLQQKAMYLVGSPVGISLRNGQGVSGKLCSVQNGEVYVLQYMYASQFATFHYPFNQINDIYPYPNC
>NZ_CP048286.1|WP_162639812.1|1989549_1990467_+|AraC-family-transcriptional-regulator
MDRQRKNSERMFPTIKSELYVYGACAGEAYPPWRCQRHLHHMMFELNLVLEGSQTVIVGNREYKQRSGELLLIPPMQPHEAYVDDPAGMRYFVMHVQLDDPAFLQLLHDSGKVYFAGDEEVNLLLMPELESIMGLLSDGSSRISVFHKLYGMLDKLEKHLLRERERQPVSPANTLALRIAQSIERMVTTPKDDISAWPADWLEEISRKLNSTRKHSYRVFQRQYGMSPREYMTILRQQEAMQLLLGGSDTVERIALRVGYDNPQSFIRQFAKWTGATPGEFRRNRRSQEDIYYLIPLEVQSMNPT
>NZ_CP048286.1|WP_162639811.1|1987953_1989279_-|hypothetical-protein
MKIVLIGAGSYVFAPTVLEDAIVKHKLADSEIVLVDLNLEAVRAMAEAARRVSAELNVPIAISYTADRAEALPGADYVIVSASPQGAKRWAMDYEVLKNFGLADQARECGGLGGMLNAFRSITLIMDICRDMERLCPNARLLDVTNPMPRVVTAVERFSSIQGMGFCNIAHLGENGYTFLPQLLGRTGADVEIVTAGLNHFAWLLEMKDKATGEDLMPAIRQYVLDGDWSGQPEHAQIELKIMRRWLLEYGGIAAGSVHHHAEYLPVQADVRYADVPPYHGDESTRRAWMQMLQDIGAGQADWRGMFEHKSWEHPLDVALALHEGSDREIDIVNVPNRGCLQGIPEGRIVEVPLSIQGGVPVGVAVPALPEGVSSLCAILSEVHEMVAEAAVKGDRKLAHRTIDFDPAITDKAAAHAAFDRMIELHLDLLPQFAVQSSSRN
>NZ_CP048286.1|WP_162639810.1|1987495_1987894_-|helix-turn-helix-transcriptional-regulator
MAKDIRSRIEIDQINCEKELTLALIGGKWKLIILWHLGIEGTKRFSELQKLIPHITQKILTNQLRELEEDRLVERTVYPVVPPKVEYKLTSHGESLVPILRLMYDWGKDYGEQVLGRVSQPMAAIPFQPVGK
>NZ_CP048286.1|WP_162639819.1|1996858_1998007_-|polysaccharide-pyruvyl-transferase-family-protein
MRKVLYLAWIGFNNLGDEWMWEMFKAMADAHLSEDEYVVIPSLPKEEWKKVSQYDTIVLGGGSLIVPGYVDLVHDALELGKTIVIWGSGHDRLHQWAPSQDGQLKPEKAVESPAYRQKLKAIMEQSAYCAVRGPWTLDYLASLDALPKHIAMSGDPAMLMNAPMPASALQPASPASQPEAASQAESASQPASPLQPADNVQGQVRTIGINWGTTYNRLYGGSEERVEDQLADTCRSLLRLGYRLHLYSVWGPDQEALARLYRKLGQDERITFDPKVHAAAEYVRLMSGFEATINFKLHANLLSAAANVPFVCIGYRFKGFDLMHGLDLADWIVPADDPRLAEKLTEKVQAAAAWRDGYIGKLEAGREAAYQALVTPFRKRLF
>NZ_CP048286.1|WP_162639820.1|1998016_1999162_-|glycosyltransferase-family-4-protein
MMRNRIRLLMVMDSLNVGGTETYVLSLIKAFPSLGVMPVYAGGTGVMYEAFARAGCPIHRVELRAEQLLDPARQEQAVLALTQIMRSRKINLVHIHQTPSGLYAAEAARKLGIPVVFTVHGAYYPPDQLQLMKAAGCTFVSVSPPVYAYLERQGISSHLIGNGIDFEQYRSESSAELRARLRIPEGEKVVVYASRLAWDKAAVCAMLVRAARTIRLSGTLPLHVVIAGSGNQAAAIAELAETVNLECGATFIHLVGSQMQMRDYYNLGDLVVGTGRVALEAMACGKPLLAIGNHGYFGFVNPPVYSEAWQYYFGDHDSKERPSEQRIGEAIREAFASAGKLEEMGRQGQAWARDNFLIRDKAIQMKRLYDALLPKTLIGME
>NZ_CP048286.1|WP_162639821.1|1999151_1999880_-|glycosyltransferase-family-2-protein
MSFQRVPGLVSIVVTVYNKLPYLADCLTSLLNQTYTNWELILVDDASTDGSYDYVMNWLNGNEPLLREGKGIYTLRLPRNIGYAGTITAGMFLAKGEFIAIQDADDLSHPERVAKQVRYLDQHPQIDLLGTNYEVFEDGQPDRKLPVYWLKYGDQIGKVYAEGGHCICHGTAMFRGKVFDQIGGHTRRIEGAEDYEFIVKAIKPGAKNVDNLREVLYYYRKHQKQRSRKYFGKSQQAHDYDA
>NZ_CP048286.1|WP_162639822.1|1999910_2000102_-|hypothetical-protein
MIEELQSLVNKEVQIASALETISGTLVSVDGAAVTIRTSEVFGYESGSYAIIQLRFISYIRLL
>NZ_CP048286.1|WP_162639823.1|2000098_2000500_-|hypothetical-protein
MKFIVNERELKEYFDGLARLFRQPNAAQQTAAEPLNVSVLMEELRQTIREELASIAAEEPRDAGAYSLNKLQQVFEPYTGKPAELLTPAGTVEGTITKVGGDYLIMREHGGTSVMVPLEQMIAFQLTGKQVER
>NZ_CP048286.1|WP_162639824.1|2000793_2005944_+|DUF11-domain-containing-protein
MPATITGIVFNDLNHNGLFNPGEPGIPNVFVVLFNPAGGTCTPVLTDANGNYSFTITAAGTYTVYETVANPGATCPPTAFTQPPGFTMSNGPSKLTVAVSGAQVTGNAILANNNFSHDTVANPLGCTTSMIQFTGRPSVWFNINIVTGSAIAQGTVNPPVDINAIGYNPLDNYIYGYDQTNNRLVRIDNSGNVIGLAPLPPGLPADIYNVGTFDSNGFLYLFVNNETRFYVVDLRPNSATFLKLVNPANGFLEQTSNFGVALSRALNVSDWVLRPQDGNLYAITPTGLMQRIVPATGNITNIATSPLRTGPFGALALDSTGTIYAISNNDGNIYRFTIAGNTATAVRFSSTVTSSFNDATMCALATINLDFGDAPDTSSGNGPDDYSTLLSSDGPRHGLVNSLFLGTRVTAEADAHQNFDATGDDIPLGIQDDAVTVPLPVLVANTGIYTLPVTVTNATGSPANLYGWIDFNGDGIFQADEAAPVLAVPSQPGTQTFFLDFFPLPGAVQAIDHTFVRLRLTTDTLVNTNPIQASPTPGSPPDTRSLGPATDGEVEDYILQVSKAIEIFITKTPFPAEALPGETVTYRFTLKNPAPFPLTNLRIEDSLLGLIDIVSFLPPFASIDLEAKFIVPLDAPAGSQIFNTVVATSDQTFPVQDQAIITVLPAFSLAVTKTPDRISVPPGETVVYTIVVTNTSNAPITNVTVKDDLVGLSQFIASLAPGETRTFTVPFQVPAGAAAGTVFTNLTVADSTETGPASDTATIVVPPIPQVFLFKSVEPQVAAPGETVTYTITVSNAGNDTITNVRIVDPTLGVDQTYAALKPGDAIIITVPFVIPLDAKQDETIVNIARVTTDQTGPEQADAVVKVIGDPAIALSKSVSPGAAFPGDVVTYTFVVTNTGNTALANVRLSDPLIGLNIIIGTLAIGESRTVDYPFIVPNLGMSPFINTATATGTFDTVTVEEQDTASLIIVPLQPSFTLTKTVDQSRANAGDTVNYTITVVNTGNVTLTNIVISDPLLGFVNTIESLDPGASATEKIPFVIPVGSAAGTVFTNVVTASTNETGPQEGTTTVTVNDQPALALTKTPDVDNALPGDTITYTITVANTGNVPLTNVTVRDDLLGFNAVIPTLAIGQSQSFTPTFVVPAGTPVGTVIVNRSTAFSDQTDTAETTANVLVNPLPPVLTILKTSDPAVVSPGGTVTYSITVSNPGTVVLTNVEVRDDTLGFAQVVGTLNPGDSQTLTIPFAVPADAPAGSVIVNTAVVSSDQTNPEESTSSVAIDPSPALQVTKTIAPAQSAPLQTVTATITVRNTGNVDLTNVVVADTTLGFRSVIPALAVGASLVFPLPFAVPNVPAGTVLTNTATASSDETGESSASATVTVLPQFRLSLVKRVDPSAALPGETVTFSFEIRNDSNAPLTGLRFTDDLLGIDKTVDLIPAGFFSLLSRTFTIPLDARGGTILTNTAVLSTDETAPVSSTVQVTVLEDPKLEIVKTVFPPVAIPGEVVFFRLEGVNTGNVPLVNVRVSDPLLGLIGTVAFQEVGEALSIILPFTVPADAAPGVPIVNTMFVDSAQTGPLRASASLKVIGPPLVVTKSADDKVIFVGDTVRFTVKAANVSEIAINAAVLTDLLQAGTQFVPNTVEISGRTVPGADPAHGIPIGNLAPGQSVEVSFQAEQTAALSDEQLRNQAAVSFQPAESLQRFTIHSNVLIITVESHEE
>NZ_CP048286.1|WP_162639825.1|2006019_2008623_-|hypothetical-protein
MRNVYKGEKTREIVFPLGGIGSGSIGLAGNGRLVDWEIFNRPNKKSFNGFSHFAIKAERDGQVLDARVLNGDMQGPYVGEHLRGAPLHSGYGFGPESQTMAGMPHFRDVEFKGEFPFAGMTFAEPAFPARVALTAFNPFIPLQEDDSSLPAAFFEWEIENTDQTAISYTLCLSAGNPVPTENVYHRYEAAEGAHGSNVHTLQLGSDQHAGDHAQFGDITLGTDAADVSYQEFWYRGGWCDNLEMFWHDFMQPGRLRNRQYPVTESPRTRQDTASLAAHVELAPGEKKTIRFVIGWNFPNVVNYWNANPAGSNGWRNYYAALFADSRAVAKHALENWTRLYEDTLAFKEALFASTVPDVVKEAVSANLSVLKSATVLRLTDGSLYGFEGCIEDTGCCEGSCTHVWNYAYALPFLFPRLERGMRELDLTYNQREDGRMSFRLMLPLGRERMDFRSCADGQFGGVLNAYRDWKISGDTAWLRSVWPAIKKSITYAWAASNEDQWDPGKTGVLSGRQHHTLDMELFGPNSWLSGFYLAALKAGAEMASFLGEDDTADEFACLFRQGKQWVDEHLFNGEFYMQQVDLSDQAALARFDDQTVTHYWNKELGEIKYQIAEGCAIDQVIAQWHANLIGLGEILDTDQTRTALRSLYRHNFKASMRHEANTWRLYSLNDEGGLVICTWPEGTGKPGIPLTYNSETMTGFEYQAASHMIQEGLIDEGLSIVQAIRDRYDGEKRNPWNEIECGSNYARSMASYSLLQAFSGFEYDMVQGMIGFKPVRTADNGVFQTLWSLDAGWGVFEQTPDQASIHVLRGTLNVKALRLPAERLGAIAHITLDGLPLAHSMVGNEIHFAETCTLMKQPLVVAFRSGV
>NZ_CP048286.1|WP_162639826.1|2008786_2009683_+|helix-turn-helix-domain-containing-protein
MKLEDYAVAPYIRDSDYAIRPPFFLGERDLLDYIIFYVQEGTFELQVNGHVHRLQPGDLCLLQPGDIHTIRGITDTINPYVHLDFFYNPLRGDSFVTRPGQVDLSAYADFGQPRLHDCDDLRIPFKLDTPSSGRLRELVFKIIDCWHSRTKMSIMEANQLAHEFLVTLFKAYMKPQPDSLSRVPFLNWITSYLASRISEPINVKDMARRAGLSPSRFTVLFKQHFNITPYQYLMKLRIDYAQELLQDGVSLQQTSDFCGFTDVHHFSKTFKSAIGVNPGSYRRDALHGTSGHRKAPLP
>NZ_CP048286.1|WP_162639827.1|2009727_2010507_-|NADPH-dependent-oxidoreductase
MEFNDVINGHRSIREYEDREVGQDLLDQILEAGIRASSSGNMQSYSIIVTRDAELKNKLYTAHMEQSMVVDAPVLLTFCADFNRMRKWLALNDAPVHFDNFMSFMIGAIDATLAAQNCALAAENAGLGICYMGSTLANCDQIGELLNLPPNVVPVVGYSLGYPAENPAPRDRLPKQALVHREQYRDYSDADILELYKERNDKGWKRYMDIPELKEMTERLGLTNLAQIYTRAKYTKESHLAFSQTVLDYLASQNFMKHT
>NZ_CP048286.1|WP_162639828.1|2010759_2013396_+|alpha-1,2-mannosidase
MIHESAAVSVSEYVNTRRGSNSDPSYSKGNTFPATGVPFGFNFWTPMTNASEPRWIYQYSKSGIQAFTISHMPSPWIGDRQTFQFMPMSDQVTVDRDAREASFDHANETAKAHVYSVKFDNGIQTELAPTDHAACVRFSFPTDRSYLLFDTFDNLDASIAWDEGNGVVTGHVDYPDGFLRLVPRMYVYAEFSKPFVRSSKVEGYRDLTSWVEFDTVQDRQVTMKIATSFISVEQAKANLLDEIGSSTFEQVKLAAQDAWDAILNKIEVEGASEEQLITLYSNLYRLFIYPNSAYEHVGGKPQYATPYVKGNPIKEGKLYVNNGFWDTYRTTWPMYALLTPDKAGELAEGFLKGYKDGGWMARWSAPGCVDCMVGTNSDVIFADAYLKGITGFDAEAAYDSMIRNAATYSSDSSKGRKGMERSVFLGYTPQDHVGESTSWSLESYLNDFGIAQLATALGKEDDAKYFYNRALNYVHIFSPSVGFFRGKNEDGSWRTSDEEFSSIRWGSEYTEGNAWHYCVAVPHDGQGLANLYGGREGLSDKIDDVFNAPRDYEEGGYGFVIHEMVEAYDIDRGQYGHSNQPVHHTIYMYNYAGTPWKTQARARDIVTRLYDSGVGTGNGYQGDEDNGEMSAWYLFAAMGFYPVSVGRPEYAIGAPYFKKMTIHLENGKDIVIHAPKVNDDNIYVQGLKMNGQDHSKNYFLHRDLADGALLEFDMGPSPSSWGSGKDDVPPSLTTGELPPQPLQDLANGGKVTASGENEAAGNAAAQAFVNNSSTKWQTSGATGWIQYELKEAGAVQMYTITSANDGQQQDPKSWELLASNDGTHWSVLDARTDEAFAWRQHTRAFAMNQAEAFTFYRLHVKQNHGADSLQIAEIELLG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_5

2424574-2424686

Orphan

Consensus_repeat	Method
AAGTCAGGTGCTCTACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_5

>merge|NZ_CP048286|5|2424574-2424686|CRISPRCasFinder
AAGTCAGGTGCTCTACCAACTGAGCTAATGACTCAAAGAAAAAATGGTGCCGGCGATAGGAGTCGAACCCACGACCTACTGATTACAAGTCAGTTGCTCTACCAACTGAGCTA

>NZ_CP048286|5|5|2424574-2424686|CRISPRCasFinder
AAGTCAGGTGCTCTACCAACTGAGCTA	ATGACTCAAAGAAAAAATGGTGCCGGCGATAGGAGTCGAACCCACGACCTACTGATTAC
AAGTCAGTTGCTCTACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162640149.1\|2437155_2438274_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379240
NZ_CP048286.1\|WP_162640141.1\|2423544_2423967_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640133.1\|2411187_2412297_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|119407
NZ_CP048286.1\|WP_162645184.1\|2435567_2435972_-\|HEAT-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|379311
NZ_CP048286.1\|WP_162640140.1\|2418525_2423532_-\|DUF4132-domain-containing-protein	unknown	unknown	gnl\|CDD\|379270
NZ_CP048286.1\|WP_162640150.1\|2438472_2438886_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361
NZ_CP048286.1\|WP_162645183.1\|2412542_2413238_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP048286.1\|WP_162640144.1\|2432261_2433704_-\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236426
NZ_CP048286.1\|WP_162640145.1\|2433719_2434277_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP048286.1\|WP_162640147.1\|2435330_2435561_-\|DUF3934-domain-containing-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640148.1\|2436154_2437135_-\|DUF4838-domain-containing-protein	unknown	unknown	gnl\|CDD\|374379
NZ_CP048286.1\|WP_162640138.1\|2416977_2417619_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP048286.1\|WP_162640146.1\|2434298_2435072_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|223979
NZ_CP048286.1\|WP_162640136.1\|2414708_2415626_-\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|369882
NZ_CP048286.1\|WP_162640143.1\|2431749_2432097_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640134.1\|2413403_2413940_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640137.1\|2415640_2416792_-\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	unknown	unknown	gnl\|CDD\|239432
NZ_CP048286.1\|WP_162640135.1\|2414052_2414565_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640139.1\|2417710_2418343_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP048286.1\|WP_162640142.1\|2431047_2431605_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153243

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162640149.1\|2437155_2438274_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379240	pfam13527, Acetyltransf_9, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.6311e-15
NZ_CP048286.1\|WP_162640133.1\|2411187_2412297_-\|SH3-domain-containing-protein	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	3.44653e-61
NZ_CP048286.1\|WP_162645184.1\|2435567_2435972_-\|HEAT-repeat-domain-containing-protein	gnl\|CDD\|379311	pfam13646, HEAT_2, HEAT repeats. This family includes multiple HEAT repeats.	0.000510466
NZ_CP048286.1\|WP_162640140.1\|2418525_2423532_-\|DUF4132-domain-containing-protein	gnl\|CDD\|379270	pfam13569, DUF4132, Domain of unknown function (DUF4132). This domain might be involved in the biosynthesis of the molybdopterin cofactor in E.coli.	4.20547e-41
NZ_CP048286.1\|WP_162645183.1\|2412542_2413238_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.63057e-26
NZ_CP048286.1\|WP_162640144.1\|2432261_2433704_-\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|236426	PRK09243, PRK09243, nicotinate phosphoribosyltransferase; Validated.	0
NZ_CP048286.1\|WP_162640145.1\|2433719_2434277_-\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	7.34391e-43
NZ_CP048286.1\|WP_162640150.1\|2438472_2438886_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	3.53705e-05
NZ_CP048286.1\|WP_162640148.1\|2436154_2437135_-\|DUF4838-domain-containing-protein	gnl\|CDD\|374379	pfam16126, DUF4838, Domain of unknown function (DUF4838). This family consists of several uncharacterized proteins found in various Bacteroides and Chloroflexus species. The function of this family is unknown.	9.85217e-14
NZ_CP048286.1\|WP_162640146.1\|2434298_2435072_-\|NUDIX-hydrolase	gnl\|CDD\|223979	COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism].	2.70656e-33
NZ_CP048286.1\|WP_162640136.1\|2414708_2415626_-\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|369882	pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.	3.07882e-89
NZ_CP048286.1\|WP_162640138.1\|2416977_2417619_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.41347e-40
NZ_CP048286.1\|WP_162640137.1\|2415640_2416792_-\|mandelate-racemase/muconate-lactonizing-enzyme-family-protein	gnl\|CDD\|239432	cd03316, MR_like, Mandelate racemase (MR)-like subfamily of the enolase superfamily. Enzymes of this subgroup share three conserved carboxylate ligands for the essential divalent metal ion (usually Mg2+), two aspartates and a glutamate, and conserved catalytic residues, a Lys-X-Lys motif and a conserved histidine-aspartate dyad. Members of the MR subgroup are mandelate racemase, D-glucarate/L-idarate dehydratase (GlucD), D-altronate/D-mannonate dehydratase , D-galactonate dehydratase (GalD) , D-gluconate dehydratase (GlcD), and L-rhamnonate dehydratase (RhamD).	1.9328e-116
NZ_CP048286.1\|WP_162640139.1\|2417710_2418343_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.87169e-20
NZ_CP048286.1\|WP_162640142.1\|2431047_2431605_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153243	cd03169, GATase1_PfpI_1, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	3.86894e-85

>NZ_CP048286.1|WP_162640141.1|2423544_2423967_-|hypothetical-protein
MQVFILMKQIGKRQPVIGERPLLLQEAPMTLRHLIGQVVAQEVERYNALELEADFVRLLTQEDMQEQAANGKIGFGRRYQADNQSVRTSIETACQAFEDGLYKVVINEEVIDELDSPLQVNENDRIVFIRLTMLAGRLWP
>NZ_CP048286.1|WP_162640140.1|2418525_2423532_-|DUF4132-domain-containing-protein
MRTASEQKQDLERYIASKREEAARWPESKRRLIEAVLADVEDPTVQSAQMLEKLFWPAQVNHISEALQGERLEVVAKLIGEEHAAMFKAIWDRSVLYPYTSGLSRLPFRSPEQSRLYLPLNLRRLAAAVHFVAQGYAWGVEAVLQDAANHPFLHDWIALAIDQGDDQSLQAVKRVIESDDSGAKLTRNMIKGCLMSHNVEARRAIGELLLSAKLQEGLRQTIMECADETSRESFILMLQLVLETDLLRFPSIVRAFGTWTAIVLDMDKPAVIRKCLQSAYDCLTDRDALTACLNSSDAQLFYIGLWALAVDETAWLQQPILLAIGTGEVYKAVAALELLQHTQQEDFQHKLASGFLINTEAGGMTHLHFLAKVLANLSTHDGTDSAFSLRHRTKLRNATEADIALFRQFRKLLAIVPIKQQTFWEQDYSSYTISADTVCLHMIVLAIETGSEEMGDELLELLPTMSPGTRETFCSAVLGHARNDKQRSALIDALGDKGAGVRHAAMRGVSKLALMPEEYARVEQLLQYKAGDIRQNALELLFKQPLEELKATVGRLLTDKKEEKRLAGLECMVQMRDSERHGPIFEACLGLARGLKQPTSREKVLLDSIVEKDISADDPMHGFGLYDPSMHDKLSPLPEHLTLEGIFRTGHEELKQILQVWSDRIHELRNEEFVLELGDGTQQTLLLSEGEWGFQALRMRAVKPMDQFPFPDVWRELARSQGLDGERLIQLIWYLEAPGSKQFGFKLDDFKENYHTPHLDGLFASLKQSGLQIFKEKLHYSWFIRMLCRALYQEEQEDERYRIVYHTSVAIYNCLMADSQVQKQDNRPRQGRLRFGNGEVHFGDVVDTEEVQFWLKHLQDFGLYGADETEWRDEWRWQDGKFRESFRLRQRIAKLERQEYAGPILETEELLGALEAGILSENEFYRELFEGDHGRTHLHALTRDAAYHRISLEKYPIGQRLTRRAVDRIAEIEMKRGDIATPVSRLAEGIQRFEGARHFVQCLLSLGSESLARGYDWFGVSTKKGSLSRMLKHVFPGAGEDAGTLRALLSGHKVPERRLIEAAMYAPQWIDLVEQVLEWEGLSSACWYFHAHTTDYLTADKETMVGRYSSIPPRQLQEGAFDIDWFHQAYRKLGDKRFRHVYDSAKYIANGANHRRAQLFADAVLGKLQLAELEAEMIEKRNKNYVLCYGLVPMLEKDGDHREDLLHRYEVLQQFLKISKTFGALRRESESAVVQLALENLSRNAGFADLTRMIWHVEAEAFQALSGHFAPMAIGYWEASLAVDEFGQTSMLVTKDGKALKSVPAGLKGYEAFKELKKTQASLKAQLQRARAAFEQAMVNQEAFTCGELVRLEKNPILAPLVGRLVFRTESGGLGWFVDGSLRGVNGDLTVIRGEERLWVAHSFDLYESGEWPQFQRQLFAEKIVQPFKQVFRELYLLTEDERSNGAASGRYGGHQVQQRRAAALFKARRWTVSHQAGLQKVYHRERIMATMYAQADWFTPAEMEAPTLETVEFFHLDTWQRVALADVPPVIFSEVMRDIDLVVSVAHVGGVDPDASLSTIEMRAAMAAELMPLLKLSNVTFKSAHAIIEGVLGEYSVHLGSGVVHQTAGGALHILAVHGQQRGRLFLPFVDDDPRTAEVLSKIIVLAEDRKLKDPTILRQIKQYAGS
>NZ_CP048286.1|WP_162640139.1|2417710_2418343_+|GntR-family-transcriptional-regulator
MSAPSLRDQAYHIIYEQIAAGALAGGTVTSEVQLSAQLDMSRTPVRAALQQLETEGFVRIISKHGVLVLDASAQRTGDLLELIAAILLFAVASVRRLDPEGLAELSLKLAAELQVRLEADKLDANPEALCAFELSAIRSILALGRNQEMQETAERSASRLFWLSSGRRWTAPCRDEMADVMQLLLHRLPASNDAFHDAMQRYLRMLKMNW
>NZ_CP048286.1|WP_162640138.1|2416977_2417619_-|GntR-family-transcriptional-regulator
MSRQEGNVTLRETAFQVIKKHIVGGDWTGGTFLSEKFLSELLGMSKTPIRSALDRLEMMGLVKLAPKQGVFVQELSLKKILEFYELRLSLETYAARKLTGRMDAAFFQRLDANLALQDEAIRQDDISRYVELDREFHAMIVGGLDNEEYMEVMSRIQDKFLLVVRMTFVKNKRRLIGSIEEHRQLRQALAGQDAALSVRLVEAHIEYVKKIMF
>NZ_CP048286.1|WP_162640137.1|2415640_2416792_-|mandelate-racemase/muconate-lactonizing-enzyme-family-protein
MKITDVRTFILGNPWKNWLFVLVDTDEGVTGLGEGTLNGFAKTVEAAIHELKHLVMGRDPFDVETISLKLFRDVYSDGGQIQGSALAAIETASWDIMGKVTNQPLYKLLGGQCHDKLRAYANGWYRGPNTPDNFFEKAKLVAAKGYTALKFDPFGAAWRTVTRQDFAAAIENIAAVREAVGPDVDILIEGHNRFSVSTALQFADAMLKYEPTWFEAPVPPHLITSMVEVARRSPVPVACGEDYYSREQFAELLRHDAVHIIQLEPQFLGIAASKQVCGMVHAHNGVTAPHSAQGPVCSVVCSHLNMATPNFYLHEIFDEFNEPWEEQVLMPPLKVQNGYLTPPEGPGLGVELNLEEIDKHPYQVGNWLPLFKQGWEKRETVNE
>NZ_CP048286.1|WP_162640136.1|2414708_2415626_-|SMP-30/gluconolactonase/LRE-family-protein
MTQAIAKQFAHAAELLLDAKAILAEGPHWHAAQGKLYWVDIQGLSFGRFDTASGVNQQFRVGKTVGAVVCDAEDGEVVYLSTRDGFERYDCRTGELTNIADPEADKPANRFNDGKCDSAGRFWAGTMMDAETGVTGALYVLDNDRNCRKAYENVGVSNGIAWNADETEMYYIDSMKGTVTAFDYDLAAGSIDRPRIIIDFRDEPGAPDGMTIDAEGMLWIAHWGGWQVSRWNPRTGEKLDAVYVPAAKATSCIFGGDELDILYITSASIGLTPQELAEQPHAGGIFTYRPGVKGTPTHAYRAAKA
>NZ_CP048286.1|WP_162640135.1|2414052_2414565_-|hypothetical-protein
MKKRAIGIALTILGLTTLVSTVSALDNGYAPVKQTPDMITVYIHGIENQDGRETLQADPIQWFEGKAADEEFLKDEPDSGLDGAPDGYYIVNDDQKLETLEIDPHAAVYMQIYDRTGSLVNVTTEWNQSVSLEKFKAIYRNNAIVDVSEYPYHLTLKDGKVVRIVQQFVP
>NZ_CP048286.1|WP_162640134.1|2413403_2413940_-|hypothetical-protein
MFDPTVFDNLKVAVENYVYDLDNLDARVIVTHRVDRLEMAVMGRVFALQFTLAKGSGITAEIRLEASLQDLAAEILDQQGAAPGCTVRIRFYMPVEDIETTCAYTERELTEIWQLEMPPTQMLSFMYGEGLPSPSYQNEIEVHFHRKINEEQMEDLPELIEHMVQSLERLEAFAAEPA
>NZ_CP048286.1|WP_162645183.1|2412542_2413238_-|class-I-SAM-dependent-methyltransferase
MNHVRSTFDATANGYDAQRRKLIPCFDDYYGTAVSLAEAGAAKPRILDLGAGTGLLSSMLLAKHPEAQLTLIDLSDNMLAVAKERFAGQPDIDYVCRDYTSYMEEEAFDLIVSSLSIHHLSDEGKQAVYRNAYANLKPGGIFINADQVLGRTPFIDALYKDDWKRKIEASGLTRAELDAAYERTKIDRMSGLDEQLAWLAQAGFSDAGCVYQSFNFVVMYGRKQEEGSRSE
>NZ_CP048286.1|WP_162640133.1|2411187_2412297_-|SH3-domain-containing-protein
MRTKWFGLALILVVIVGGLGLRSNDAAATTKVPYQAKVSTTALNVRSEPALQASVVGQLKAGDVVTVTDEEEDGWVQIKKNNLSGYAAGYLLRRTDNSGQTAGTSSSTGGKVSTSPGSTATVTADSLRIRSGPGTGYKVVGSLKQGEQVTILSSETSWLKIRATPSVTGWIAKEYVDKGAPKQSHSSGTGIRGKLIVVDAGHGGSDPGKIGTTYDTKEKGLTLSTAQYLKQELQRLGAKVVMTRTTDVKPELSERVQISESNHADAFVSIHYNSAETKTSGTLTFFYSEQKDRPLANAIESELSESGIGLRSNGVSFGDFYVLRENNVVSTLVELGFLSNAKDESNVRGSAYQKSAAAAIARGLADYFD
>NZ_CP048286.1|WP_162640142.1|2431047_2431605_-|DJ-1/PfpI-family-protein
MSKRILIVTGDAAEVLEVYYPYYRVLEEGYEAVIAAPAKKVLHTVVHDFVEGWETYTEKPAHLLPAHLAFADVDPAAYDALLIPGGRAPEYIRNNEDLPRILSHFLEADKPIGAICHGVQVFASLQDTRYFEGRTMTAYTACRLDVERLGASYAKETLHVDGKLVSGHAWPDLPGFMREFLKLLA
>NZ_CP048286.1|WP_162640143.1|2431749_2432097_-|hypothetical-protein
MNEKVRSYFRLKRKQKELEQELAELREEILAYCAENEATSMEVGNYTVKVVAHRRKEYDEAKLFEVLPDLELWKLLSSPDTAKISNLVKLNVLSDERLKDTYTVKEVSYLQVERK
>NZ_CP048286.1|WP_162640144.1|2432261_2433704_-|nicotinate-phosphoribosyltransferase
MNYENMTLHTDKYQINMMYAHWVQGSHNDQAIFEVFFRKLPFGNGYAVFAGLERVVDYIRNIRFGDEEIAFLREQEEGYKEEFLEELREYRFTGQLDAVPEGTIVFANEPLLRITARIFEAQLIETAILNFVNFQTLIATKASRIKQVAGDDGLLEFGTRRAQEADASVWGARAAYIAGFHATSNLRAGMLFGIPTKGTHAHAWVQGHDTEEEAFRKYAEVLPDQVTLLVDTYDTLRSGVPNAIRIGKMLEKQGKRMNGIRLDSGDLAYLSQEARRMLDEAGLHYVGIVASNDLDESLIFSLKGQGAKIDVWGVGTQLITSGDQPSLGGVYKLVAREKDGEMVPVIKISGNPEKVTTPGRKDVYRIINRETGIAEGDYLTLVEEGPLNTEEPLRLFDPVHHYIQKVIQRFDAIPLLTGIFQDGELVYEVPSLEEVRRYHREQLALFWPQVLRKTNPAEYRVNLSDTAWELKMALIAKYMA
>NZ_CP048286.1|WP_162640145.1|2433719_2434277_-|cysteine-hydrolase
MKALIVIDYTVDFVVGKLPCGQPAIDIEQRIAELTAQFAGQGDFTVMAVDLHREQDELHPEHRLFPPHNIEGTDGRDLYGRLKDVYEANRERIYWMDKTRYSAFCGTDLELQLRMRDIQELHLVGVCTDICVLHTAVDAYNKGFRIVIHADAVASFNEQGHDWALTHFERTLGAAIYRDGQRITV
>NZ_CP048286.1|WP_162640146.1|2434298_2435072_-|NUDIX-hydrolase
MNEPIEEAANYSASRYRTPDGAPADIVIFTITSTERNTAKKSLPVRQLEVLLIQRKGWPYQGHWALPGGFSKETETLLDSALRELHEETGVADVHIEYFGVYSKPGRDPRGWMISHAFFALVHEHALANRRAADDAADVRLFPVQEALAMNLAFDHREILEDALQQIRIKMLTTTIAKSFLPEEFTIGELYQVIEAVVPDFEEKNFIRKITSTQSRKGIIEEVRDRKGELKQSNRHSQRAAQLYRFTDYVPQLSIYS
>NZ_CP048286.1|WP_162640147.1|2435330_2435561_-|DUF3934-domain-containing-protein
MAKSKGGTGRGTDKKGWNRWQATEKRIKNAPKPYKSKGTKKPAEGGAASGTPGAAAGKGTGSGASSRPAAKSPSAK
>NZ_CP048286.1|WP_162645184.1|2435567_2435972_-|HEAT-repeat-domain-containing-protein
MEELKRAVSRTSNWRERLKAVEALRELGGQPAVDLLTRIVKNDTVHQVQLAAHSALTELGVEAERPLKKTIELVKGTGKILLRIKKSLPAGHSYEAFKEKLKHMRTDVYDIYEGDKGEGFDEWLESTWSSLSGR
>NZ_CP048286.1|WP_162640148.1|2436154_2437135_-|DUF4838-domain-containing-protein
MNTTTKATMEEKRGILILPEEAGLYWADLIARSGLNLVGIHPGWGAGALEELEKMLDFVKTPQFAEFAQRMKELNVAIEFEAHAMSWLVPRALFSEHPDWFRMDESGNRNADFNLCASSPEALLFLETRSEELARALPSPTGRYYFWIDDVTGSACHCGNCRVLSASDQAMIFYNHILRGIRRFDLEAEHCYLAYQDTIQAPDKVKPDPGIFLEYAPIYRDSARPINDPDCPENYKELEHLPGLLRLFGQEGAQILEYWMDNSRFLKWQKPLSPLPFYEEVIRRDAEYYRSLGFNRQTSFGVWLGEDYGQAFGEPPIIAYARAIEG
>NZ_CP048286.1|WP_162640149.1|2437155_2438274_-|GNAT-family-N-acetyltransferase
MMEYRKARPDEREAYIDLANYAFKIDFESVIPKVYGKDMDPSAMHMVAADEQGRLRAQVAVYPEPMNVGGFPLRAGYLGIVSVHPRARGEGHMKVLMNKWLEEAPQSYDMLVLYGQRQRYEYFDFTLGGVRIKYTVGQDNARHALNDVSIDGLSIRPLFEIEGAAAFAGKLNDARPSFVQRDEQQMPFVLTGLEQRPLGVLDEGRLIGYLVVGKTGKEITEFAMENADDIPRAMKAYLAHAGTDWLSVLAPEYETELNASLSRFAENYAIETSDMYHIFDFARVLEAYLTLKHRTIGLAYGQFSAILDGQPVTARVDENGVTVERSALPGAGEFTKQQAQKLLLTPHGRFMEARVPAGWFPLPIFWYMADKF
>NZ_CP048286.1|WP_162640150.1|2438472_2438886_-|VOC-family-protein
MGVHSLGAIFIRVSNLENSIPFYSALGLRFRGIEDWDPGRAATFYLLPDHDGFPLMTLVESDKVQVLEYHSYNLNATNVREIYRDLELSGYKLRPVEEWSSPWNHHIMFDVYDPDGHPINIIEVIPINQAQAVQVHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_6

2608628-2608789

Orphan

Consensus_repeat	Method
CCAGGCCTTCGCAAACCGCCGCCGTTTCCCGCCCTGCGCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_6

>merge|NZ_CP048286|6|2608628-2608789|CRISPRCasFinder
GGGGGCTTTCGCAGACTGCTGCCGTTATCCGCCCTGCGCTTCCAGGCCTTCGCAAACCGCCGCCGTTTCCCGCCCTGCGCTTCTGAACTTACGCAAACCGCCGCCGCTACCGCCCTGCGCTCCCAGGCCTTCGCAAGCCGCCGCCGTTTCCCGCCCTGCGCT

>NZ_CP048286|6|6|2608628-2608789|CRISPRCasFinder
GGGGGCTTTCGCAGACTGCTGCCGTTATCCGCCCTGCGCT	TCCAGGCCTTCGCAAACCGCCGCCGTTTCCCGCCCTGCGCTTCTGAACTTACGCAAACCGCCGCCGCTACCGCCCTGCGCTC
CCAGGCCTTCGCAAGCCGCCGCCGTTTCCCGCCCTGCGCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162640247.1\|2595496_2596303_-\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|223710
NZ_CP048286.1\|WP_162640248.1\|2597179_2598649_-\|sugar-porter-family-MFS-transporter	unknown	unknown	gnl\|CDD\|182225
NZ_CP048286.1\|WP_162640250.1\|2600198_2601731_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP048286.1\|WP_162640261.1\|2618365_2619994_-\|response-regulator	unknown	unknown	gnl\|CDD\|381091
NZ_CP048286.1\|WP_162640260.1\|2617721_2618219_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222790
NZ_CP048286.1\|WP_162640257.1\|2612685_2614311_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270298
NZ_CP048286.1\|WP_162645201.1\|2615331_2616213_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NZ_CP048286.1\|WP_162640249.1\|2598907_2600224_-\|response-regulator	unknown	unknown	gnl\|CDD\|381091
NZ_CP048286.1\|WP_162640255.1\|2610235_2612134_-\|DUF4091-domain-containing-protein	unknown	unknown	gnl\|CDD\|379121
NZ_CP048286.1\|WP_162640262.1\|2619990_2621823_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225519
NZ_CP048286.1\|WP_162640253.1\|2604027_2606979_-\|cadherin-like-beta-sandwich-domain-containing-protein	unknown	unknown	gnl\|CDD\|378939
NZ_CP048286.1\|WP_162640254.1\|2608847_2610257_-\|DUF4832-domain-containing-protein	unknown	unknown	gnl\|CDD\|374373
NZ_CP048286.1\|WP_162640258.1\|2614422_2615310_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP048286.1\|WP_162640251.1\|2601727_2602747_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380537
NZ_CP048286.1\|WP_162640252.1\|2603018_2603348_-\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|212139
NZ_CP048286.1\|WP_162640259.1\|2616467_2616719_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640256.1\|2612145_2612667_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162645200.1\|2607490_2608534_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372264
NZ_CP048286.1\|WP_162640246.1\|2595165_2595489_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP048286.1\|WP_162645199.1\|2596501_2597038_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162640247.1\|2595496_2596303_-\|HAD-family-phosphatase	gnl\|CDD\|223710	COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only].	1.02752e-31
NZ_CP048286.1\|WP_162640248.1\|2597179_2598649_-\|sugar-porter-family-MFS-transporter	gnl\|CDD\|182225	PRK10077, xylE, D-xylose transporter XylE; Provisional.	1.26085e-151
NZ_CP048286.1\|WP_162640250.1\|2600198_2601731_-\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	1.95337e-49
NZ_CP048286.1\|WP_162640261.1\|2618365_2619994_-\|response-regulator	gnl\|CDD\|381091	cd17536, REC_YesN-like, phosphoacceptor receiver (REC) domain of YesN and related helix-turn-helix containing response regulators. This family is composed of uncharacterized response regulators that contain a REC domain and a AraC family helix-turn-helix (HTH) DNA-binding output domain, including Bacillus subtilis uncharacterized transcriptional regulatory protein YesN and Staphylococcus aureus uncharacterized response regulatory protein SAR0214. YesN is a member of the two-component regulatory system YesM/YesN and SAR0214 is a member of the probable two-component regulatory system SAR0215/SAR0214. Also included in this family is the AlgR-like group of LytTR/AlgR family response, which includes Pseudomonas aeruginosa positive alginate biosynthesis regulatory protein AlgR and Bacillus subtilis sensory transduction protein LytT, among others. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	7.0465e-42
NZ_CP048286.1\|WP_162640260.1\|2617721_2618219_-\|hypothetical-protein	gnl\|CDD\|222790	PHA00430, PHA00430, tail fiber protein.	2.53161e-09
NZ_CP048286.1\|WP_162640257.1\|2612685_2614311_-\|extracellular-solute-binding-protein	gnl\|CDD\|270298	cd13580, PBP2_AlgQ_like_1, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	1.85582e-88
NZ_CP048286.1\|WP_162645201.1\|2615331_2616213_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	2.89733e-111
NZ_CP048286.1\|WP_162640249.1\|2598907_2600224_-\|response-regulator	gnl\|CDD\|381091	cd17536, REC_YesN-like, phosphoacceptor receiver (REC) domain of YesN and related helix-turn-helix containing response regulators. This family is composed of uncharacterized response regulators that contain a REC domain and a AraC family helix-turn-helix (HTH) DNA-binding output domain, including Bacillus subtilis uncharacterized transcriptional regulatory protein YesN and Staphylococcus aureus uncharacterized response regulatory protein SAR0214. YesN is a member of the two-component regulatory system YesM/YesN and SAR0214 is a member of the probable two-component regulatory system SAR0215/SAR0214. Also included in this family is the AlgR-like group of LytTR/AlgR family response, which includes Pseudomonas aeruginosa positive alginate biosynthesis regulatory protein AlgR and Bacillus subtilis sensory transduction protein LytT, among others. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	7.39271e-43
NZ_CP048286.1\|WP_162640255.1\|2610235_2612134_-\|DUF4091-domain-containing-protein	gnl\|CDD\|379121	pfam13320, DUF4091, Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.	0.00360412
NZ_CP048286.1\|WP_162640262.1\|2619990_2621823_-\|HAMP-domain-containing-protein	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	8.12521e-55
NZ_CP048286.1\|WP_162640253.1\|2604027_2606979_-\|cadherin-like-beta-sandwich-domain-containing-protein	gnl\|CDD\|378939	pfam12733, Cadherin-like, Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.	2.65284e-13
NZ_CP048286.1\|WP_162640254.1\|2608847_2610257_-\|DUF4832-domain-containing-protein	gnl\|CDD\|374373	pfam16116, DUF4832, Domain of unknown function (DUF4832). This family consists of uncharacterized proteins around 200 residues in length and is mainly found in various Bacteroides and Capnocytophaga species. The function of this family is unknown. Distant homology analysis suggests a possible similarity of proteins from this family to TIM barrel glycoside hydrolases and, subsequently its involvement in carbohydrate metabolism.The domain lies downstream of glycosyl hydrolases 42 suggesting that as a domain it might represent the carbohydrate-binding region of the enzyme.	1.68796e-19
NZ_CP048286.1\|WP_162640258.1\|2614422_2615310_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	3.92806e-70
NZ_CP048286.1\|WP_162640251.1\|2601727_2602747_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380537	cd06314, PBP1_tmGBP, periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs. Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs from other bacteria. They are members of the type 1 periplasmic binding protein superfamily which consists of two domains connected by a three-stranded hinge. TmGBP is specific for glucose and its binding pocket is buried at the interface of the two domains. TmGBP also exhibits high thermostability and the highest structural similarity to E. coli glucose binding protein (ecGBP).	1.79581e-85
NZ_CP048286.1\|WP_162640252.1\|2603018_2603348_-\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|212139	cd11532, NTP-PPase_COG4997, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in a group of uncharacterized proteins from archaea and bacteria. The family includes some uncharacterized hypothetical proteins from archaea and bacteria. Although their biological roles remain unclear, the family members show significant sequence similarity to the dimeric 2-deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTP pyrophosphatase or dUTPase) and NTP-PPase MazG proteins. However, unlike typical tandem-domain MazG proteins, the family contains a single MazG-like domain.	1.13576e-36
NZ_CP048286.1\|WP_162645200.1\|2607490_2608534_-\|hypothetical-protein	gnl\|CDD\|372264	pfam12715, Abhydrolase_7, Abhydrolase family. This is a family of probable bacterial abhydrolases.	2.34805e-08
NZ_CP048286.1\|WP_162640246.1\|2595165_2595489_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	1.46511e-29
NZ_CP048286.1\|WP_162645199.1\|2596501_2597038_+\|transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	9.61912e-33

>NZ_CP048286.1|WP_162645200.1|2607490_2608534_-|hypothetical-protein
MAEVYDRRARQLALRAGSKEEYAAWKEQVRGRLREITGMNTMEGCELSPRLLGSEQMDGYRRDKLIIQTEPGVWMPLYVLVPDGAGSPPEGMRTPCVIAAHGHRTAGKLSVAGRSEIPAVKAQIGVYNNDYGVRLAQEGYIVFCPDARAFGERREWTLQGDDDESFIGSSCAQLNHMAIGLGQSLTGMWTWDLMRLADYIETRADCGAIGCVGLSGGGLQTLWLAALDDRIQAAVLSGYFYGYKDALLKLSDNCACNYVPNLWTCVDMGDLGALIAPRPLLVESGTNDRLNGERGIANVYEQVDITRQAYRLFDAERELQHFVFEGGHMWRGDQTYAFLDRHLRAGV
>NZ_CP048286.1|WP_162640253.1|2604027_2606979_-|cadherin-like-beta-sandwich-domain-containing-protein
MMKFRRIFSVAIMISMLAAYFALPASADAATDNALYNFESGTQSFFVDGGAANGTVAKSSEQAFAGASSLKVNFNVPIGSASKGINVGVANPNLIIGATYAMHVYIPSGANIKAMLPYVMDNTWSWVNSYYDVAPMVKDGWNTVKLTIPAKQGNGTTDYKTPLNQVGIQFLVDTGGYTGSAYIDSITLESVPVAPPSPASLSSLKIDGAPVIGFDANKTAYVAHVPNDAASAAVTAAAVDPAASVSISGDGSLAVGENNVAVTVTAPTETKVYTVKVIRGLPANQGNRISIQGREFYANHERIWFNGANTPWDKWNDFGGAFNYAFWDTHFQQLHDNGVNASRVWITSNGEVGIDIDENGHVAGATAAHWNDLDSLFYLAQKHGVYIMATLMSFDHMKDSHPNYTSWRNMLASDANIDSYVNNYVIPFVNRYKANPYLWSIDFMNEPDWVYEDAHDGNFPWERLQTLFAKESVAVHTNSQVLTTAGLAMVKYNSDTCDPVTKGCKGNMVGDAPLMAAAGGNPLAKLDFWSGHYYDWMGQYWGNPLYTTPALFGMTDDRPSVIGETAAIGTQGHTLTDDIASAYENGWQGIFPWTSNGVDGLGNLTNVGPAASAFRDAHPELVFPVGLAHDANLSDLQVDGATVAGFAADTPSYSVEVPNSTTSVDVFAAVEEAHATVAVTGGVDLTVGDQNTVTLVVTAEDGVTTKTYTITIKRAKSSNANLSDLKVNGATLDGFSADTHSYSMLVPLGTASVAVTATAADDKAIFAVTGGTKLVNGENTVTVVVTAEDGTKQTYTITVNRAKSSNALLNDLKVNGQTIAGFASGSFNYTLDVPNGTTLVTVTAAVSDPKARKVSVRNDNKLVVGANEITVRVTAEDGTKQYYTIIVNRAKSSNASLSGLKVGGKAVEGFAPDQFAYTVQAASNAKSAKVSAAAADKTASVIIIGANKLMDGDNPYTVLVIAQDGTRLTYTVHVVRAPSVPKK
>NZ_CP048286.1|WP_162640252.1|2603018_2603348_-|nucleoside-triphosphate-pyrophosphohydrolase
MPVYNKLVRDRIPSMIHANGKACRTRILDEDAYKHELTLKLKEESEEYFAAQEPVDSLEELADMLEVIRALAAVHGATWEELEALRGQKAEARGGFRDRVYLIDVDDNG
>NZ_CP048286.1|WP_162640251.1|2601727_2602747_-|sugar-ABC-transporter-substrate-binding-protein
MKIRLWNVGLILLTLLFAGLFALFASAVQHTRELTSQLKPPREASADKTARIALIAQVQNNPFWRSVEEGAASASERFGMDLEYMGPVRIDPAEQTRLLEKAIAERFDALLVQGQSNAANARLIDQAAARGIPVITVDADEPGSARLAYVGTDNRAAGQRLGEYVVRSVGESGKIGVLIGSEANNQQLRLAGFRSVVERYPGLTIEDVRSSNISRLQAEEQAEDMLRSHPELKAIIGLSALDGLGIAEAAKHLKADGLLVFGFDDPGSTRQEIGSCQIAAALVQQPNRMGEEAVTLVHDYMQGRKPTEFHYTGTTVLDRASLADAQDGTQAVAPTERCR
>NZ_CP048286.1|WP_162640250.1|2600198_2601731_-|sensor-histidine-kinase
MTIRAKLLIVIPLLVLAANTTIFFLFRSSTLVQDGYDQMLNRMLAYKQSVQTSDQSLQALYDYLLDPGPALQSEMTRLNGMLRLGGDSIRQLGQLPALAPKATGYLNMIDTLADQEQYAAEASDTPKEALARYESAEKTAGFIREEGQRLVDLELGADQPIFRQIQQENERMNRFGLAVILVQTLLCVCTAVWLSRSVTGPVGRLVRMARHVSEGRPQEQLPAPSVPSRDELGILTTAFLQMIASLHEAADRDKEQLERERFVKELELRALQSQIQPHFLFNALNVLSKLALLEGAERTSDLIVSMSKLIRYRLRKLDEPVSLRDELGHVAEYAAIQQARFGGRIRFETEIDEQALSAKLPALTVQPLVENAFVHGIESIEAGAVIRLAVTVDGSEAVIEVADNGVGMDEATRRSLLQLNYEPHEPNSDSEQDSDADEDAALPQGTKRPEPASMSAGLGTRNVFRRLQLFTGRGDAVEIRSAPAQGTTFTIRIPMTPKEEAADVPFNDRG
>NZ_CP048286.1|WP_162640249.1|2598907_2600224_-|response-regulator
MYRLMIADDEALEREGLEWIVQRMLPDTFEIVQAENGRRAIELAEERRPNIVLMDVQMPGIQGLEALQEIRKLLPDAKFVLVTAYDSFHYAQAALSLGVKEYIVKPASREQVASLLRRLAAELDEERAKRAEQLHLINKVSTLQPLVENELALILMMDQTQGSSAEQLAEWLEFPLEECRCLVAAFPGSEFAPDRQSLYETIRRTAKSFGPCLVSSIVEHHLAVFLRKPPQAADTWKEEPVRFARKLADTVKSLIKKDISIGIGSLRSGADGMRQSYFEAVFASTYSDPICVFDDLQQGGQEPLPQQRAGGEGWQSYVTSALQRIRDIREEQTLTIIDRAKHYISQRFAEDLSLEEAAESVHLNQFYFSKVFKQHVGETFIDYLTGLRIDRAKQLIEEDVLSLKEVSYQVGYKDPNYFSRVFKKVTGVAPSEYRSQLK
>NZ_CP048286.1|WP_162640248.1|2597179_2598649_-|sugar-porter-family-MFS-transporter
MTTTTSSEARAGQDAQLNMKYVTLISIIGAVGGLLFGFDTAVVSGAVGFLQDRFHLGDFGAGWAVSCLIIGAIVGAIASGWLSDALGRKKALIGAAGLFIIGSIGTALPDTFTGYVIARMISGLGIGITSTLCPLYNAEIAPARYRGRLVALNQFAIVTGIFLTYFANSGIAGSGSDAWDVTTGWRWMFGVGVIPGLIFMILLFLVPESPRWLIKKGRPEKALNILLRIHGEAAAKQEVLEIKESFKQHSSMRELFKPGIRFALFVGIGLAVLQQVTGINAILYYAPEILKQTGAGDNAALIQTILVGFINMVFTVLSIWLIDKAGRKALLLTGTSVMAVCLGLIGLLFHTGHSSGYLVLVLILAYTAAFAVSLGPVVWVMLSEIFPNRVRGLAISVASMFLWVADYAVSQSFPSLLSWAGSAATYWIFGVMSVITVIFTMVFVPETKGRSLEQMESLWNRGATIDSQEDTSSSSMTIHSKLSPSNSKR
>NZ_CP048286.1|WP_162645199.1|2596501_2597038_+|transcriptional-regulator
MREPASKREELRVKVIDAIAQTMDLYGVNYSFGQLYGILFFEDRPMTLDEMQASMNMSKSNMSYAVRSLMDSSMVFKLEEKADRKDLYAAETDFFKAFQLFFATKLQREIDVMRGALDAVIPMLSETILEMDTSEEERKLCLQDLHKLKHAVHYYEWLQQFVNKLQNGTFFDGQQVNE
>NZ_CP048286.1|WP_162640247.1|2595496_2596303_-|HAD-family-phosphatase
MIPKGGIGVAWLYADGERFPIEAILFDKDGTLLDFIYTWGKWSERVFTQFAKQLEARNLPPMDVDLSALWGTRHDRHGEVVDYDRNGVLSMGTVEDLMITLAWQGHRLGMTWAEAKEAAYASRQYAEEQLDIARDAKALPGVVEFLEQCRGCGLKLAVVTADETSGAVKHLEWLGLERYFDVIIGTDQVERGKPFPDMAMLACRRLGVTPAQAAVIGDTNGDMRMARSAGAFVTIGIAKPDASSVLQLPDADKVIASFHELRLSADER
>NZ_CP048286.1|WP_162640246.1|2595165_2595489_-|multidrug-efflux-SMR-transporter
MGWFLLGCAIVLELSGTVSMKLSNGFARLTPSILMFVFYGGSFTMLNYALHYLQISVAYAVWSGIGIVLITFAGLSIFGEKLQPASYLWIGVIVIGVIGLNISSKGH
>NZ_CP048286.1|WP_162640254.1|2608847_2610257_-|DUF4832-domain-containing-protein
MVRKRFVVRPGVIDDVLVNPGIGFTTFQRFNGDQLNAGNKWTEGFPIDYQPFEGSLANKDHPMTSIAYYRIYWRFLEPEQGQYDWELIDRALRTAQERKQTLMLRVAPYGECELSDVPDWYRRLPDVSGNPIQPRWRVDPEDPRYVSCFGGFIRALGERYDLHPGLESVDMAIIGSWGEGEGSELLTQPTREALMDCYIDSFRETPLLMLLTDDRTNRYGLSRAAVGWRADCLGDMGGYWSNLKDIVGWRADSANEYWDIPLDWSHMTDCYPQLITLTGVQDAWKKAPVSFEVCWVVQDWYDRGWDIDYIIDQSLKWHISTFNAKSSPIPQEWEPNVRRWLNKMGYRYALRKITYPESVEPGGELDITTWWENLGVAPCYRRYPLALRLRNDSGSTVLRTDADIREWLPGDTLYDGAVALPADLLPGRYQLELAILGTDAVVPAVQLAVEGRQSDGWYTLGGIEVAAKI
>NZ_CP048286.1|WP_162640255.1|2610235_2612134_-|DUF4091-domain-containing-protein
MDIYLIKDYARVDGVTGQFVEREYGHEFEKFDRELVLHTARNQHVSFQVIVNAAGEPVDSADISFDDLRGPGRLSAKDAEAFVEWFHETEGQAIPDCLIPLNSGYPFRIPQHADYLPGQQVGALWVDWFVPRDAAAGTYEGVVRVRANADEKEFVLRLVVHAVTVPDQSLMTADLNAYADSISPVFPHLSANPNRYEDGSFFDVERQVVAMAREHRSLYHNLGYKHSGIVIPSFAPELEGEGKNIRVKSWELFDRHFGPYLDGTAFADSRRGAYPIEYLYLPFHVNWPARFEKWGKKGFRTEVRRIMAEFIRHFEEKGWTRTKLELFLNHKKQYRFYPFTLDEIWYEHDEEPFEQYYDIIKDTYDSTSVPFLFRTDESNHYGNHYHNKYADMCDLWVVNAGMFSWFPDSIEAMKHKGNVVWLYGGVIRKLSSNFMTLFSWPMQTFMTGADGFCVWNAFGHGTSDYLKAPNADEIIMYPGSRFGIEGPLPSIRLKFLRNAMQLADVMMSTNGYDYETRTMFNRKVRDIVNGHYGFEGDNGWWKKTPDFVDTPPRIWDFSAGGLVEQACSPEASHGKSPRLIECIHRDVLTYLGGSGLFPATTSAASESESASESSSVGVAQTKEVHAWSESGS
>NZ_CP048286.1|WP_162640256.1|2612145_2612667_-|hypothetical-protein
MTEVPQGGRGGNRRALDYDTKGDDGMSTYLELDIDSVVRIGLMYLDGDRFEEVLLDRHGHTDYDFARFTDVKNDLTRLENINPKLNLCAVLWQLHPANRQVAIPVVAGKSLPLEEWTRTAASPEMLSVMESGRPQVKKRNASRISRYYPVRNSDDEIVGILELLQGMEQIEDL
>NZ_CP048286.1|WP_162640257.1|2612685_2614311_-|extracellular-solute-binding-protein
MNKNWIRVQAAACVAFVMLFSAACSSKNNDNGGASSTDGSTNVSAKTADTAADPLAKKLKITAFEGLWGKVLPSDSPGVKAIDEKFNIDYKPEFVPMDQAQQKIAVLMASGSQPDILGLEGVDSNFIKWAKQGAFLPLNDYIDKYPQLQQIPKSIWDSVSVDGKIYGIPQYFHVKYMNSAVIRKDWLDKLGLPMPSNYDELLQVSKAFTEKDPDGNGKADTYGFSTSKGIDWNNRMGVYYDIGAWYHKNEQGQLIPGIISDDANLDRLKFMQDAYAAGTVPKDWPVMEYTDARQVFWSGKAGIYYEGIPGTGSMWNLLSENAPDAEVVPIPPFKAPDGSQGQPGMSGYYTMKTLSSKLANDPDKIDRILTMVNQFMTFTPFDQRNPQNENYDWKQGGVDKGYTYANGVADLSGDNDAKVAARPSTFFTVQEWAPSDEALELDKGLKNPKEAAYAKAVIEEWNKPNYVYIDPFSSIHSDVFNEKMGALYDKVMDGETKIILGQEPLSYFDTIKADFLKNGGQAIIDDVNKQIEAVGATGTWK
>NZ_CP048286.1|WP_162640258.1|2614422_2615310_-|carbohydrate-ABC-transporter-permease
MHFRTRGELVVDRLNVALLFVIAALMIFPFFYMLVVSFTSYREYMNTDLLLWPKTWVLDSYRYIFSSKQFMQSIGNTVWITVIGTVIDLAMTSTMAYGLSRQVPGRKYINFMVLLTFLFSGGMIPTYLVVKATGLIDTSWALILPGAISAFNLLIMRQFFMGIPNELTEAAIIDGASEMKVYTHIILPLSKPVLAAFGLFCAVGHWNTFFDAILYLNNPDKWTIQVILRQIVVLSDTASSLKPTLMAQQVRDQHLPPPETIGMAAILVATVPILFVYPFLQKHFAKGVMLGAVKG
>NZ_CP048286.1|WP_162645201.1|2615331_2616213_-|sugar-ABC-transporter-permease
MWHMRFIYLLLLPGIAYFVIYKYVPMVGIMIAFQDYSAFTGIWHSDWVGFAHFKEIFDDPDIVQILFNTLYLSLLQLLFAFPVGIALALMLNELRNHAYKRTIQSIVYLPHFVSWIVVIGLVNTFLSEKGIVNSMLGLLHLPQSNLLTSPGWFMPLLLLEGIWKETGWGTIIFLAALSGINNELYEAGVVDGASRMRLMWHVTLPALRGTIALLLILQLGHVLDTGIEQIMLMINALTKDVGTTLDYYVYVKGILNADFSFSAAFGLFKSLIGLILILGANKLTKKFGEEGAF
>NZ_CP048286.1|WP_162640259.1|2616467_2616719_+|hypothetical-protein
MKFGTLEHRSGVKFGTLEQRSGVKFEALEQRSGVKFEALEQRSGVKFGTLEQRSGVKFEALEHRSGVKFGTLEHHSGVKFEGS
>NZ_CP048286.1|WP_162640260.1|2617721_2618219_-|hypothetical-protein
MAKSEEPRAKSQEPRAKSQEPRAKSREPRAESQEPRAKSQEPRAKSQEPRAKSQEPRAKSQEPRAKSQEPRAKSQEPRAKSQERRAKSREPRAKSQEPRAKSQEHQEPRAKSQEPRAKSQEPRAKSQEPRAPRAESQEPRAKSEEPRAKSQEPRAKSTKSQEPRT
>NZ_CP048286.1|WP_162640261.1|2618365_2619994_-|response-regulator
MNLLLVEDEIRQLNNVATCIPWEEHDIEIVGMARSGKEALAMVALRKPDIVLLDLQLPDMNGLEIIRSLRASGESVSFVILSGHNDFSYARDALELGADQYLLKPAGNAEILAVVSKLAERLRAERETEHDNQRLKRMWETSLPALQALFLRDLVRGKYAADDSLQHAEEYFPGRPPLQAEDEYVVVIMEMDPLPASEIRYSQKDTPLLRLALQNLAADTLWASNCLLFPDDEAKVVAMFGCREEESGEALVLRVNVTIARLLARVQDSLKMTASAGIGSKVVLKEIEISFRQANRALHERVVFGYNVVIPYHPQPIGAGIPAPDRAFERKLQGAMESGDDNAACEHVEQWFRETCSVVPSLDALQEHVLFLHSFIVRMIHAQGWSVAEVAKHDYESFLRPPELVSKEQTLQWMLRAVEAYMTYGSEQRNLHTNRLIVAVMELAKGKMDMEMTLHDIADQLYMNPSYLSRLFKRETGLTFTAYYQDLKMQRARELMVGGAKVYEAARQVGFKDIGYFTRLFRKFWGVTPGEASGSVIHYSSE
>NZ_CP048286.1|WP_162640262.1|2619990_2621823_-|HAMP-domain-containing-protein
MSVVTRDRAPFRRSTQKRLTFFFILPIVPLIFISLYAISQSENIVVRQAGENNRAAISAALGFIDQFTDTAQRLSLQISNDSTLNAMLDVQGSEATMIYEASQILNRLATYKLANDMIQDIWILDTNLGMIISRQHGGKRIDYAHRNWYSQAIAGMGSSVLYIPHATKEISPGVPDPVDNVDLVTFTREMGFNTSNPSSHVVGITVSRQTLTQFALNLLNTKHSQFQILDADNRVIASYADASVSDEAARGLNSKYGFIKLKKHMLDSRVVSQVSGWSIELAQPESVLNQGTRQLQAFIIAISVLSIFLALIVSWIVYVGISAPLAKLLGGIQQIRRGVWDVNLKSKRRDEFGMITDTFNQMAMQQKQYLQDIYTQQVQKTRTELKFLQSQIDPHFLYNTLDSIYASAVQYGADETSEMVLNLSRFFRLSLSKGRDTFTVKETFEHLSYYIRIQEMRFLDHFEWEYQIDEASEPVPILKLLLQPLVENAIIHGLEKAPPGGRLTIAAANENGILSLRVRDTGNGIPEDRLRKIQSELVRNRVDSFNLERAKPNDFYGLTNVCSRLRLYYGNRAEMTIASIAGQWTETTIRIPVEACYGAPPIERTGGENL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_7

3012826-3013123

Orphan

Consensus_repeat	Method
CANTGTACTGCACTGGGTGCAGCTCNTTGCTCG	CRT

5 spacers

The CRISPR arrays of NZ_CP048286_7

>merge|NZ_CP048286|7|3012826-3013123|CRT
TCCAATACTGCACTGGGTGCAGCTCCTTGCTCGAATTCACCGCTTTTCCTCCAATGTACTGCACTGGGTGCAGCTCTTTGCTCGAATTCACCGCTTTTCCTCCAATGTACTGCACTGGGTGCAGCTCTTTGCTCGGATTCACCGCTTTTCCTCCAATGTACTGCACTGGGTGACACTGGGTGCAGCTCCTTGCTCGGATTCCCCGCTTTTCCTCCAATGTACTGCACTGGGTGCAGCTCTTTGCTCGAATTCACCGCTTTTCCTCCAATGTACTGCACCGGGTGCAGCTCCTTGCTCG

>NZ_CP048286|7|1|3012826-3013123|CRT
TCCAATACTGCACTGGGTGCAGCTCCTTGCTCG	AATTCACCGCTTTTCCTC
CAATGTACTGCACTGGGTGCAGCTCTTTGCTCG	AATTCACCGCTTTTCCTC
CAATGTACTGCACTGGGTGCAGCTCTTTGCTCG	GATTCACCGCTTTTCCTCCAATGTACTG
CACTGGGTGACACTGGGTGCAGCTCCTTGCTCG	GATTCCCCGCTTTTCCTC
CAATGTACTGCACTGGGTGCAGCTCTTTGCTCG	AATTCACCGCTTTTCCTC
CAATGTACTGCACCGGGTGCAGCTCCTTGCTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162640551.1\|3000167_3001082_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP048286.1\|WP_162640557.1\|3011593_3012379_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162640559.1\|3013397_3014336_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|130256
NZ_CP048286.1\|WP_162640561.1\|3015238_3016051_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP048286.1\|WP_162640553.1\|3004733_3005315_-\|dienelactone-hydrolase	unknown	unknown	gnl\|CDD\|223489
NZ_CP048286.1\|WP_162640555.1\|3008031_3008475_-\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|119346
NZ_CP048286.1\|WP_162640556.1\|3009198_3011472_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|378963
NZ_CP048286.1\|WP_162640567.1\|3020783_3021959_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374209
NZ_CP048286.1\|WP_162640554.1\|3005427_3006513_-\|gluconolaconase	unknown	unknown	gnl\|CDD\|308585
NZ_CP048286.1\|WP_162640560.1\|3014332_3015124_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|272861
NZ_CP048286.1\|WP_162640565.1\|3019323_3019809_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162645238.1\|3007085_3007871_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381364
NZ_CP048286.1\|WP_162640562.1\|3016173_3016767_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|377164
NZ_CP048286.1\|WP_162640564.1\|3017386_3019126_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP048286.1\|WP_162640552.1\|3001145_3004451_+\|helicase-SNF	unknown	unknown	gnl\|CDD\|223627
NZ_CP048286.1\|WP_162640566.1\|3019901_3020600_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180753
NZ_CP048286.1\|WP_162640563.1\|3016947_3017328_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319909
NZ_CP048286.1\|WP_162640549.1\|2998677_2999055_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640568.1\|3022355_3022649_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162640550.1\|2999120_2999981_-\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162640551.1\|3000167_3001082_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	8.5022e-23
NZ_CP048286.1\|WP_162640557.1\|3011593_3012379_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.38767e-21
NZ_CP048286.1\|WP_162640559.1\|3013397_3014336_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|130256	TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc. [Transport and binding proteins, Other].	3.79406e-104
NZ_CP048286.1\|WP_162640561.1\|3015238_3016051_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	4.7922e-08
NZ_CP048286.1\|WP_162640553.1\|3004733_3005315_-\|dienelactone-hydrolase	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	7.26326e-12
NZ_CP048286.1\|WP_162640555.1\|3008031_3008475_-\|ASCH-domain-containing-protein	gnl\|CDD\|119346	cd06554, ASCH_ASC-1_like, ASC-1 homology domain, ASC-1-like subfamily. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation. The domain has been named after the ASC-1 protein, the activating signal cointegrator 1 or thyroid hormone receptor interactor protein 4 (TRIP4). ASC-1 is conserved in many eukaryotes and has been suggested to participate in a protein complex that interacts with RNA. It has been shown that ASC-1 mediates the interaction between various transciption factors and the basal transcriptional machinery.	3.67357e-20
NZ_CP048286.1\|WP_162640556.1\|3009198_3011472_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|378963	pfam12831, FAD_oxidored, FAD dependent oxidoreductase. This family of proteins contains FAD dependent oxidoreductases and related proteins.	5.15071e-133
NZ_CP048286.1\|WP_162640567.1\|3020783_3021959_-\|hypothetical-protein	gnl\|CDD\|374209	pfam15902, Sortilin-Vps10, Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.	5.76275e-06
NZ_CP048286.1\|WP_162640554.1\|3005427_3006513_-\|gluconolaconase	gnl\|CDD\|308585	pfam03022, MRJP, Major royal jelly protein. Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts.	4.04026e-30
NZ_CP048286.1\|WP_162640560.1\|3014332_3015124_+\|ABC-transporter-permease	gnl\|CDD\|272861	TIGR00025, Mtu_efflux, ABC transporter efflux protein, DrrB family. The seed members for this model are a paralogous family of Mycobacterium tuberculosis. Nearly all proteins scoring above the noise cutoff are from high-GC Gram-positive organisms. The members of this paralogous family of efflux proteins are all found in operons with ATP-binding chain partners. They are related to a putative daunorubicin resistance efflux protein of Streptomyces peucetius. This model represents a branch of a larger superfamily that also includes NodJ, a part of the NodIJ pair of nodulation-triggering signal efflux proteins. The members of this branch may all act in antibiotic resistance.	5.17487e-17
NZ_CP048286.1\|WP_162645238.1\|3007085_3007871_-\|aldo/keto-reductase	gnl\|CDD\|381364	cd19138, AKR_YeaE, Escherichia coli YeaE and similar proteins. Escherichia coli YeaE is the prototype of this family. It acts as an aldo-keto reductase (AKR) that catalyzes the reversible reduction of ketones to the respective alcohols using NAD(P)H as a hydride donor.	3.10067e-148
NZ_CP048286.1\|WP_162640562.1\|3016173_3016767_-\|PepSY-domain-containing-protein	gnl\|CDD\|377164	pfam03929, PepSY_TM, PepSY-associated TM region. The PepSY_TM family is so named because it is an alignment of up to five transmembranes helices found in bacterial species some of which carry a nested PepSY domain, pfam03413.	1.77294e-08
NZ_CP048286.1\|WP_162640564.1\|3017386_3019126_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	3.98724e-58
NZ_CP048286.1\|WP_162640552.1\|3001145_3004451_+\|helicase-SNF	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	6.9528e-110
NZ_CP048286.1\|WP_162640566.1\|3019901_3020600_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|180753	PRK06924, PRK06924, (S)-benzoin forming benzil reductase.	2.16934e-65
NZ_CP048286.1\|WP_162640563.1\|3016947_3017328_-\|glyoxalase	gnl\|CDD\|319909	cd07245, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	5.00677e-28
NZ_CP048286.1\|WP_162640550.1\|2999120_2999981_-\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	2.80353e-32

>NZ_CP048286.1|WP_162640557.1|3011593_3012379_+|helix-turn-helix-transcriptional-regulator
MQELAFPPFPEETEWVYWHHKEAFQLAEDTYARWVLFAVESGGFRYRILDEEGTAAAGDVVVCPPGVRFEREVVQPLSFAFISFTLRADDLSSLPQGRVNTGDTARLLHNLAQLKPSHPHDSSAWHPYGAHYAADIWLQCLQTFGRRRQAPAEPADAAMEAAASWLRSHVEAKAALSEAAALCGLTPVQFTRRFQRAFGMPPQQFMLSLRMAEARKLLVSTDWTLDRIALSCGYENGFSLSRSFVRLTGIRPSSYRGLHRL
>NZ_CP048286.1|WP_162640556.1|3009198_3011472_-|FAD-dependent-oxidoreductase
MLEQTVKTDIVVVGGGLSGVCAAVAAARLGQTVSLVQNRPVLGGNSSSEVRVWVCGATGHGVNRYARETGIMGELFVENQYRNMEGNPYYWDLVVLETVRAEPNIQLFLNTDVHEVEAEGPAEDRIITAVTGWMMGSERRIRFEGDVVLDCTGDGLVGFLAGAKYRIGREAKAEFNEDWAPEIADDITLGSTILFYSKDMGRPIKYVPPSFAKDITQTSIPVRRVIRSGDSGCHYWWIEWGGELDTVHENERIRDELWSVIYGIWDFIKNSGQFEADNMTLEWVGSLPGKREYRRFVGDYMLNQNDVVEQRAFDDKVAFGGWSIDLHPPQGMYAVESGSKHFYADGNYAIPFRSLYSANVRNLLFAGRNISASHVAFGTTRVMATCAVIGEAAGTGAALCVKKGVTPRTLQAEHMGDLQQTLLRQDAAVIGLRNADPLDLARATAAVEASSTLSLAQWPLHGTGGELVSHAHALEKPVGILVPVDPRLDGVELLVDAEEATELVVEVWETGREENYIPHRLLSRHSCRVEQGAKQWAAVDGSGARLQSAPCNVFLVVRENARLRLHAAEGTIFGMLGFEYHGDLPIDELPENSQRVTLWRTGPFNRKAVCVKLSPGTKAYAADKAVDGYVRPFGGPHLWMSDVMEEGREEWLRLQWPSPVGMREIHLTFNDDVNEDLINLHHHTTPFPVMPDLVKDCRIEALTDEGWTVLERIQDNRKRKRVIALPAAVAASALRIVVESTNGSPFAQVIEVRVYGQ
>NZ_CP048286.1|WP_162640555.1|3008031_3008475_-|ASCH-domain-containing-protein
MKVLSMIQPWATLLVQGETLYETRSWKTRYRGPLAIHASRKVDKQACKYEPNRSLLAKNGYTEQTLPTGVILATCELTNCYQVIDANHTSAILDCGKVVTGDDFLLGDYSPGYFAWEMAGFRLLKPYIPVKGKLGLWEYPIVEELTI
>NZ_CP048286.1|WP_162645238.1|3007085_3007871_-|aldo/keto-reductase
MGDEPSKKNEELRALRRGVELGLRLIDSAEMYGDGRSESLVGEAIEGIRDQVFLVSKVYPHNAGLNRIAGSCEQSLKRLKTDRLDLYLLHWRGSIPLSETVEAMEQLVEAGKILRWGVSNLDTDDMKELFDSARGTHCMVDQVLYHLGSRGAEYDLLPWLRERKIPTMAYSPLAQAGTLRRGLVEHPAVKEIADRHSVKPLQVLLAWCIRNDDVIAIPKASTAVHVEENAEAERIKLTEEDLGMLDEAFPKPTRKVQLDII
>NZ_CP048286.1|WP_162640554.1|3005427_3006513_-|gluconolaconase
MLPIEKYFGNLELVYTFYGAMPTGVSVSETGRIFVCFPKWGDDVRFTVAEIVDGHLQPYPNLATNSINPSDRTKSFISVQSVIADGRGTLWVLDTGAPNFSEPIKGGAKLVAVDLITNTIRKIYTFDEEVVLPTTYLNDVRFDFRVGTSGYAYITDSSSRGPGAIIVVNLENGNAFRRLNGAHSTSPDPYFLPKVEGEILMNRNRDGSTSPFRLASDGLAISPDGKMIFFCPLTSRQLYSISAEALRDRTIPDSELSYHVKYWGEKGASDGMITDAKGNVYAGDYENDSIRKIWPNGIMETIAHDPKILWPDTFSIGPDRHLYVIVNQLHRQARFHYGKDLRQKPYSLLRIKIDELPAPTC
>NZ_CP048286.1|WP_162640553.1|3004733_3005315_-|dienelactone-hydrolase
MAEILLLHHSLGLTKGIHAFADKIRGAGHTVHIPDLFDGHLFATIEDGMTYVNGIGFEEITERGIRSASEFPREIVYAGVSLGVVAAQKLALTREGARGALLFYSCVPTSMFGSPWPAELPVQIHGMDADPYFVDEGDIEAARELVTAADHAELFLYPGDQHLFADSSLPSYDADATTLLLRRVLEFLRHLDA
>NZ_CP048286.1|WP_162640552.1|3001145_3004451_+|helicase-SNF
MNHTLTLSAIQSMCGQLSYKRGEAAFRSGKVAVTYYDADAGRCEANVQLQENFEVTLRIDEDGDVTAQCSCPSLSSYDKYCSHIAAVLLLILDAQQAGRTPAGSGAAGGRGDAKLRGDDRHLLTEPADDRLARGLLELFAPQTGRTVPASQTRFDTRTPFPLAFVCKPFAYGRGKRMLGIEIKAGAKRPIIVPRIREFLQCAANGEPCAISKSLAYDPRQHCFGAADFAVLEQLIAMAEQERLYRDTSGVYAAYASPMSGERMLLIPPPAWEPLLAALAAAPSTVMEIDNVVYAAISPTDERLPLHFELEEHVTGIGCRLRMQGLTEMTVLDAYGLVLAEGKLFRQPPEACSRLLELQELLEQADEPQSLPLPPGQIEPFMERAMPGLLKLGSVRIAEEVAERITQRPLRAKLFLDRIRDRLLAALEFHYGDLVINPLESEHERRGNGPILMRDGDRERQILALMEGASFAKTEAGYFLGDEEREYHFLQHVVPQLEKLLTIHATSAVRTRIHIGSLPPNVALTLNERTNWLDVKFDIAGIPESEIKAVLKSIEEKRSYHRLRTGALLPLDSDEMKEIIRFINEGRLTAKDLRDSGIHIPLFRGLHLMDVPRQGGAVKLDKAFRRLLDNLRSPDNLDFPEPQELLHPLRDYQAYGYQWLRTLAHYGFGGILADDMGLGKTVQAIAFLASMLPNIREERLPAIIVAPASLTYNWRNEIRKFAPHIRAVIADGTKAQRNAVLASCSSADVVITSYPLLRRDVVEYAALSFHTLILDEAQAFKNDATQTAHSVKLLRARNRFALTGTPVENRLEELWSLFDAVCPDLFPGRKAFGDLARETIAKRARPFLLRRVKADVLKELPDKIESVQASALLPEQRKLYAAYLAKLREETLRHLDKETLNKNRIRILAGLTRLRQLCCHPALFVEDYAGSSGKLQQLLELIEECRSAGRRMLVFSQFVEMLKLIRQELHRRDVSYFYLDGSTPPSDRIELSNRFNDGEGDLFLISLKAGGTGLNLTGADTVILYDLWWNPAVEQQAADRAHRIGQKNVVQVIRLVAEGTVEDKMVELQERKKNLIDEVIQPGEEPLSALTEDEIKELLMLT
>NZ_CP048286.1|WP_162640551.1|3000167_3001082_+|AraC-family-transcriptional-regulator
MTSPTMSEQSPYRDVAPYRPLLIENELEFRAELPFDARSSSLYYIGEQLMPNWATTSHYHDHFELCYLEEGHGQYQIDKTLYQIRAGDLWLTKPGETHYGLAGKDAPFRLYYMGFKLEWMKALQPDFYQLGAGRVVPDEDGTVKWIFERLLREVRLRPRLSFHMAEGLFLQLLVTVSRLFHDSAKQPDAHPNPLGSAVIAVMNRLHGEIRYDHDIEAIARSIPISRSHLAREFKSAIGMPVGEYMRSLCLDKAKFELRATDKPVTQIAEELHFSSIHTFSIFFKRFTGSTPSEYRKQAAGETRK
>NZ_CP048286.1|WP_162640550.1|2999120_2999981_-|phytanoyl-CoA-dioxygenase-family-protein
MTTIHKQVNDACLPAREDVEFFDKNGYWVSPVIFSEEELAAIKDHQDRIYRGEFETGRAPVCNWLEGVDNPRALRKTDNSHWSDSVLRGVATDPTIGAIAGMLMHADTIRLWHDQLLYKPGRGPGRETANVGWHQDFSYWQCAKEPTLVTAWVAFTDVDLSNGCMQMVPRSHQWGLLKMSDFFEQNMEKQQADMDIPENEQFTTKPIIMKAGQVSFHHALTIHGSGANTTEEARRSMAVHLMTGETRYKQGTRGDGHFNAGFMKGRDGELFDGPEFPVLYGASANK
>NZ_CP048286.1|WP_162640549.1|2998677_2999055_+|hypothetical-protein
MKRKTAIICATTVMLLVIASILFTKQAHEARDVRGDYIIGKDNSGETPKILVARNIKASERSSAAPTLAMSKSRKIDFMYYRLSDLSLYNDLQIGDRVTVKPPSGAYVIDQSWPPQMNAGEVIHY
>NZ_CP048286.1|WP_162640559.1|3013397_3014336_+|ATP-binding-cassette-domain-containing-protein
MNRTAIATKGLRKSFGQQTVLDGIDLTVQSGTIFALLGPNGAGKTTLINILSTLTKPDGGTASVNGHDVVREREDVKRSISLTGQFAAVDDMLTARENLRMMCRLSGFTPADARSRTAELLKLFDLEASAGKLVKTYSGGMRRRLDLAVSLVASRPVLFLDEPTTGLDTVSRRALWDMILELRDRGMTIFLTTQYLEEADLLADRIAVIAGGRIVASGTAQELKSRFGGELIELHGADEEILAVYATDGSLQHIRNTLNELAEQVSPDTRISLRKPSMDDVFVALTTTSTTSSSTTSTTSTSSTAKVEEAVQ
>NZ_CP048286.1|WP_162640560.1|3014332_3015124_+|ABC-transporter-permease
MIHTTSAPDKGVSFGATNAVFIGRSIRLSLRNTEALVMAIMLPIMLMLLFTYVFGGAIAPGGEYVNYVVPGIILLCAGFGSSSTAFDVAQDMTNGIIDRFRTMPIRSLSVIIGHIAASLARNLMATGVVIGVAFLVGFRSSAGLLDWLAAIGIIALFILALTWLFATIGLIAGSPSAASGYGFILLFLPYLSSAFVPTTTMPHWLQGVANNQPITPVIETIRGLLTGTPIGNSAWLAVAWCIGILLLAIIWSVIAFNRKAGRR
>NZ_CP048286.1|WP_162640561.1|3015238_3016051_-|TetR/AcrR-family-transcriptional-regulator
MTDRNDSADNSADKDEVLEQLPSGVALSWGIVKQGKRGPKGELSIKQIVDAAVAIADQDGLQAMSMSRVAQSLGFTTMSLYRYIASKDDLLLLMQESVCTPLPEDKPGQHWRDGMREYVDLCVDVFTRHPWYSDIPITGVPVTPNIMAMVDWVLRMMRPLDLDEFEKMSIMLLMSSYGRSIGQIRRDMVMAMKAGRNAEEFSGLPFSPALKQLVTPERFPDLYPIVMSGVYAGEREAESTVGDDLDFGLERILDGVEQYLERRRKPSGEA
>NZ_CP048286.1|WP_162640562.1|3016173_3016767_-|PepSY-domain-containing-protein
MVLIENALESWIYPIDAHPTAGDIGIAATVNSYEKQIPTWFGFESKEAVPDPAKKTEAKDGAAILPFGQALGMEQEKYPHGKLITVTLPQKPGDTYQFGVKEGFGASSGSNSTIDMDASNGEVLYKMHPNWAINLYNTWRKGLHFATWGGVTTRWITFVFGMMPFVLMVTGLTIWQLKARARKKGKNRNMDRTTAVA
>NZ_CP048286.1|WP_162640563.1|3016947_3017328_-|glyoxalase
MIRHEGIHHVSLIVTDLEQAKRFYEEVIGLREIERPAFDFPGAWYGIGSGGQQLHLIVHEGQTLRSAGIDTRDGHFAIRVADFDETIAWLDRCGIEHRNNRNSITGFSQIFLLDPDRNIIELNAAR
>NZ_CP048286.1|WP_162640564.1|3017386_3019126_-|methyl-accepting-chemotaxis-protein
MKKSLLTFTVGRKLLFAFLVLVLMLCFLGFASLSSEKRMADNTKVITTNWLSGVEIANNINYLTEHVLNYQLRILSEADKTKKADDMKEASKLLGAVDDAMDSYAATYANEKDKATAEKLRSKWNAYKQVYEQAASLGTKVDLINGSGNKASEVVQIMDESLKAFEDMQLDLKQLVQLNHRGAEEATKESEDAYRNSRIEVWIIMAAAVVIAIFLVVLINASISRPIKRAAETLRRIADADLSVESQPAKSKDEIGTMIGAMNEMTDSLRSMMTGIRQAAGTLTTSSEGLRASSEQNAGATQHVAEAVQEVASGAERQQHSAGETSRAMEEMATGIQRIAETASTVADLTIEASRHARDGNEAIASAVERMNAISGSVDQAGADIEMLEGHSERIGEIVVLIGDIASQTGLLSLNASIEAARAGEQGRGFAVVASEVKKLSEQSAESVHGIAEVIAEIQRDTLKAVQTMQRSRGDVQRGIDAVSGAERAFGQIVATARQVAERVQEVAAAAQQMAAGSEEVSASVHDMSAISREAAQSTQSVAAATEEQLASVQEITAAAQSLSSIAQGLSDMVGKFKM
>NZ_CP048286.1|WP_162640565.1|3019323_3019809_+|hypothetical-protein
MMKTALALLVLLLGGWLGSLRSNAAPDADWHKLQDGEAVSVQVVGSLHGITPSPLYTVATSEGRAIVATIVRWYNAAPPNGVQPFYGRHGYPWKLRIDLSDGSDIMIEQAYDCTTRAFSNHSEKSCASADGEVVFHVQSKELRGKNRELYDWLAGGWRTQQ
>NZ_CP048286.1|WP_162640566.1|3019901_3020600_-|SDR-family-NAD(P)-dependent-oxidoreductase
MRYFIITGSSRGIGKAITEKLLSPNHHLFCLSREVNQALVSLAASKNAPLDYFAFDLNNLNGIDDLVHQIVGKIDDADAESIYLINNAARIKPVEVINRSAHEEVIDHMQINLIAPMLLTSSFIKYTDAYKTDKRVMNISSGLSFNLKPMLSCYSTSKAGLETFIKSIGVEQDTVKIMGVRPGATDTRMYEESAITDERAQSVRLASPNYAADRILTFLMDRFEHGKVVKGW
>NZ_CP048286.1|WP_162640567.1|3020783_3021959_-|hypothetical-protein
MIGKLPKLALAALLAAATLTGFGANAGTSAAAAASAPKAAAPCRTDDHGLALKAMKDTSDPYLESIQFLSTNIGRAAGNGFMIGTSDAGCHWQTIYNTGKLSFTQMQFLTNTTGYVLAQTAYGQPNTLLKTANGGSSFTWIPTGQHPFDRIQFLNEQTGFGYTRAFTYKTANGGKTWSKLPTPPNTRYVHFMTEQKGWAIIVLATGGYEVKRTVDGGKHWTDSLKVKSQTNVGGMIYGTDSSDVWVLLYGDSGMSQTSYSVFHTSDAGAHWKQVISHPTAGAGPAPGPVAPNGKLAGPAGRPTDMAVIGRQAAFMVAGSGAIDDLQFGRSLDDGKTWTNLPGAAPGYDGKLSFLSAATGYLAVTSFEKPAVYKTTDSGKTWKAVFSLPAKP
>NZ_CP048286.1|WP_162640568.1|3022355_3022649_+|hypothetical-protein
MSSQPAIVYTSRICDSDTMTNKLIYQIRQNQLSPTELNKLQARCNRELNELRQELNDLLNDLRAIADRSKTEPSAADRVAAAGSTSNNQTAPRKTAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_8

3053581-3053655

Orphan

Consensus_repeat	Method
TTTCGTACAAAACGCCGGCCTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_8

>merge|NZ_CP048286|8|3053581-3053655|CRISPRCasFinder
TTTCGTACAAAACGCCGGCCTCAGTCGGCCTCGCTCGCTGCTTTGTACGAGTTTCGTACAAAACGCCGGCCTCGG

>NZ_CP048286|8|7|3053581-3053655|CRISPRCasFinder
TTTCGTACAAAACGCCGGCCTCAG	TCGGCCTCGCTCGCTGCTTTGTACGAG
TTTCGTACAAAACGCCGGCCTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162640595.1\|3055858_3056968_-\|Nif3-like-dinuclear-metal-center-hexameric-protein	unknown	unknown	gnl\|CDD\|376614
NZ_CP048286.1\|WP_162640599.1\|3060499_3061792_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226444
NZ_CP048286.1\|WP_162640591.1\|3052656_3053430_+\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_CP048286.1\|WP_162640600.1\|3063473_3069380_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|306825
NZ_CP048286.1\|WP_162640582.1\|3037949_3038630_-\|ribonuclease-H	unknown	unknown	gnl\|CDD\|260015
NZ_CP048286.1\|WP_162640588.1\|3049046_3051191_+\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|306825
NZ_CP048286.1\|WP_162640583.1\|3038757_3040059_-\|NCS2-family-permease	unknown	unknown	gnl\|CDD\|225161
NZ_CP048286.1\|WP_162640587.1\|3047452_3048739_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP048286.1\|WP_162640597.1\|3057729_3058452_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP048286.1\|WP_162640598.1\|3058473_3059337_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270428
NZ_CP048286.1\|WP_162640589.1\|3051259_3051820_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP048286.1\|WP_162640594.1\|3054879_3055818_-\|homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|181899
NZ_CP048286.1\|WP_162640590.1\|3051979_3052660_+\|esterase	unknown	unknown	gnl\|CDD\|223477
NZ_CP048286.1\|WP_162640596.1\|3056995_3057733_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP048286.1\|WP_162640593.1\|3054117_3054618_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240043
NZ_CP048286.1\|WP_162640592.1\|3053711_3053939_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP048286.1\|WP_162640585.1\|3045378_3045852_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP048286.1\|WP_162640584.1\|3040278_3042045_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227059
NZ_CP048286.1\|WP_162645241.1\|3062287_3063343_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380629
NZ_CP048286.1\|WP_162640586.1\|3046395_3047184_-\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|213023

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162640595.1\|3055858_3056968_-\|Nif3-like-dinuclear-metal-center-hexameric-protein	gnl\|CDD\|376614	pfam01784, NIF3, NIF3 (NGG1p interacting factor 3). This family contains several NIF3 (NGG1p interacting factor 3) protein homologs. NIF3 interacts with the yeast transcriptional coactivator NGG1p which is part of the ADA complex, the exact function of this interaction is unknown.	7.97239e-44
NZ_CP048286.1\|WP_162640599.1\|3060499_3061792_-\|hypothetical-protein	gnl\|CDD\|226444	COG3934, COG3934, Endo-beta-mannanase [Carbohydrate transport and metabolism].	3.15357e-11
NZ_CP048286.1\|WP_162640591.1\|3052656_3053430_+\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	3.22927e-114
NZ_CP048286.1\|WP_162640600.1\|3063473_3069380_-\|hypothetical-protein	gnl\|CDD\|306825	pfam00395, SLH, S-layer homology domain.	4.03898e-08
NZ_CP048286.1\|WP_162640582.1\|3037949_3038630_-\|ribonuclease-H	gnl\|CDD\|260015	cd13935, RNase_H_bacteria_like, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. This family includes bacterial ribonuclease H (RNase H) enzymes. RNases are divided into two major families, Type 1 and Type 2, based on amino acid sequence similarities and biochemical properties. RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner in the presence of divalent cations. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. Most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site residues and have the same catalytic mechanism and functions in cells. RNase H is involved in DNA replication, repair and transcription. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription.	3.94414e-65
NZ_CP048286.1\|WP_162640588.1\|3049046_3051191_+\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|306825	pfam00395, SLH, S-layer homology domain.	1.91429e-12
NZ_CP048286.1\|WP_162640583.1\|3038757_3040059_-\|NCS2-family-permease	gnl\|CDD\|225161	COG2252, COG2252, Xanthine/uracil/vitamin C permease [Nucleotide transport and metabolism].	4.60006e-146
NZ_CP048286.1\|WP_162640587.1\|3047452_3048739_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.13884e-72
NZ_CP048286.1\|WP_162640597.1\|3057729_3058452_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.28765e-77
NZ_CP048286.1\|WP_162640598.1\|3058473_3059337_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270428	cd13710, PBP2_TcyK, Substrate binding domain of an ABC transporter TcyJKLMN; the type 2 periplasmic binding protein fold. This group contains periplasmic cystine-binding domain (TcyK) of an ATP-binding cassette transporter from Bacillus subtilus and its closely related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.81568e-67
NZ_CP048286.1\|WP_162640589.1\|3051259_3051820_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.16637e-20
NZ_CP048286.1\|WP_162640594.1\|3054879_3055818_-\|homocysteine-S-methyltransferase	gnl\|CDD\|181899	PRK09485, mmuM, homocysteine methyltransferase; Provisional.	0
NZ_CP048286.1\|WP_162640590.1\|3051979_3052660_+\|esterase	gnl\|CDD\|223477	COG0400, COG0400, Predicted esterase [General function prediction only].	1.17051e-32
NZ_CP048286.1\|WP_162640596.1\|3056995_3057733_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.16119e-140
NZ_CP048286.1\|WP_162640593.1\|3054117_3054618_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240043	cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	4.1821e-45
NZ_CP048286.1\|WP_162640592.1\|3053711_3053939_+\|hypothetical-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	2.66744e-08
NZ_CP048286.1\|WP_162640585.1\|3045378_3045852_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	8.62975e-15
NZ_CP048286.1\|WP_162640584.1\|3040278_3042045_+\|hypothetical-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	6.17438e-05
NZ_CP048286.1\|WP_162645241.1\|3062287_3063343_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380629	cd19974, PBP1_LacI-like, ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	2.10373e-83
NZ_CP048286.1\|WP_162640586.1\|3046395_3047184_-\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|213023	cd10918, CE4_NodB_like_5s_6s, Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.	1.18354e-59

>NZ_CP048286.1|WP_162640591.1|3052656_3053430_+|dioxygenase
MMPAYFFAHGAPSLVLEQHAYTDFIKQFAGSTRKPKAIVLFSAHWEQTTQTISKVETYDTIYDFSGFQDELYSITYPAHGNPNLSEYIGALFAKHGIPSQFDDNRGLDHGAWAVLKLLYPDAGEIPVVALSVNRHLTNEQQYAIGSALAELREQDVLIIGSGGTVHNLRRLNWGSDGVDPWAGEFDNWLQSKIEAWDTDALFDYRSQAPFAQEAVPTNEHFIPLLIAMGAGSKNRTAKLLHRSYQFGNLSLSCWQFD
>NZ_CP048286.1|WP_162640590.1|3051979_3052660_+|esterase
MTAAFQYDIHLPAQLEGGKRYPVIFTLHGKGSNERNMFGLVSPLAEQFIIIGIRGNRILGNGYQYYDLKSLGNPIREQFDQSMQELTDFIAYATSKYPIDAQRRYLLGFSQGAILSMSLALTMGDQLKGIVALNGYVPAFVKTEYSLRSVEQTSMFISHGDFDSVFPVSIVHENAAYFQPLASKLTFKTYPTDHGVSPENQQDYTQWLLQDAGLTDTNDNQGGIQR
>NZ_CP048286.1|WP_162640589.1|3051259_3051820_-|helix-turn-helix-domain-containing-protein
MDIGSTIRAIRKRKDITIAQICEDTGLSQGFMSQVETNKTSPSIATLENIANALKVPLAYLLLRKEERMQIVRKTDRKVTTSGPERLKVEHLSAAKNMRMMLVELPPGASTGDEPHAHEGEEVHMVIKGRIYAEQGEDAAEFGEGDSFSWNACTPHLVRNIGEEDAIVLISVYTESERAESYYDQQ
>NZ_CP048286.1|WP_162640588.1|3049046_3051191_+|PQQ-binding-like-beta-propeller-repeat-protein
MRMGSNRRRWKAFALTAISMVVFASGLPDSRTFALSGVVDIPGIDITGPVTPIKTIPDVVTPIVQTHPLRWKLILGNYVGTPAIAKDGTIYAAVHNGTSTSSDTDYIAAVTPYGTLKWSWKAPQSNDPGPLSGITPAIGPDGTIYVRTKHQLYAIDANGRTKWSFQEDLPSATAFGADGTVYVGNNSSIIYALSPGGGQVKWKYVGNSLYSVVAGTNGDLYGMELHAAGGGRSVLALSSSGTKKWSYSLGTNDLGSLRLAPDGSVLAFTYNKLFSIKPSGALKWEFNAAAPYDNFAQSTDGGMYLKGWVSETAPHSRVFAVSADGKKKWEWSVDASDPVVYGSASTDLNLKLGSGADGSLYATEYNYLYAVSSAGKKLWKYKEPEKRSLETPVASPDGTVIVVGGSDFGAAVQNSALLAIGTVPAEGVMLQQPSLSLETGKSAALKATVTPAAAVEKSVRWQSSNPAVAEVNAGGQVTGRSPGTAVITVTTVEGEYTASCTVTITAGSTTPGTTTPGTTAPGTTTPGTTTPGTTTPATPFTDIAGNWASADIAKAYESGITKGYTDGTFKPNASITRSEFTVMLMKGLKVSGDNTPLTFKDAGKIEAWAAPSVAAAVKLGIISGYSDGTFKPQANITHAEMIAMVVKASGLPTTADAATSYADDALVPAWAREAIAVAGKYSLLGGLQDNRFQPSAKATRAEAAAAIVRMLAIP
>NZ_CP048286.1|WP_162640587.1|3047452_3048739_+|MFS-transporter
MRMKDWDRNLKIRLGGESAFNVIFWTFFPFLSIYFTKSFGKGWTGMLLVLSQLISVLANLVGGYCADRFGRKRMMVFAASGQAFGYALFAFAASPWVDMPVTGFVGFSLASMFGSLYWPASQAMVADVVDEKHQSSVFAIFYTAANIAVVVGPLIGSLLYSDNPYAVLAAAAVICALIALVMSRLLGETLPASVSDRHRTKAGTPWYGAIAAQLRDYRVIATDRVFLLFVIAGVLLAQTFMQLDLLFPVFLKETVGQSTLFAFHDWDLTVTGQQLFGLIVSENGLFVAVFTVIITKWMTMYRDRYVFMGGAIFYAAGMIMFSSMSTFWGFTAAIAVFTLAELMSAGPQQAFVARLAPEEMRGQYFAAASLRFTLGRTIAPLSIPLTGWIGFKWTFVLLALLAVISAGIYNVMFNQLEKNQPSPSLAPR
>NZ_CP048286.1|WP_162640586.1|3046395_3047184_-|polysaccharide-deacetylase-family-protein
MRKRKMLVLAAALLFMAASFVITADQLLQFKRTTVAFASSDAAAARIPVLCYHSIADNGAGNEYIVSPDAFRQQMAWLHDEGYRSIGMEEFGAILTGQEASTGKEVLITFDDGYKNNYTAAQPILKQYGFQATEFLVTNWVGGEAYLTWGQVKELHAAGWDIMAHTRTHPYLPLHTPKVQRDEIAGSKTAIEKNLGTSVTAIAYPYGLRSEETMRIAKQSGFAYGFTFDDGYTTSEQNPYLLKRLFISGDTDLAGFQRKMKS
>NZ_CP048286.1|WP_162640585.1|3045378_3045852_+|GNAT-family-N-acetyltransferase
MESKSTKGAPNSTNNSYEIIERSPTVSEHQALWDSVSWGNLDTGMSEQSIANSIYAVVVEIEGQAVGMGRIVGDGAMYFYLQDVAVHPDHQGHGLGKRIVERLLAYIRQHKHEKGIAFVGLFASQGKEPFYEQFGFKDHSPGMTGMFTVFEPTAPQE
>NZ_CP048286.1|WP_162640584.1|3040278_3042045_+|hypothetical-protein
MDTDLMMDDTAWRKLLEGVAAYFDELTIIRGFQYHKQGRVETLGLRDDGVYLDARVKDNRVYEVAVDLGDLSKSTCACPLDRGCLHMVAALLRYAELCGRPIQALVNARAAARNAAKADAAEAGTGDGRLAGKGAGKAVAGDGTETGTGKSGAGKEGAGKEGAENSPLRAGTPSARLVRPTLTEQELTELPVALWHDRFRQRRGPLQANIRTAQEASDLLADLHAMRPDLPYALEQLFNLHAALFVLEQIVKPAQANWRQSGLFMGYHTQLALDGLLAQTRRMLEERLALSSETSAYWERLLETAAFLREQMLTEDKTLNCFASLYQSFWLHWLSPASAGSKHLYEEELQHLREAQQVLGNALSPLPWTLAQCLLWLYLERDEEALRLLAERGGKLLLKPEHLMPLLDVMSRAGQWERLRDWLVETGALLTGFRGEDLAPYGEYWSIVAEQLPEAKPAMWNTLASMLPFSRVIYEEALVAHGKWERWIDYQMSSGQEPLSFRVAVLKPIEKDAPELLLPFYHQAVERYVLQKNRDGYKAAAKLLKRLSKLYVRLKREERWEQFISAFASRNSRLRALQEELRKGGLLS
>NZ_CP048286.1|WP_162640583.1|3038757_3040059_-|NCS2-family-permease
MDKLFKLQERGTSAGTEIMAGITTFLTMVYIVIVNPGILSKTGMDFHGVFIATVLASIVATLIMGLFANYPIVLAPGMGLNAYFAFTVVSPDDGVTWQIALGAVFVAGLIFILLSLTSFRYMLLDAIPTSLKHAITAGIGLFITFIGLQNAGVIVASPSTLLTLGDLTEPMTALTIVGLVISLVLMAYRVRGFLFVGMLITAVIALLMDQMDLPSNLVAMPSGLDATAFRLDIGGVFEKGLYAVIFTFLLITLFDTTGTMLGVAEQAKLLKDGKFPRSQGALLADAAGTSVGALLGTSPTSAYIESSAGVAIGGRTGLTAVVVCVLLALTLFFSPVIAMLAGMPAITAPSLIIVGFLMLDVLRRIEWSELEEAFPAFLIVVLMPLTYSIATGIGIGFIAYPLLKLARGKGRDVHPVFYVFAVLFFIQIVFFSH
>NZ_CP048286.1|WP_162640582.1|3037949_3038630_-|ribonuclease-H
MAKQKFYVVWVGRQPGVYASWGECQEQINKFDDAKFKSYESRAEADEAYRGGWKKFWGQGGGAKAAGGSGAAKSGSGQFRRKPSAAEAEPGEIDYDSISVDVGTSGNPGPVEYKGVDTQTGEVIFAVGPVKKGTNNLGEFLAIVHALALLKQQGSSKTVYSDSMNALKWVKQKNVSTTLPRDASTVEIWDMVDRAVRWLQTNTYSNKVLKWQTKQWGEIKADYGRK
>NZ_CP048286.1|WP_162640592.1|3053711_3053939_+|hypothetical-protein
MAEIKESLRDKAAGKTAAIMLISDKSFSLMQDHTYSGNVVYGTLGFQAPAMAAGSDWKDFSLEVLPELNATCVQR
>NZ_CP048286.1|WP_162640593.1|3054117_3054618_-|NUDIX-domain-containing-protein
MTRPPFRLRACALIIKDGNILLVAFRNDEDEGVHYNLPAGGVEPGETLAEAAIREAMEEACVDIEVGPVAFVYEYQPAKNDNRYGDTHSVGITFACSLKGSSEPRLPDRPDLNQIDVRWVPIAELDQVQLYPEITRDIMDYYAGKPYRNYVEEHEIQTEKAARERE
>NZ_CP048286.1|WP_162640594.1|3054879_3055818_-|homocysteine-S-methyltransferase
MNPIALILQQYPVLILDGAMATELERHGCDLNDSLWSAKVLMDNPELIGRVHTDYFAAGADAAITASYQATVEGFRGRGLNEAEAVALIRRSVRIAVEARDAFWAEPGNRPGRLKPIVAASVGPYGAFLADGSEYRGDYALTEEELADFHRERMRALIEAGADVLACETIPCLREAKAIIGLLEAEFPGVYAWISFSAKDAQHISSGETIAECAQWLDAHEQVAAVGVNCTPPQYINALVGEIGRHTAKPVIAYPNSGETYDPADKTWTSAGSVDSYGCSAKQWHEAGARLIGGCCRTTPADVKAIAAWVRS
>NZ_CP048286.1|WP_162640595.1|3055858_3056968_-|Nif3-like-dinuclear-metal-center-hexameric-protein
MYATGQTIIERFEQWAPKRLALPNDRIGLQLGTLRSEVRKVLVALDVTEEVVEEAIREQVELIIAHHAIIFRPLEDLQTDQPAGRLYAKLIKHDIAVYIAHTNLDAAEGGVNDLLAEALGLRELDVLRFVHAEKLKKLAVFVPQTHHRQVLDALFAAGVGHIGDYSNCSFNTAGEATFMPSDSARPFIGEAGVLERVAEVRIETVVPESLVRQAVHAVIAAHPYEEVAYDVYPIEHEAKRYGIGRVGQLPEALALGELASHVKDVFGLDAVRVVGELSRTVRRAAVLGGSGGKFVQDALRAGADVLITGDIDYHTAQDAKAAGLALIDAGHHIEQIMKRGVAAYLTICLADTDTKVTASEVVTEPFHTV
>NZ_CP048286.1|WP_162640596.1|3056995_3057733_-|amino-acid-ABC-transporter-ATP-binding-protein
MIQLQQIHKYFGEHHVLKGIDLTVGKGEVVAILGPSGSGKSTLLRSVNFLERPSSGVITINGRRVEAASATKEDILALRTSTAMVFQQYHLFKNLRVLQNVMIGLTTVKKMTSAKARELSAALLEKVGLKERMNHYPSQLSGGQQQRVGIARALALNPEVLLFDEPTSSLDPELVDEVLAVIKQVASEGNTMLIVTHELNFAREVADRIVFMEDGAIVEEGTAEQMFTNPRAERTKQFLSKAIKQ
>NZ_CP048286.1|WP_162640597.1|3057729_3058452_-|amino-acid-ABC-transporter-permease
MDKLLDVDYLLKSLPHILKYLPVTIWIAVATMALGMVIGLATALIRLYKVPVLRQISAVYVSFVRGTPLLVQIYLVFYGIPKFIYYLQTQHGWMKGFDVNLISPEISVLLSFSLNLGAYLSETIRSAIESVDRGQFEAAESIGMSRKQTMLKIILPQALTVALPNLGNTFISTVKDTSLVFIVGVIDIMGEAKIIGARSLAYFEVFIAVSLIYWPVCIIIERVLAIVEKRIRKYERSAIS
>NZ_CP048286.1|WP_162640598.1|3058473_3059337_-|transporter-substrate-binding-domain-containing-protein
MRKSKAIAAFGITMALAAGVLSGCGSSSSNDSGSNAANDASSAGNAGSAKEKTIYVGTQNDYPPFAFVDDKNELTGYDVEVLKEVDKKLDGYKIEFTPTTWDSIFLALESNKIQLIADEVARSAEREEKYLFSDESYFAAQTVIIVKKGRTDIQTLKDLEGKNVGAVAGDSYTQILEEYNKSHDKKINLKYTDSTSPADVLQQVQNGRIDAYVNDPVMMKATIKKQNFDLDIVGDPIQADNIGIVFNKDKQGEDLKALIDPILKGLKDDGTLAKLSQKWTEGEYIPQ
>NZ_CP048286.1|WP_162640599.1|3060499_3061792_-|hypothetical-protein
MDKQTFVTRSGSGLQLEGKTFRFAGPNIYWLGLDENVGGVDWPTEFRVANALDTALEMGATVVRAHTLAASQGCSKAIMPELGEYNEEAFRKVDFAITEAGLRGLRLVVPFVCNWSYYHGGRETFTKWRGLDDRDAFYTNSDVIADYKAYIAMIVNRVNSFTGIAYKDDPAIMAWELGNELNDAPAAWVADIADYIKSLDGNHLVAHGKQFQLDRDKLAIDSLDILDVHYYPANAAELIKDAEAVAAAGKVYMAGEFGWPQCDLAAFLTAAEEHAAVSGTLFWSLFPHHDTCGYVQHFDGFSVHYPGNGVNEDAAVRFAQLRAHAFAMSGKAVTEHSVPEAPVIAEHNGAIAIRGVVGAAFYTVEKSTVSPEGPWHVLADKRPADHDMPWTDATRAHTVTTWYRVKAHNLSGQAGPYSAALESAAFTPQR
>NZ_CP048286.1|WP_162645241.1|3062287_3063343_-|LacI-family-transcriptional-regulator
MQKVTLQSIADKLNVSKALVSKALSNDPAVNEVTREVIWKTAEEVGYRIKSAKKSGTPTGSGNLALLMPRAYLDDPEYWGKIIKGIDKELESQSYSLLLSGLDVAVRINEGMPSSITENKVEGAIVLGQLPDVYTDQLKKKKLPFVLVDPSAQDPDIDMVLANNYQGAYQAANLLLAEGHRRLAFVGDADTTWSFAERFRGFGDAVQAFNAKRGDAANAASLVVVEGMGVSGTGMYTKPSFPEELQRRLTGDQPVTAMFCANDLIAIDSLAHFAGWGLECPRDVSVVSFDNLSLAELKEPQLTTVNVPMEEIGVKAAQLILERIAEPGKLPELVMISTTLVQRNSTQARQA
>NZ_CP048286.1|WP_162640600.1|3063473_3069380_-|hypothetical-protein
MTRLRKFTFKRSISLLSAAAVLGGLLSPIGSGAAVAYADEAPAASVFSNFITASGDQLMDGDQPFRFASLNYPGGMRDSDFSQEDALRTIAAIGGNVTRTYVPPVKRYDGANASYALILGPNDSGVMQFNEDGFKRLDHLLALANQIGVRLIIPFVDQWQWEGGIESYYAFRHPGTISGDAASDPDAWGFYTDPEVISDFKQVIHYMMNRVNTITGVKYKDDKAILAWETGNELGGYNQDKFPQAWTTEIADYVRNDENPSQLLLDGRFAVNNDSLSDPNVDIVGDHFYTGNFIDRINEDSAAAAGKKPYILGEFGLYTSGAPVDALYDAALKNGTDGIMIWSLRPHKDDGGFFWHDENPGNWASYHWPGFASGDYYGESDIIRTVYKYAHYMNAGDVAKTTAVPPIPAPANAPVLLGIDSVADIKWKGSVGASGYEVQRLPEGGTEWETVANGFSDGGRAGTPAFHDETALTGTAYDYRVRGVNESGASEWSNVVHVASAAHVITDEMSLLANDKEQRNVYAYDQSSNVLTGGGGEDGVGFKAYVATANPGYLTYASPVPLNSVSVTSAGSGTVKWFASATNGNYTEIHPAAQDGGVTTASDLPPGTRYVKFVIDGSNSVQIDRIQLTYAYDGTGYAAVPALTRNGFILDDSFSGKDAGKSENLSLQAAQPYTDNAPALGRTNGDAGAITYKTDGDIGSYRITSYSNVTDELKVYASADGDNYVQANPDVAKTPAGSGWSKVIYTDFALPAATKYLKFVYPATAAGAAPAIGRVEIGYGVNLIPLTDKPPANVFEDGEYDYGSDANVQARYERNVNGDDISIALDTANKNRGSYGVRVNYSLGSAYYAGLTQELGGVNLSAFDALHAWIKPDGSGNKLTFQLQTGDGRVWESTTPMTGTAGGTVELKLADFVQPQWNQDAAGAAEAIDLSSVSSFGIYVGGGDNASAASGAVYLDDVKLTNATKLDSFEGYGGYNALLNKAFSRNTGGGSFDLSLDKTHKSEGSYGLRVDYNFGGPGYAGGSFNPDFLNLKGYDGFSFWLQPDGSNNELAIQFTDASGKFWETKTVIRGTDPRLMYVPFDSFRYPSWYSGDTTARPDPKQNITAFSLYMGGGDSSLSTSGTLYFDDINGASFVDRLTDSAIAIDKSQTSVASLPYAISGTATGTPYVTLEAGKQVFYAPVQADGTWTYSTSKLPNGTVDIKASAQLYDGTVMSSDTYTVQVNVPNNPNTDGGGQPQQTNYLLDPGFEEAVDASAWPILPAHWMNKDADGNDVTDGIVKLEGGARTGAYKLVHWNNAPYEVTSSQRIDDLPDGIYELRAWTKSKGGQQTAEMFATVGNQEPLRTAIPAGESAWAYIKIQDIEVRGGGLTIGFHSKDVGDHWIGVDDVELVKTGDINYMSNAGLEDVVDAAAWPLLPVGWTHREANGNDVTDGTVKLEGEAHDGSYKLVHWNGSPYEVTSSTVVTNLPDGVYELSAWTKSKGGQEAAEMTAAVGADKHAVAIPAGEGQWANIKLSQLEVRGGSMTVSFHSKDAVGGNWIGVDDLALIRTGDLPTDPTDPTDPTGPTGPTGPTTPTTPSVPSAPQADVHNGIITIQPTKNAQGDAAASLREEDIRQALGQLSGRTLAIHLTGAEGAKAVQVDLPLQQFEANPEAEWITVDTGFAAVSIHRGALKNSAGAAASKMQLTVANVDPSTLPAEVRARLGGSAVYDFSLRLDGILVDRFQGNEVRVSLPYVLKPGEDPNHVVVYYIDDQNNLQSVKNGKYDPAAGKVEFSAKHFSKYAAAYVKVSFSDIAPLTWAVPGIESLAAKGILQGAGGSQFKPGQAVTRAEFITMLAAALDWTNEGSASSFKDVKAGAWYASAVAAAQKLGIVQGKTDGTFGINDPISRQDMAVMIYRAVKQQLPSVSAANAAAFSDGDAIGGYAAEAVQAVQGAGLMNGMPDGTFKPAGQATRAQAAVLVYRLLERFGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_9

3578753-3578858

Unclear

Consensus_repeat	Method
CTCTCACCGTTCAGTCGTAAAGTTCGC	CRISPRCasFinder

1 spacers

cas3

The CRISPR arrays of NZ_CP048286_9

>merge|NZ_CP048286|9|3578753-3578858|CRISPRCasFinder
CTCTCACCGTTCAGTCGTAAAGTTCGCCGCCCAGGTATGCATCCTACCCTGGTCGCGAACTTCTCTGATCCGTGAGCCTCTCTCACGGTTCAGTCGTAAAGTTCGC

>NZ_CP048286|9|8|3578753-3578858|CRISPRCasFinder
CTCTCACCGTTCAGTCGTAAAGTTCGC	CGCCCAGGTATGCATCCTACCCTGGTCGCGAACTTCTCTGATCCGTGAGCCT
CTCTCACGGTTCAGTCGTAAAGTTCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162641004.1\|3566819_3567908_-\|urea-ABC-transporter-permease-subunit-UrtC	unknown	unknown	gnl\|CDD\|132449
NZ_CP048286.1\|WP_162641013.1\|3569124_3570405_-\|urea-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|132448
NZ_CP048286.1\|WP_162641060.1\|3579938_3580589_-\|50S-ribosomal-protein-L25	unknown	unknown	gnl\|CDD\|235534
NZ_CP048286.1\|WP_162641080.1\|3582800_3583187_-\|RidA-family-protein	unknown	unknown	gnl\|CDD\|129116
NZ_CP048286.1\|WP_162641014.1\|3570761_3572396_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162641043.1\|3578905_3579466_-\|aminoacyl-tRNA-hydrolase	unknown	unknown	gnl\|CDD\|376485
NZ_CP048286.1\|WP_162641091.1\|3584122_3584977_-\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	unknown	unknown	gnl\|CDD\|234652
NZ_CP048286.1\|WP_162641008.1\|3567987_3568893_-\|urea-ABC-transporter-permease-subunit-UrtB	unknown	unknown	gnl\|CDD\|200272
NZ_CP048286.1\|WP_162641085.1\|3583201_3584038_-\|pur-operon-repressor	unknown	unknown	gnl\|CDD\|236414
NZ_CP048286.1\|WP_162641031.1\|3573715_3574837_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|234605
NZ_CP048286.1\|WP_162645281.1\|3566068_3566845_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	unknown	unknown	gnl\|CDD\|274568
NZ_CP048286.1\|WP_162640975.1\|3565395_3566091_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP048286.1\|WP_162641096.1\|3586089_3586965_-\|sporulation-peptidase-YabG	unknown	unknown	gnl\|CDD\|377528
NZ_CP048286.1\|WP_162641053.1\|3579651_3579852_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162641037.1\|3574823_3578351_-\|transcription-repair-coupling-factor	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|224118
NZ_CP048286.1\|WP_162641038.1\|3578462_3578693_-\|anti-sigma-F-factor-Fin-family-protein	unknown	unknown	gnl\|CDD\|371314
NZ_CP048286.1\|WP_162641094.1\|3585665_3585938_-\|Veg-protein	unknown	unknown	gnl\|CDD\|377636
NZ_CP048286.1\|WP_162641023.1\|3572564_3573611_-\|lactonase-family-protein	unknown	unknown	gnl\|CDD\|378416
NZ_CP048286.1\|WP_018759486.1\|3582377_3582662_-\|septation-protein-SpoVG	unknown	unknown	gnl\|CDD\|237321
NZ_CP048286.1\|WP_162641074.1\|3580854_3582255_-\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	unknown	unknown	gnl\|CDD\|184643

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162641004.1\|3566819_3567908_-\|urea-ABC-transporter-permease-subunit-UrtC	gnl\|CDD\|132449	TIGR03408, urea_trans_UrtC, urea ABC transporter, permease protein UrtC. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	7.44265e-153
NZ_CP048286.1\|WP_162641013.1\|3569124_3570405_-\|urea-ABC-transporter-substrate-binding-protein	gnl\|CDD\|132448	TIGR03407, urea_ABC_UrtA, urea ABC transporter, urea binding protein. Members of this protein family are ABC transporter substrate-binding proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. Members of this protein family tend to have the twin-arginine signal for Sec-independent transport across the plasma membrane. [Transport and binding proteins, Amino acids, peptides and amines].	0
NZ_CP048286.1\|WP_162641060.1\|3579938_3580589_-\|50S-ribosomal-protein-L25	gnl\|CDD\|235534	PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed.	1.49129e-59
NZ_CP048286.1\|WP_162641080.1\|3582800_3583187_-\|RidA-family-protein	gnl\|CDD\|129116	TIGR00004, RutC_family_protein, reactive intermediate/imine deaminase. This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes. [Cellular processes, Other].	5.62002e-63
NZ_CP048286.1\|WP_162641096.1\|3586089_3586965_-\|sporulation-peptidase-YabG	gnl\|CDD\|377528	pfam05582, Peptidase_U57, YabG peptidase U57. YabG is a protease involved in the proteolysis and maturation of SpoIVA and YrbA proteins, conserved with the cortex and/or coat assembly by Bacillus subtilis.	1.13381e-148
NZ_CP048286.1\|WP_162641043.1\|3578905_3579466_-\|aminoacyl-tRNA-hydrolase	gnl\|CDD\|376485	pfam01195, Pept_tRNA_hydro, Peptidyl-tRNA hydrolase.	2.82836e-96
NZ_CP048286.1\|WP_162641091.1\|3584122_3584977_-\|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase	gnl\|CDD\|234652	PRK00128, ipk, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional.	0
NZ_CP048286.1\|WP_162641008.1\|3567987_3568893_-\|urea-ABC-transporter-permease-subunit-UrtB	gnl\|CDD\|200272	TIGR03409, urea_trans_UrtB, urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease proteins associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	2.13416e-140
NZ_CP048286.1\|WP_162641085.1\|3583201_3584038_-\|pur-operon-repressor	gnl\|CDD\|236414	PRK09213, PRK09213, pur operon repressor; Provisional.	6.47699e-170
NZ_CP048286.1\|WP_162641031.1\|3573715_3574837_-\|peptidylprolyl-isomerase	gnl\|CDD\|234605	PRK00059, prsA, peptidylprolyl isomerase; Provisional.	4.78014e-22
NZ_CP048286.1\|WP_162645281.1\|3566068_3566845_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	gnl\|CDD\|274568	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	8.25707e-144
NZ_CP048286.1\|WP_162640975.1\|3565395_3566091_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	4.04611e-117
NZ_CP048286.1\|WP_162641074.1\|3580854_3582255_-\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	gnl\|CDD\|184643	PRK14354, glmU, bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU.	0
NZ_CP048286.1\|WP_162641037.1\|3574823_3578351_-\|transcription-repair-coupling-factor	gnl\|CDD\|224118	COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription].	0
NZ_CP048286.1\|WP_162641038.1\|3578462_3578693_-\|anti-sigma-F-factor-Fin-family-protein	gnl\|CDD\|371314	pfam10955, DUF2757, Protein of unknown function (DUF2757). Members in this family of proteins are annotated as YabK however currently no function is known.	1.19415e-31
NZ_CP048286.1\|WP_162641094.1\|3585665_3585938_-\|Veg-protein	gnl\|CDD\|377636	pfam06257, VEG, Biofilm formation stimulator VEG. VEG is a family that is highly conserved among Gram-positive bacteria. It stimulates biofilm formation through inducing transcription of the tapA-sipW-tasA operon. The products of this operon are resposible for production of the amyloid fibre (TasA) component of the biofilm. Veg or a Veg-induced protein acts as an antirepressor of SinR - part of the major overall biofilm transcriptional control system - to regulate and stimulate biofilm formation. Veg is transcribed at high levels during both exponential growth and sporulation.	1.38057e-30
NZ_CP048286.1\|WP_162641023.1\|3572564_3573611_-\|lactonase-family-protein	gnl\|CDD\|378416	pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller. This entry contains bacterial 6-phosphogluconolactonases (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyze 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonising enzyme carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and muconate cycloisomerase (EC:5.5.1.1), which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold.	1.9138e-133
NZ_CP048286.1\|WP_018759486.1\|3582377_3582662_-\|septation-protein-SpoVG	gnl\|CDD\|237321	PRK13259, PRK13259, septation regulator SpoVG.	9.99831e-55

>NZ_CP048286.1|WP_162641038.1|3578462_3578693_-|anti-sigma-F-factor-Fin-family-protein
MAVNYVCRHCKTSMGSIDNTQISEAQLGFHFLTPEERSDIIAYNSNGDVTVNVVCDYCREAIESNPELLLVVNPLQ
>NZ_CP048286.1|WP_162641037.1|3574823_3578351_-|transcription-repair-coupling-factor
MKALLEAYAADTDFVSIVSGIKKGMREQLISGLAGSSRQVMIAALKQEFDRPILVVTHNMFAAQKIAEDLVECLSADEVLLFPANELVAAEAAISSPETLAQRMDVLIRLSQGFRGIVVVPFSGVRRFLPLNTVMANARISLKVGETLALEAFLRQMVELGYERVDKVEGKGEMSVRGGIVDFFPLTSPHPYRVEWFDDEIDSIRTFDSSDQRSIEKLNEYSVPPCQELTADKRRFQNAAQHASDLLEQQLLKMTDRTAKDRLRSEIGSEIEKLREHHYFPEIYKYISLLYPERQTLFDYVPSDTLLIYDEPTRLIETGRQLERDEAEWSTHLMTNGKALPALALARPSDDVLFHRPFPTLFLSLFLRQIPHTQPQNILNVVSRAMQNFHGQMNVLKAEMERWRKAGATVMMLAGSAERMDRMRRVLQDYGIEPPILIEGNLQSGFELPSVHLIVITEGEMFSQKQRKARRLDKKMDNAERIKSYTELKVGDYVVHQNHGIGKYMGIGTLEIAGIHKDYMHIMYAGGDKLSVPIEQIDLIQKYVGNEEKEPKVYKLGGSEWTRVKSKAQSSVKDIADELIKLYAERQATTGFGFGPDTSYQQEFEAMFPYDETVDQLRAISEIKKDMQTPRPMDRLLCGDVGYGKTEVAVRAAFKSAIEGKQVAILVPTTILAQQHYETFRERFSGFPFNVQVLSRFRSKKEQSATMKGLKAGTVDVVIGTHRLLSQDVIFKDLGLLIVDEEQRFGVSHKEKLKRLKTNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVVEYSPSLVRESIERELARGGQVYYLYNRVQGIYQMAEQINALVPDAKVAVGHGQMSEQELEKTILDFLDGESDVLVSTSIIETGVDIPNVNTLIVHDADKMGLSQLYQLRGRVGRSNRIAYAYFTYQRDKVLTEVAEKRLQSIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGFIASVGFDLYSQMLADEIAKRKAEMGGEVEEQVKEVSTVIDMSIDAYLPSSYIYDSIQKIEIYKKVAAVRTFEEGDDLRDELVDRFGDLPQSVDNLLSVARLKVFGAICGIEQIGGKGEDFTLKFAEREKKRFDAKKVDRICLQLENRFARPSGQEPYPVVQLRGKGLAVEQKLELLERFLTQYKDTIQSKGELQDVTH
>NZ_CP048286.1|WP_162641031.1|3573715_3574837_-|peptidylprolyl-isomerase
MLRTKRARRTILLAIVAVLVVVLAAGCGSKKEEASSAAPGTAEGKTIATYKDGTVTDNEFKKYSTFFGIVQPQTEAYLSIPQLQEQFLREYIGYKILYKPLSDKKLSDEDQKAIDTFYSQVKQQFDADATIKKKADDAGLTEADIRYFYTMITSIMKDEESKVTDADVQKQYESTKDDYNIISVRHILISTVDPTTGAEKRTGEEALKIAKDVKAQLDAGGDWNVLAKKYSEDDGSKDKGGLYADQQAKGWVQEFKDAANKQEIGKVGDPVQSQFGYHVMKVEKRTPTAFDKLTAADKESLKQEASSAKLQAYMTDELPKLITKIDLPKAATTDGAGTGTNAGTTNTGKTNTGTNNADKKDDTATNDSKTESK
>NZ_CP048286.1|WP_162641023.1|3572564_3573611_-|lactonase-family-protein
MGQGLLYTGSYASREQEGVKAMRLQGHDGGLTERSGLAGIHHPSYLTVNAAGTRLYVVSETGAEPGSVLGYAIHPEDGALTLINEASTLGGSPCHVTMDATERLLIVTNYTGGTVSLYAIQEDGSLALADHKAHEGRGPRDDRQEAPHPHSSIIDAANRFALVADLGTDEMVHYRIDHEAQKLVRHHATKTAAGAGPRHMAFNSAGDRLYVVHELDCNVAVYSYDGETSEAALLQSVSTLPEGFAGENTCADIHVTKDGRYLYASNRGHDSIAVYRILQDGQLDRVEIVSSGGRTPRNFAISPDGQFLLAANQDSDTIIAFRIDAATGRLHATGESFETVKPVCIVFQ
>NZ_CP048286.1|WP_162641014.1|3570761_3572396_-|hypothetical-protein
MPTTIDFHTQGIKSILSQYANIVDQLAAIHQSVDPALLQRVQALQQIDAIINQILAAYTAIQNAPDVVTIDISGLIGGVQGSYAGLSQAIKDRIGEGTLTQLKTIDNVIKLAAAINEIKAFIAEASTYDQINSESVHAIILSAKEIYTAIAAQFGSVADPNVLAKFDQAEALINGLQQLAILIQNPSSIDWTVLQSRVDEIKAALNATLSGLQSQYSDEINDVLAKVAGYQAAFNELQQLINNLKNVGTFNIDTAEDVVDQVQTAYNNIAIDLGITIDENDGFNTLLNHVRDTIHMVQLLQRLATDPLSLTPAEIETSLESLSSLEDLYLSIMNTIHITPDQNVLNALNALEAVAHGIQSARAFEDLLGGFLADLKDNPQQTLNNLWAAYNEMVNNGGLDYLGDNQILDILVNAETTAVNAVNALIDGIHTPVKLSDLASIASIIAARPAYNALSDHGKTLVGGERLAKLENAEVQMLDLKYNLLAAKPSKGLEFLYSKSTVQGYVNDFNALDYNQQTSISAGSKTKLAAWATYYGITITYKVQ
>NZ_CP048286.1|WP_162641013.1|3569124_3570405_-|urea-ABC-transporter-substrate-binding-protein
MKRKFWKSGVFVLLALMMVLAGCGKNDNAASTTTNADGAKTDDSGSGSETSSGGEIKVGILHSLSGTMAISEVSVKDSEMMAIDEINAKGGVMGKKIVPVVEDGASDWPTFAEKARKLISEDKVATVFGGWTSSSRKAMLPVFEELNGLLWYPVQYEGLEQSPNIMYTGATTNQQIVPAVTWLLQNKGKKFFLLGSDYVFPRTANKIIKEQLKVEGGELAGEEYTPLGHTDYTTIISKIKEAKPDVVFNTLNGDSNVAFFKQLKDAGISSSALTTLSVSVAEEEIRGIGADVLAGTYAAWNYYETTDTPENKTFVAAYKKKYGDDRVTADPIEAGYDAVYLWAAAVEKADSTDVDKVKAAAKDLEWDAPEGKVKIDGETQHLYKTVRIGEVQTDGQFKEVWNSGSPVKPDPFLKGYDWAKSLSEGK
>NZ_CP048286.1|WP_162641008.1|3567987_3568893_-|urea-ABC-transporter-permease-subunit-UrtB
MDVIVLQLFNGISVSSILLLIALGLSITFGLMKVINMAHGELIMIGAYTAYVVQNLFADYLPDSMFGWYFALAIPVSFIVAFVFGLVLEMGLIRFLYGRPLDSLLATWGVGLMLQQLARSIFGAPNVGVKSPAWLDGGMTVGDNVFPYKRLFIIGLVLICLLAMYVYIYKSHSGRRMRAVMQNREMAACLGISTRRVDAMTFAIGSGIAGIAGCALTLIGPIGPAIGTYYIVDAFMVVVLGGVGKLVGTVFGALGIGLSNTLFEYWTTASLGKVLVFACIVAFLQWKPSGFVALRSRSLDN
>NZ_CP048286.1|WP_162641004.1|3566819_3567908_-|urea-ABC-transporter-permease-subunit-UrtC
MPIRKLSAQRLWLLAAYAAAAAALFCAPLVLSDFRLNLLAKFLAYAIVALGLDLIWGYTGILSLGHGVFFGLGGYAMAMYLKLDASGGKLPDFMDWSGLTKLPWFWKPFASLPFAIAAGILVPAMLALILGYVTFRNRIRGVYFTILTQALVIITTTLFIGQQAYTGGTNGLTGYSKLFGYSLGSPETKKWLYWVTVMLLIGAYLLCRVLVKSRFGKVLRAIRDGENRVRFIGYDPALYQMVAFGFSAGLAGLAGMLFVLHVGIISPSMMGIVPSIEMVLWVAIGGRGTLVGAVLGAVLLNYAKSTFSESYPNIWIVFMGALFVVVVVFLPKGAAGLFGQFKWLRRRKAADEGADGVRYPAV
>NZ_CP048286.1|WP_162645281.1|3566068_3566845_-|urea-ABC-transporter-ATP-binding-protein-UrtD
MESVILRCDEVTVDFDGFKAVQGMNLTLVKGELRFLIGPNGAGKTTMLDVICGKTKPASGKVTFGGGSVDITRKKEHQIAELGIGRKFQTPSIFASLTVSENFEIAMKQNRGVFAAMRAKMRAEDSDRIAAQLEMVGLAEKAHRRAGGLSHGEKQWLEIGMMLLQEPEILLLDEPVAGMTDNETEKTGELLQEIRKTQSVVVVEHDMEFVRNFASFVTVMHEGKLLKEGSMEDVQRDDRVAEVYLGKRRDADASRSTA
>NZ_CP048286.1|WP_162640975.1|3565395_3566091_-|urea-ABC-transporter-ATP-binding-subunit-UrtE
MLAVQQLEAGYGESVVLRGVTLQVRPGQVVCLLGRNGVGKTTLMKSIMGVLKARKGTVSYKGNDLTKRAPGQRAKKGIGYVPQGREVFAQLTVFENVLLGLEASGTKKRVIPESAIEKFPVLPTMYDRRGGDLSGGQQQQLAFARALASEPDLLLLDEPCEGIQPSIVDDIRDVIRAIKADGKTSILLVEQSLEFVKSVGDYFYILEKGTVAWEGGLGDLNDEVIRHYLTV
>NZ_CP048286.1|WP_162641043.1|3578905_3579466_-|aminoacyl-tRNA-hydrolase
MKWIVGLGNPGTAYQGTRHNVGFMVVDVLAKRWGISVTQSKCKALIGEGNVAGTKVALIKPMTYMNLSGETVRGFMDYFKADLEDAIVVYDDLDTETGRIRLRYQGSAGGHNGIKSIIQHTGTQTFNRIRLGISRPQNGMIISDYVLSNFPKSEGELLKLMVEESCDAIEFALTNPFERTMAKYNR
>NZ_CP048286.1|WP_162641053.1|3579651_3579852_+|hypothetical-protein
MYENGQLIFDDCHFQDHFDCQVPVQVYWGKEHHDIGFVDEVSSSYIKMNNIFYSRKRFTFVSRPGY
>NZ_CP048286.1|WP_162641060.1|3579938_3580589_-|50S-ribosomal-protein-L25
MAIPFQAEERKTGTQGELRNMRMKGRVPGVVYGTQLSKPLNVAVNEKELSSLLRSHPHALLELDIPGAGKQPVMLTEVQREPLSRTVLHVDFHQVNMNQEVKTMVRLDMVGDSTGVREGGILQAMLHELEIHCLPGGIPESIEVDVSSLGIGENLLVGDLKLPSGVTTRLDADQVIVTILMPQKDLTAEEAAEADGEAEAAAERSHEAKMEVHTST
>NZ_CP048286.1|WP_162641074.1|3580854_3582255_-|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU
MKVMAIVLAAGQGKRMKSKLYKVLHPVCGKPMVAHVLQTVKDAACERTVVVVGHGAETVRSYLGAGVEIVLQEQQLGTGHAVQQAEPLLGEEEGTTVILYGDTPLVTSETIQSLLSIHTGTRSAATVLTAVVPNPQGLGRIIRDDAGNVLRIVEQKDCTPEQAEITEINTGMYCFDNKKLFQALAKVTNHNAQGEFYLTDVMEILKNAGETVGAYCTPDFAEGIGVNDRVGLGEAEALMRARIVRKHQIGGVTIIDPAATYIEADVVIGSDTVIYPGTVLRGATVIGEDCVIGPNADIADTTIGNGVTVKHAVSAEAEIGDECSVGPYAYLRPGSKLGIGVKIGDFVEIKNAELGNGTKVSHLSYVGDAKVGKDVNIGCGAITVNYDGYNKSLTEIGDNAFVGSNVNLIAPVKIGDGAYVVAGSTITHDVPENDVAIARERQVNKPGYAEKLRGRAKVKKDAKSQN
>NZ_CP048286.1|WP_018759486.1|3582377_3582662_-|septation-protein-SpoVG
MQITDVRLRRVNSEGRMKAIASITIDNEFVVHDIRVIDGNNGMFVAMPSKRTPDGEFRDIAHPISSTTREKIQAAVLAEYERAATEEEVIEEGA
>NZ_CP048286.1|WP_162641080.1|3582800_3583187_-|RidA-family-protein
MTKQQPQMISTTNAPAAIGPYSQAIKLGNLLFTSGQIPLNADGTLIEGGIEEQTHQVFRNLEAVLAEAGATLSDTVKATVFIKDMNQFAALNAIYASYFGDHKPARSTVEVARLPKDVLVEIELIVSI
>NZ_CP048286.1|WP_162641085.1|3583201_3584038_-|pur-operon-repressor
MKKLKRSARLVEMTQYLLTRPHTLISLTAFADRYQSAKSSISEDLAIIKEVFEEEGLGELHTLAGAAGGVKYTPKMADAEALTIMNGICRQLEQPERVLAGGYLYMTDMLGQPGLLADVGRMFATAFAHAEIDVIMTVETKGIPLAYATAACMNLPVVIVRRDNKVTEGSAVSINYVSGSNKRIQTMSLARRALKEGARVLIVDDFMKAGGTIQGMMDLLYEFNAKVAGVGVFVESGELDTEERLLEDYVSLASLTAVDLKTKQTTVIPGNYFNRLEK
>NZ_CP048286.1|WP_162641091.1|3584122_3584977_-|4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol-kinase
MKIYEKAPAKINLLLDVMRKREDGFHEVEMIMTMVDLADRLEMEELQSDSIFISSQAGYIPLDEKNLAFQAARLIKDRYNVRKGVYIHLDKNIPVAAGLAGGSSDAAATLRGLNRLWQLGISEDELCTLGAELGSDVPFCVTGGTAIARGRGEKLERIPNPPQCWVILAKPPINVSTADVYGKLRASELKKHPSTKDMVEAIANGSFMDVCSHLGNVLETVTLQLYPEVLQMKEIMQRLGADGVLMSGSGPTVFGLVSKEAKVSRIYNGLRGFCKEVYVVRMLT
>NZ_CP048286.1|WP_162641094.1|3585665_3585938_-|Veg-protein
MAKNALLEIKRSLETHVGSKIRLRANGGRRKTIERTGVLEEIYPSVFIVRLDQEQHAFKRVSYSYADILTASVEVMVDSDDGQVRITYIQ
>NZ_CP048286.1|WP_162641096.1|3586089_3586965_-|sporulation-peptidase-YabG
MMQGDLVVRKSYGGDVLFRVATIDQQTAILKGTDYRLLADAPIVDLSVVKDGDLPVAIRQARLKAGESTQRMQEEREQQIIQRELLRAQNQNQPFFEVPGRVLHLDGDSNYMKKSMQLYTQMRVPAHGLFVHESQMADAVYRLLPQIQPDVIVITGHDGVLKNREQNDLSNLASYKNSQNFVDAVRIARDYERNRDGLIIVAGACQSHYEALLQSGSNFASSPGRVLIHALDPVYVAIKASYTPIRETINLTDVIHGTISGIDGVGGIETLGKYRVGLPKPRTLTGVKATV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_10

3859051-3859125

Orphan

Consensus_repeat	Method
GGTTTTGTACGAAATATCGTACAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_10

>merge|NZ_CP048286|10|3859051-3859125|CRISPRCasFinder
GGTTTTGTACGAAATATCGTACAAAGTAACGTGTGAGGTAGCGGGTTGCCGGGGTTTGTACGAAATATCGTACAA

>NZ_CP048286|10|9|3859051-3859125|CRISPRCasFinder
GGTTTTGTACGAAATATCGTACAA	AGTAACGTGTGAGGTAGCGGGTTGCCG
GGGTTTGTACGAAATATCGTACAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162645301.1\|3865534_3866350_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP048286.1\|WP_162642039.1\|3867421_3868552_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|211420
NZ_CP048286.1\|WP_162641991.1\|3845591_3846500_-\|RNA-polymerase-sigma-70-factor	unknown	unknown	gnl\|CDD\|132002
NZ_CP048286.1\|WP_162642026.1\|3859187_3860132_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223566
NZ_CP048286.1\|WP_162642000.1\|3849044_3850187_-\|DNA-polymerase-III-subunit-beta	unknown	unknown	gnl\|CDD\|238082
NZ_CP048286.1\|WP_162645299.1\|3863328_3864309_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176189
NZ_CP048286.1\|WP_162641998.1\|3848305_3848881_-\|type-VI-secretion-system-tube-protein-Hcp	unknown	unknown	gnl\|CDD\|377536
NZ_CP048286.1\|WP_162645300.1\|3864382_3864661_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642016.1\|3853072_3854242_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380491
NZ_CP048286.1\|WP_162642012.1\|3852108_3852576_+\|transcription-elongation-factor-GreA	unknown	unknown	gnl\|CDD\|234693
NZ_CP048286.1\|WP_162642029.1\|3860219_3861083_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293840
NZ_CP048286.1\|WP_162641995.1\|3846627_3847938_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|235977
NZ_CP048286.1\|WP_162642031.1\|3861360_3862194_-\|1,4-dihydroxy-6-naphthoate-synthase	unknown	unknown	gnl\|CDD\|270353
NZ_CP048286.1\|WP_162645298.1\|3862198_3863014_-\|futalosine-hydrolase	unknown	unknown	gnl\|CDD\|236194
NZ_CP048286.1\|WP_162642009.1\|3850631_3851693_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	unknown	unknown	gnl\|CDD\|237717
NZ_CP048286.1\|WP_162642035.1\|3864986_3865274_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236766
NZ_CP048286.1\|WP_162642037.1\|3866369_3867305_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP048286.1\|WP_162642023.1\|3857540_3859004_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP048286.1\|WP_162642005.1\|3850191_3850449_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642020.1\|3854384_3857399_+\|alpha-mannosidase	unknown	unknown	gnl\|CDD\|223460

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162645301.1\|3865534_3866350_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	3.00605e-32
NZ_CP048286.1\|WP_162642039.1\|3867421_3868552_+\|hypothetical-protein	gnl\|CDD\|211420	cd11579, Glyco_tran_WbsX, Glycosyl hydrolase family 99-like domain of WbsX-like glycosyltransferases. Members of this domain family are found in proteins within O-antigen biosynthesis clusters in Gram negative bacteria, where they may function as glycosyl hydrolases and typically co-occur with glycosyltransferase domains. They bear resemblance to GH71 and the GH99 family of alpha-1,2-mannosidases and may share a similar cataltyic site and mechanism. The O-antigens are essential lipopolysaccharides in gram-negative bacteria's outer membrane and have been linked to pathogenicity.	7.62633e-97
NZ_CP048286.1\|WP_162642035.1\|3864986_3865274_+\|hypothetical-protein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	0.00111003
NZ_CP048286.1\|WP_162642026.1\|3859187_3860132_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	1.50069e-55
NZ_CP048286.1\|WP_162642000.1\|3849044_3850187_-\|DNA-polymerase-III-subunit-beta	gnl\|CDD\|238082	cd00140, beta_clamp, Beta clamp domain. The beta subunit (processivity factor) of DNA polymerase III holoenzyme, refered to as the beta clamp, forms a ring shaped dimer that encircles dsDNA (sliding clamp) in bacteria. The beta-clamp is structurally similar to the trimeric ring formed by PCNA (found in eukaryotes and archaea) and the processivity factor (found in bacteriophages T4 and RB69). This structural correspondence further substantiates the mechanistic connection between eukaryotic and prokaryotic DNA replication that has been suggested on biochemical grounds. .	1.45453e-82
NZ_CP048286.1\|WP_162645299.1\|3863328_3864309_+\|quinone-oxidoreductase	gnl\|CDD\|176189	cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.21477e-132
NZ_CP048286.1\|WP_162641998.1\|3848305_3848881_-\|type-VI-secretion-system-tube-protein-Hcp	gnl\|CDD\|377536	pfam05638, T6SS_HCP, Type VI secretion system effector, Hcp. HCP is a family of proteins which are expressed in up to 1000 copies in Gram-negative bacteria. Together these copies aggregate into a needle-like shaft or tube that will penetrate other bacteria via a puncturing protein attached to its head. Initially Hcp forms a hexameric structure with a central channel of 40 Angstroms. These hexamers pile up one on top of each other forming nanotubes resembling the gp19 tail phage tube.	2.69023e-26
NZ_CP048286.1\|WP_162642016.1\|3853072_3854242_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|380491	cd06267, PBP1_LacI_sugar_binding-like, ligand binding domain of the LacI transcriptional regulator family belonging to the type 1 periplasmic-binding fold protein superfamily. Ligand binding domain of the LacI transcriptional regulator family belonging to the type 1 periplasmic-binding fold protein superfamily. In most cases, ligands are monosaccharide including lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. The LacI family of proteins consists of transcriptional regulators related to the lac repressor. In this case, the domain sugar binding changes the DNA binding activity of the repressor domain.	2.09127e-57
NZ_CP048286.1\|WP_162642012.1\|3852108_3852576_+\|transcription-elongation-factor-GreA	gnl\|CDD\|234693	PRK00226, greA, transcription elongation factor GreA; Reviewed.	2.94129e-59
NZ_CP048286.1\|WP_162642029.1\|3860219_3861083_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293840	cd16282, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily.Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.75647e-13
NZ_CP048286.1\|WP_162641995.1\|3846627_3847938_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|235977	PRK07233, PRK07233, hypothetical protein; Provisional.	8.14827e-26
NZ_CP048286.1\|WP_162642031.1\|3861360_3862194_-\|1,4-dihydroxy-6-naphthoate-synthase	gnl\|CDD\|270353	cd13635, PBP2_Ttha1568_Mqnd, A menaquinone biosynthetic enzyme exhibits the type 2 periplasmic-binding protein fold. This group includes Ttha1568 (MqnD) from Thermus thermophilies HB8, an enzyme within an alternative menaquinone biosynthetic pathway that catalyzes the conversion of cyclic de-hypoxanthine futalosine to 1,4-dihydroxy-6-naphthoate. Menaquinone (MK; vitamin K) is an essential lipid-soluble carrier that shuttles electrons between membrane-bound protein complexes in the electron transport chain. Ttha1568 has significant structural homology with the members of type 2 periplasmic-binding fold protein superfamily. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	2.45892e-133
NZ_CP048286.1\|WP_162645298.1\|3862198_3863014_-\|futalosine-hydrolase	gnl\|CDD\|236194	PRK08236, PRK08236, hypothetical protein; Provisional.	2.08729e-73
NZ_CP048286.1\|WP_162642009.1\|3850631_3851693_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	gnl\|CDD\|237717	PRK14455, PRK14455, ribosomal RNA large subunit methyltransferase N; Provisional.	0
NZ_CP048286.1\|WP_162642037.1\|3866369_3867305_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	7.65032e-25
NZ_CP048286.1\|WP_162642023.1\|3857540_3859004_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	5.08718e-143
NZ_CP048286.1\|WP_162641991.1\|3845591_3846500_-\|RNA-polymerase-sigma-70-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	2.43198e-115
NZ_CP048286.1\|WP_162642020.1\|3854384_3857399_+\|alpha-mannosidase	gnl\|CDD\|223460	COG0383, AMS1, Alpha-mannosidase [Carbohydrate transport and metabolism].	1.02024e-156

>NZ_CP048286.1|WP_162642023.1|3857540_3859004_+|DEAD/DEAH-box-helicase
MAIEEQGQGKDFRNYGLSEDILRAIDSLGYEAPTPVQREVIPRVLAHRDCTVRAQTGSGKTAAFGIPLCELIDWEENRPQALVLTPTRELAGQVKEDLVNIGRFKRIKAVAIYGQQPFAAQKIELHQKVHAVAGTPGRMLDHIRRGTLDVERIRFLVIDEADEMLNRGFIEQVEAIIDELPKERVTLLFSATLPDDVDRLCRTHLREPLHIEIESPGVAVDRIAHKLYIVANGGKLALLKAVTVAENPDSCIVFCSTKEAVDEVNRELRRSGYSCDKIHGGMEQDDRFEVMHAFRRREFRYLIATDLAARGIDIEHVTHVVNFDLPMDSEKFVHRIGRTARAGLSGEAITFAVPQEERRLAEIEHYLGFELPRFEAPSKAEVEAARDAFELKLQAEEAPRLDKRELLSQDIMKLYFNGGKKKKLRAVDFVGTIAKLEGITAADIGIIAIQDNVTFVDILNGKGPLVLRAMKTTTIKGKQLKVHEANK
>NZ_CP048286.1|WP_162642020.1|3854384_3857399_+|alpha-mannosidase
MPHTPIKMDVLRRTLQGIESRIYTKVAPLAITAYATKEPVVFAERESGERLELNAGDKWGERWDCAWFHFRGQVPESAAGQKVVLLLDVNGELCIFDDEGTPLQGLTNVNSEFDLTLGLPGKRVFPVADNAAGGEVIDLWGDAGNNDLFGYYRSGTVKEADIAICREEVRQLYYDYEVLLDYAEHIEDKSARTARIMQALYDVSLLLRNPSDETVAEARRLLGTELAKQGGDPTMTATAVGHAHIDLAWLWPIRETYRKGARTFATVLRLMERYPDYVFGASQPQLYQWVKEQHPKLYAQIKQRVAEGRWEVQGAMWVEPDSNIAGGEALIRQILLGKRFFKEEFGLDMRMLWVPDIFGYTASLPQLLKQSGVDYVMTQKLSWSIHNDHPHHTFFWEGLDGSRILTHLPPEDTYNGPALPRSIMKAERDYYDKNVSDHCLVVFGIGDGGGGPGEEHMERLARVKNLQGLIPVKQEPAIDFFDKLNANRDRYKTWKGELYLEKHQGTLTSQARNKRFNRKLEKALRELEFAASLAFAAGTGSYPAEELDRIWKEMLLYQFHDILPGSSITRVFDESLARYEELLSRVNELAAGAYRDAASAVTASGAARAAVLFNSLPWARKEWLNTGKGEWRQVDVPAMGYAVVDSEQPTLPAFELQAANDSLENDLIRVAFLADGSIGSVYDKALGRETLAPGERANVLAIYKDDGDAWDFPEDYAAAGFEQMKLTASQAIIDGPQAIVEQRYACGKSTLTQRISLTAGSKQLTFATEADWQEDGRMLRSIFPLNVYTDAANCEIQFGHMKRPTHRNTMWDYAKDEICAHQWIDLSQPDFGAAILNDCKYGYSANGHTVSVHLLRSPSFPDPVCDRAVHQFSYALLPHEGDFIAAEVYKAGYAFNTPIAVVEAGGSRTGTLPTDRFSAIALEGRGVMIEAVKKAEDEDALIVRLYETSGANAAVQLRVRLPHASASLTDLLEQETETLSPSEGDGGYGLQFTPFEIKTVKVKL
>NZ_CP048286.1|WP_162642016.1|3853072_3854242_+|substrate-binding-domain-containing-protein
MNADREPLYIRIQNHFKDAIRAGQLREGDKIPTEKMLLEQFEVSRITVANALGELAREGWIHRIPGRGTYVQGIPDNSEEAAEADIQEHRTERAPLTSNQGVRPRIGLVVPFIGDYFAIRLLSGLRDAVEEAGYSLLAMFTFNDKEREKELIRELRDTVEGLVIFPVDADVYNEEIIALKMNGYPFVLIDRYLPGVETNTVHTDGGLAAKLAVDHLWELGHREIAICADTPVSTVSVDDRINGYMNALKMKGALINPVLLMTDFSMPQAAAGAEHPLARTIGSGAATAYIALNSTLALHIAALAKKAGLKVPQDLSIVAFDNPSRGQLEESGTFTFIDQNEGELGRKAGELMLEVLRGGSRESGTAVYRRIVLVPELVVRDTTAAPAAG
>NZ_CP048286.1|WP_162642012.1|3852108_3852576_+|transcription-elongation-factor-GreA
MANEQMILTREGFDKLQEELDDLKYVKRKELAARIKLAISYGDLKENSEYHSAKEDQAFMETRIMVLEKMLATARVVEGGNLDSVQVGSSVVLHDVEFDERIVYQIVAPAEANVADNKISYESPLGKELMNKGIGERITVNAPMGVIEYKLLEIK
>NZ_CP048286.1|WP_162642009.1|3850631_3851693_+|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN
MNKPSIYGLTLEQLTAWLLEHGHKKSRSLQVWDWLYRKRVTSFEAMEDVNGDCRALLAERFAIETLAEHTKQESSDGTVKFLFKLQDGSLIETVLMRHKFGLSVCVTTQVGCNIGCSFCASGLISKSRDLSAGEIAEQIMKVQLYLDAAGQGERVSHVVVMGIGEPFDNFENLVDFLDVIKDHKGLAIGAKHITVSTSGLADKIIAFTDRGLGVNLAISLHAPNNELRTRIMKINRAIPIEKLMGAIDYYISKNRRRITLEYILLRDVNDREEHALELAELIGDRRPSVNVNLIPYNPVDEHSQYQRSEQSSIRGFYDTLKKQNVSVSVRLEHGTDIDAACGQLRSKQMKASG
>NZ_CP048286.1|WP_162642005.1|3850191_3850449_-|hypothetical-protein
MPSKKLKLGVPEQEGQLSMLFTKGGPRTGAGRKGIGETRKLSLTLPETAWAAIEALCEEHACSKSELLRAIIHDYLHATTKNGED
>NZ_CP048286.1|WP_162642000.1|3849044_3850187_-|DNA-polymerase-III-subunit-beta
MRVEVSQASLHAALQRLSPALSSKPVTPILGSILLWADDDGLSVRGGGGGITVEARLDAASGEAVVHRTGQLLVPSRSLLPVIRCLPPGSVALESVHGPALLIRAGHARYRLSGLDAGQYPYIAVPPHTHELHFTNARLKEIIRRLAFAASSSEARPILTGISCSIDAGSIAFTATDGVRLSSQRISRTPLAETPSALRTAVIPAKPWLDFVNLLDDEGSTAMTLGTASVRFQTNELWLQLALLEGSYPVLDRVAAQECETTITLMAPDLLRALERVTLLAGEHRAVKLASDRDGLAVALTARTEGIGDVEESVPAQSVDGQPLTIAFNGSYLRDFMRAASGSAVTLTFSTPNKPIVIRTTDEPSSLFVLTPIRTAGAAP
>NZ_CP048286.1|WP_162641998.1|3848305_3848881_-|type-VI-secretion-system-tube-protein-Hcp
MYKRFMSKSFIIVLAIVAVICAIPGSAFAAPGSPRILLVLDGIKGESVLKGYENAIDITSFSYGVEAASNFTSGAGASVGKPSYTEFNFTKSVDTATLALMQRIAQGTAIKQGTLYFIKDDSGKPYLTIKLQQIFVTGDQLSAEAGSGMSEELKLRAAQTTFTYAPQGPDGRLLPGQTLDINIPKGTVTAS
>NZ_CP048286.1|WP_162641995.1|3846627_3847938_-|FAD-dependent-oxidoreductase
MKHAGTVVIGGGLAGLLAAIETAKAGRPVVLLEKSSHTGGRGISVLKNGARLNLGGHALYRGGAAFAALRQLGIKLEGRAPSTSGEVIWKNGLAPLPADPLRLLTSKLLRFPGKIELGRLLTGLGKINFAALGDTTLREWAEREVRDPMVRHLFYSLCRTATYSRDIDFQLAGAVLQQVQLSLKEGVLYLDGGWQSIIDQLHALAVRSGVAIRTSAGVTGIAHEGGAVQGVLLGSGELLPADSVISTLPPADNFRLVEGAEHTALLRWKEDARPVTAACLDLALNRLPVENRQFVMGLDQPLFFSNHSRAAKLSDNGTVVTHLIKYNAPGEQDPRGDEALLARTMDMLHPGWQQETAAKQFLPSITVVHDQPHIGRRDRKPGPAVPEIRGLYVAGDWACHGEMLADAAAASAGRAAAQLLKDAKAGLGREPELIGS
>NZ_CP048286.1|WP_162641991.1|3845591_3846500_-|RNA-polymerase-sigma-70-factor
MEKSIITEELYASHKTLLFSLAYRMLGSVMDAEDIVHEAILSLQGKQADQILNLKAYLCKVVTNRCIDRLRSAQKQREVYVGPWLPEPIVTDLREGSEADASRSGDPYQAYVRQESVSTAYLLLLQQLSWVERTVFLLREVLQFDYEEIAEIAGKSSQNCRQIFHRAKRSIHPAAEQKAPAPGLPGHRMLVEQFTAALASGDIGKLLNVLSLDATLVSDGGGKVSAAVRPIVGPARIASFFEGLRKKLPPDFGFKLALVGGQPGLVTYAGGAPASVFSFRTEQDRIAEIYVVVNPDKLLGVR
>NZ_CP048286.1|WP_162642026.1|3859187_3860132_-|NAD(P)/FAD-dependent-oxidoreductase
MIYDCIIVGGGLAGLQAAIQLGRYNAYRVLVIDSEDGRSGLCRSYRNLLGYPDGVSGEALRQAGRKQLQTYGIAIRRDTVTHAEPLAPNGGFRLKGTEGDAYEARTVLLATGVMDRLPDWPGLRGCLGLSVYVCPDCDGYEIKGRRTLVLGAGDVGARMALTLRTWTDRLVYLRQEEREHPLSPELANQLEAAGIPHRAAPVQSITATDGCTLTGVVLADGTEIPADRAFVAFGGNEVRSQLARQLGARLHENMHVWTDSRTKMTSVAGLWAAGDIAFHSEQAAIAMGDGAQAAIWIHKTLQEARAGKEAQSLS
>NZ_CP048286.1|WP_162642029.1|3860219_3861083_+|MBL-fold-metallo-hydrolase
MIKMRKGALTIFESALYKTTSTVIQTADAVLIVDPCWLPGEVEEIRRYADEAAEGGRRKYVLFTHSDFDHIIGYGAFPDAEVIASAALAGKSDEAKAAIIEQILAFDDDYYLERNYKISYPDVTHAIAHDGQQLTLGASGSLRLTFYLSPGHNDDGLFTVVEPLGLLVAGDYWSDIEFPYIYHSSTLYESAVAKLDTMLDAHEIVRLIPGHGASTTDKAEMKRRQTADVAYISAMRAGVRANDQQAIDALIEGCRFPRNMRKFHRANQTLFERELNEELGTGPAEEV
>NZ_CP048286.1|WP_162642031.1|3861360_3862194_-|1,4-dihydroxy-6-naphthoate-synthase
MKIAFSPCPNDTFVFHALVHGLVPGAPEFEVTYADIDITNNWAAAGEGPEVLKISYAALPWVLEDYALLPTGGALGRGCGPLVLTKNEIANPAELAGKRVAVPSERSTAYLLFRLWAAQNIPGGNLDIVVMPFHEIMPAVRDGAIDAGLVIHEARFTYQNYGLSLQTDLGSWWESDTGLPIPLGAIIARRSLDAASLTKWIRASVEYAWANPELSQTYVMEHAQEMSPDVAKQHIALYVNEFSASLGASGYAAIESLLGRAMKEGLVPAFDLAKLRA
>NZ_CP048286.1|WP_162645298.1|3862198_3863014_-|futalosine-hydrolase
MGHEDNIARGRVLIITAVEAERDAVLRGLGGDERFHVVAAGAGPAAAAAGTAFALAAAGQASIPVRGESAPAEVGPAEELLGSASFSGLEAAGMASTVPDSPASAQAGGYTLVISAGIAGGFPGLAAVGSLVVASEIIAADLGAETPDGFLSVDELGFGSSRIGVNARLAGDLAAAISAAGLPASTGPVLTVTTATGTAATAAEHGRRVPGAAAEAMEGFGVASAAKQFGLPALELRAISNAVGPRDRSAWRIGDALQALERASQILREVL
>NZ_CP048286.1|WP_162645299.1|3863328_3864309_+|quinone-oxidoreductase
MKALVFRTFGGPEVLALEEVDDPVLAPGTVKVRTRAIGLNYADVYRRRGNYHLIGDPPYILGYEGAGIVEETAPDVQGIQVGDRVGFADAPHANAELVIVPADRIVPLPDGISFETAAGVLLQGLTAHYLTNDSYDVRPGDQVIVHAAAGGVGQLLVQLCKAKGAHVLGLASSEAKRRSVLAAGADAAVMYGDGWADACLQWSAALDHREPGADVAFDSVGVTLMESFRAVRTRGTVVFFGMAGGDPPLIDPRMLMDTSKTLTGGDLWNHVKTADDRIRRSTALFDDIMGGRLKLAAPRLYPLAGGADAHRFIESRQSTGKILLMP
>NZ_CP048286.1|WP_162645300.1|3864382_3864661_+|hypothetical-protein
MSEQINMIELVQHIAGITKADAKLVEQVLQHEQTFINGAQEDKNGEVNIDSDELVDYILSRPGLKSDELTVERILDAEMDYLMDKGIAGYID
>NZ_CP048286.1|WP_162642035.1|3864986_3865274_+|hypothetical-protein
MSHEEEIVEVNAEAASDELEAVVEIAAASEEAAEEAEASEDAEESAEEAEEAEEASEEAAEEEEAQADESEEAAEEADAEEEVEDAADEAAEDEA
>NZ_CP048286.1|WP_162645301.1|3865534_3866350_+|sulfite-exporter-TauE/SafE-family-protein
MWDAPTLLIMFVLGLFASTFGAIVGLGGGVIIVPALLLLGSSMLGMDIDTTLAVGVSLGALVFTSFTSTLTFVREGKADLRSALFFSLSSGPFSLVGASLTSLFDPDAFRKAFGYFMLFMVVLLLFRNRIKPYQGQWRYVRTYTDAAGMQQEYGYNALPALLIGGAVGLIAGLLGIGGGVLLIPAMMLLFRFPPHIASATSMAVIFVSALFGSGMHLARGEWDWMLVLALAPGALIGGWLGARISRRIGSVLLIRIMCGALLLFALRMIIT
>NZ_CP048286.1|WP_162642037.1|3866369_3867305_+|AraC-family-transcriptional-regulator
MTATIPIGLQQLAPYVRYVHYNEGDEHYRVPRRVIYDYEFIYIVRGSALFTLGDEEVPLQAGDLHIIPPLTVNACRVPAGGSFAYYACHFDLAYMGRELDFPDDIYVQVDYANLPEVPVQEELLERPLQTIADFELPPFYSTVASHRFGERFADLLALFEREPFGFQARMRACLLDVIGLLLEETHTAEGIRQDSPHKAMITEMIALMHGPGLQGEVDLEPIVGRYGMTLKYARTLFKQATGLSWTRYLTRLRMERAKMLLRQGGLSVGEIAERCGYADLHYFSRLFKKLEGLPPRAYADSLRSVAQPMGE
>NZ_CP048286.1|WP_162642039.1|3867421_3868552_+|hypothetical-protein
MTKPYEVAVYYFPNYHVDKRNEAWHGEGWTEWELVKRATPRFEGHDLPKEPLWGYTDEANPAEMAQKIDAAADHGVDTFIFDWYWYEDGPYLERALEEGFLGAANNERLRFALMWANHDWIDIHPAPRNKPYNTLAQGTVSREAFARATDHMIAAYFRRPNYWRIDGKLYFSVYELMSLVKGLGGIEETREALDDFRQRVRAAGLGELHINAVVWGVQILPGEQRITNGNELLAVLGVDSVSSYVWIHHRELPVFPETPYADIALQSAEDWETFTHQYELPYLPNVTMGWDSSPRTVQSDRFDNLGYPFMSMLSGNTPEQFRLSLERMKQFLERDSNGFRAFTVNAWNEWTEGSYLEPDTKNGLAYLEAIKRVFGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_11

4055389-4055472

Orphan

Consensus_repeat	Method
AGAGGCAGATGCGCTGCATCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_11

>merge|NZ_CP048286|11|4055389-4055472|CRISPRCasFinder
AGAGGCAGATGCGCTGCATCGGCATGGCAGTGAAGGGTCGCAGCGTCCAAGAGACAAAGCAGAGGCAGATGCGCTGCATCGGCA

>NZ_CP048286|11|10|4055389-4055472|CRISPRCasFinder
AGAGGCAGATGCGCTGCATCGGCA	TGGCAGTGAAGGGTCGCAGCGTCCAAGAGACAAAGC
AGAGGCAGATGCGCTGCATCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162642424.1\|4064340_4065207_+\|flagellar-hook-basal-body-protein	unknown	unknown	gnl\|CDD\|227125
NZ_CP048286.1\|WP_162642421.1\|4060507_4061701_+\|stage-II-sporulation-protein-D	unknown	unknown	gnl\|CDD\|274332
NZ_CP048286.1\|WP_162642414.1\|4049496_4049799_+\|NADH-quinone-oxidoreductase-subunit-NuoK	unknown	unknown	gnl\|CDD\|180218
NZ_CP048286.1\|WP_162642409.1\|4045053_4046259_+\|protein-NuoC	unknown	unknown	gnl\|CDD\|376317
NZ_CP048286.1\|WP_162642422.1\|4061809_4062565_+\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP048286.1\|WP_162642416.1\|4051675_4053304_+\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP048286.1\|WP_162642410.1\|4046265_4047366_+\|NADH-quinone-oxidoreductase-subunit-D	unknown	unknown	gnl\|CDD\|183437
NZ_CP048286.1\|WP_162642411.1\|4047365_4048376_+\|NADH-quinone-oxidoreductase-subunit-NuoH	unknown	unknown	gnl\|CDD\|235692
NZ_CP048286.1\|WP_162645315.1\|4066273_4066495_+\|DNA-directed-RNA-polymerase-subunit-beta	unknown	unknown	gnl\|CDD\|378713
NZ_CP048286.1\|WP_162642419.1\|4058450_4058696_+\|DUF1146-domain-containing-protein	unknown	unknown	gnl\|CDD\|377678
NZ_CP048286.1\|WP_162642415.1\|4049804_4051676_+\|NADH-quinone-oxidoreductase-subunit-L	unknown	unknown	gnl\|CDD\|235836
NZ_CP048286.1\|WP_162642412.1\|4048518_4048974_+\|NADH-quinone-oxidoreductase-subunit-NuoI	unknown	unknown	gnl\|CDD\|235637
NZ_CP048286.1\|WP_162642408.1\|4044538_4045057_+\|NADH-quinone-oxidoreductase-subunit-B	unknown	unknown	gnl\|CDD\|235797
NZ_CP048286.1\|WP_162642420.1\|4058910_4060323_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
NZ_CP048286.1\|WP_162642417.1\|4053309_4054872_+\|NADH-quinone-oxidoreductase-subunit-N	unknown	unknown	gnl\|CDD\|235603
NZ_CP048286.1\|WP_162642418.1\|4055826_4058436_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173810
NZ_CP048286.1\|WP_090575384.1\|4062751_4063039_+\|sporulation-transcriptional-regulator-SpoIIID	unknown	unknown	gnl\|CDD\|378813
NZ_CP048286.1\|WP_162642425.1\|4065311_4066133_+\|flagellar-hook-basal-body-protein	unknown	unknown	gnl\|CDD\|227125
NZ_CP048286.1\|WP_162642423.1\|4063143_4064154_+\|MreB/Mrl-family-cell-shape-determining-protein	unknown	unknown	gnl\|CDD\|237563
NZ_CP048286.1\|WP_162642413.1\|4048977_4049496_+\|NADH-quinone-oxidoreductase-subunit-J	unknown	unknown	gnl\|CDD\|235844

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162642424.1\|4064340_4065207_+\|flagellar-hook-basal-body-protein	gnl\|CDD\|227125	COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion].	5.21579e-69
NZ_CP048286.1\|WP_162642421.1\|4060507_4061701_+\|stage-II-sporulation-protein-D	gnl\|CDD\|274332	TIGR02870, Stage_II_sporulation_protein_D, stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination].	1.79443e-108
NZ_CP048286.1\|WP_162642414.1\|4049496_4049799_+\|NADH-quinone-oxidoreductase-subunit-NuoK	gnl\|CDD\|180218	PRK05715, PRK05715, NADH-quinone oxidoreductase subunit NuoK.	4.05723e-39
NZ_CP048286.1\|WP_162642409.1\|4045053_4046259_+\|protein-NuoC	gnl\|CDD\|376317	pfam00329, Complex1_30kDa, Respiratory-chain NADH dehydrogenase, 30 Kd subunit.	4.16882e-53
NZ_CP048286.1\|WP_162642422.1\|4061809_4062565_+\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	3.94425e-26
NZ_CP048286.1\|WP_162642416.1\|4051675_4053304_+\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	7.23906e-177
NZ_CP048286.1\|WP_162642410.1\|4046265_4047366_+\|NADH-quinone-oxidoreductase-subunit-D	gnl\|CDD\|183437	PRK12322, PRK12322, NADH-quinone oxidoreductase subunit D.	0
NZ_CP048286.1\|WP_162642411.1\|4047365_4048376_+\|NADH-quinone-oxidoreductase-subunit-NuoH	gnl\|CDD\|235692	PRK06076, PRK06076, NADH-quinone oxidoreductase subunit NuoH.	8.78924e-152
NZ_CP048286.1\|WP_162645315.1\|4066273_4066495_+\|DNA-directed-RNA-polymerase-subunit-beta	gnl\|CDD\|378713	pfam11772, EpuA, DNA-directed RNA polymerase subunit beta. This short 60-residue long bacterial family is the beta subunit of the DNA-directed RNA polymerase, likely to be EC:2.7.7.6. It is membrane-bound and is referred to by the name EpuA.	8.36064e-09
NZ_CP048286.1\|WP_162642419.1\|4058450_4058696_+\|DUF1146-domain-containing-protein	gnl\|CDD\|377678	pfam06612, DUF1146, Protein of unknown function (DUF1146). This family consists of several hypothetical bacterial proteins of unknown function.	2.88883e-11
NZ_CP048286.1\|WP_162642415.1\|4049804_4051676_+\|NADH-quinone-oxidoreductase-subunit-L	gnl\|CDD\|235836	PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed.	0
NZ_CP048286.1\|WP_162642412.1\|4048518_4048974_+\|NADH-quinone-oxidoreductase-subunit-NuoI	gnl\|CDD\|235637	PRK05888, PRK05888, NADH-quinone oxidoreductase subunit NuoI.	1.29447e-56
NZ_CP048286.1\|WP_162642408.1\|4044538_4045057_+\|NADH-quinone-oxidoreductase-subunit-B	gnl\|CDD\|235797	PRK06411, PRK06411, NADH-quinone oxidoreductase subunit NuoB.	1.08834e-106
NZ_CP048286.1\|WP_162642420.1\|4058910_4060323_+\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
NZ_CP048286.1\|WP_162642417.1\|4053309_4054872_+\|NADH-quinone-oxidoreductase-subunit-N	gnl\|CDD\|235603	PRK05777, PRK05777, NADH-quinone oxidoreductase subunit NuoN.	4.63054e-121
NZ_CP048286.1\|WP_162642418.1\|4055826_4058436_+\|S8-family-serine-peptidase	gnl\|CDD\|173810	cd07484, Peptidases_S8_Thermitase_like, Peptidase S8 family domain in Thermitase-like proteins. Thermitase is a non-specific, trypsin-related serine protease with a very high specific activity. It contains a subtilisin like domain. The tertiary structure of thermitase is similar to that of subtilisin BPN'. It contains a Asp/His/Ser catalytic triad. Members of the peptidases S8 (subtilisin and kexin) and S53 (sedolisin) clan include endopeptidases and exopeptidases. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. Serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base. The S53 family contains a catalytic triad Glu/Asp/Ser with an additional acidic residue Asp in the oxyanion hole, similar to that of subtilisin. The serine residue here is the nucleophilic equivalent of the serine residue in the S8 family, while glutamic acid has the same role here as the histidine base. However, the aspartic acid residue that acts as an electrophile is quite different. In S53 the it follows glutamic acid, while in S8 it precedes histidine. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. There is a great diversity in the characteristics of their members: some contain disulfide bonds, some are intracellular while others are extracellular, some function at extreme temperatures, and others at high or low pH values.	9.62918e-78
NZ_CP048286.1\|WP_090575384.1\|4062751_4063039_+\|sporulation-transcriptional-regulator-SpoIIID	gnl\|CDD\|378813	pfam12116, SpoIIID, Stage III sporulation protein D. This stage III sporulation protein is a small DNA-binding family that is essential for gene expression of the mother-cell compartment during sporulation. The domain is found in bacteria and viruses, and is about 40 amino acids in length. It has a conserved RGG sequence motif.	3.65969e-37
NZ_CP048286.1\|WP_162642425.1\|4065311_4066133_+\|flagellar-hook-basal-body-protein	gnl\|CDD\|227125	COG4786, FlgG, Flagellar basal body rod protein [Cell motility and secretion].	1.66956e-76
NZ_CP048286.1\|WP_162642423.1\|4063143_4064154_+\|MreB/Mrl-family-cell-shape-determining-protein	gnl\|CDD\|237563	PRK13928, PRK13928, rod shape-determining protein Mbl; Provisional.	0
NZ_CP048286.1\|WP_162642413.1\|4048977_4049496_+\|NADH-quinone-oxidoreductase-subunit-J	gnl\|CDD\|235844	PRK06638, PRK06638, NADH-quinone oxidoreductase subunit J.	5.52842e-45

>NZ_CP048286.1|WP_162642417.1|4053309_4054872_+|NADH-quinone-oxidoreductase-subunit-N
MDAAQQLQSLTWSDAAYLAPEWILIVSMIALAVLDLFLPRRAITGWLTLAGLLVSLGAVIYRLIDLANAAPQMNANGQLASAAIRIMADSYRIDYFSSLMKIVFLVATALIVLMSLGTVKRSDIPDRGEFYYLLLPAVCGAMIMASSGDMITLYIGLELLSITTYVLVGIRKHAVQSTEAAFKYVVTGGISSALLLFGMSYLYGITGATNLGAIAEGIKTHGIDYPAMLYVAFFFIIAGLGIKIAAAPFHYWATDVYQGAPTPITAFLAVVSKGAAFAVIFRIVYNLAFYASSPGKPVTQDVFLVLLILAAAAMLIGSTMALRQFNVKRLFALSGVANAGYMLVPVGLSIKGMHYSGVGEFIFYLAVYLLMTIGALSVVAVISKSAGHEEVGGFAGLYYRAPWTAIAMIVFVLSLAGLPITGGFFGKLFILLGAAQSKDYWIAAVMVVSSVISYYFYFGLIRQMFMRSTSDADVHVPVTSGIVIWLCALATVALGIVPGPVLDWINSHFSLMNDLFIPFQ
>NZ_CP048286.1|WP_162642416.1|4051675_4053304_+|NADH-quinone-oxidoreductase-subunit-M
MLADLPILSMITFSPLLGLLVLLFLPKQRSRWIKITAITATVLPLLLSLWLYADYDSVKGGKAYEETATWLSTSLNKEAVGDVSSYTLQMQYHMGVDGLSMPLLLLTTIVGVMAALASVHIKKRWKAFYIWFLLLEVGMIGVFLARDVFLFFVFFEMTLIPMFFLIGIWGYMNREQAANKFLLYNGIGSAIMLLAFVLLVATAGFRADQQPELQQTHLSYSGSYEVISSNLADKDAYVNMPQLSQGSDNPLYLSDRMHWVIYLLLLIAFGIKLPIFPFHTWMLKVHAEAPPSVVMIHSGVLLKMGAYGLLRFGVFMFPGETKDWATVLAILGVINILYGAVLALVQKEFKLVLAYSSISHMGIVLLGIASLNEVGLHGAIIQLVSHGFISALLFLIVGSIHERTGSTELKDLGGLARSMPFLSGVLLAAGMASLGLPGLSGFVGEFLSLLGLFDSMRVLTGIAVLGVILTAVYVLRSVLGITFGTMPERFGALRDVRLVEAVPMITLLAFIVLIGVYPAVLTDPMKHGFDSLLQQLSDKAGR
>NZ_CP048286.1|WP_162642415.1|4049804_4051676_+|NADH-quinone-oxidoreductase-subunit-L
MDTTFSQAAWLIPLFPLVAFLLLLAFGRSSRMIGVTLGSVSSLAGLVLSVLVLIEHMTDGTKYYQYAFKWIDTGSVVFKAGFEVTNLTALMLVVVTAVSFLVNVYSAGYMKDDERISVFYGYVALFTFSMLGLVLADNMLTLYIFWELVGVCSFLLVGFWFSKPEAKAAAKKAFIVTRIGDAGLLLGILLLYWYMPDHALDFVRIGNAFEGGSGVIAASVTTWIAILIFVGAVGKSGQFPLHVWLPDAMEGPTPISALIHAATMVAAGVYLVARTFDIFQASQAAMDTVAYIGGFTAIFAATIGVAQNDIKRILAYSTVSQLGYMMMGLGLNSMTGGVFHLFTHAFFKALLFLGAGSVIHAVHTQNIQEMGGLGSKMKITAWTFGIGTLALSGIPPFSGFWSKDMILNIAYHEKPVLFVVGVVAAFFTAFYMSRLFFLVFTGKPKGHAQVHESPSSMTIPLIVLAVLAVVAGFVQTPWNDTLGTWLTDGAEQENGGGGLVMVISAAVGLLGLYLGWLVFVKGMISRDFISSRAPWLVKLLERKYYIDELYDLIIVRPLRSVGGLLNAVDDYIVDGLVRAAGGAAVLLGRGGTRMQNGQLQTYGLITVFGLVILIAAVALRRFW
>NZ_CP048286.1|WP_162642414.1|4049496_4049799_+|NADH-quinone-oxidoreductase-subunit-NuoK
MLSSYLTIAAILFCVGLYGALTKRNAVIVLLSIELMLNAVNLNLVAFSKYGIMPSLTGQMFTLFSIAVAAAEAAVGIAVLIALYRARGTVNVDDYDEMRR
>NZ_CP048286.1|WP_162642413.1|4048977_4049496_+|NADH-quinone-oxidoreductase-subunit-J
MFNIDFSGEFVAFFVFSVMIISGAVLMVSFTKVVHMVVSLAAVFIGVAGMFILLNAEFLAFVQVLIYAGAVSILMIFGIMMTKHQEAETEQPRTMQETLTAIGALALFGILFYAIRQSDFPEPQAVPDGTADNTMAIGQALFTSYVVPFELVSVLLTVAFIGAIVLAKKEAD
>NZ_CP048286.1|WP_162642412.1|4048518_4048974_+|NADH-quinone-oxidoreductase-subunit-NuoI
MKGLLKGLGVTLQSMTKKKVTTSYPDVPIIMPDRFRGIQHFEPDKCIVCNQCVRICPTECITLTGKANPDPEKKGKVIDTYDINFEICILCDLCTEVCPTEAIVMTGNFELASYSRDDLFKDMKWLDENNRLVRQDNNNIGAPAAAKGGAK
>NZ_CP048286.1|WP_162642411.1|4047365_4048376_+|NADH-quinone-oxidoreductase-subunit-NuoH
MGAWLDETLTWGHALLFFLWGVILLLVVLGFVTYAIFFERKVIGWMQYRIGPNRVGPWGLLQSVADITKLLIKEDTIPRKADRALFILAPALAYVPAFAVLAVIPYTQKLYFADINVGLLYYVALSGISTIAIILGGWSSNNKYALLGGMRSAAQMISYEVPLVISVVGVIMLSGSLNLRTIADQQGDWFWQWNFLPQIIGFVVFIIAAVSELNRTPFDLPEAESELVAGYHVEYSGFRFAFFMLTEYVYVYAIAALTTVLFLGGWHAPFPFLDWVPGLIWFLLKFTSIVFFLFWIRATLPRIRIDQLMGLGWKVLLPVAILNVFLTAVYLELFVK
>NZ_CP048286.1|WP_162642410.1|4046265_4047366_+|NADH-quinone-oxidoreductase-subunit-D
MIRTEELLLNVGPQHPSTHGVFRIIVKLDGEVITEAIPVMGYLHRGTEKLAEDLNYTQIIPYTDRMDYVSAMTTNYALCHAVEKMMGLEVPERAEFMRLIVMELQRIASHLVWWGTYLLDIGAMSPFLFAFRDREIIINLFNELCGARLTYNYMRVGGVKWDAPPGWIEQVRDFIPYMEGKLAEYHNLVSGNEIFLARIQGVGRYDAETAINFGLSGANLRSTGVNWDLRRSKPYSLYDRFEFDVPLGHNGDCFDRYNVRMEEIRQSLRILKQAVAQFPGPGDVMGKVPRVIRPPAGELYVGIESPRGEIGCHIVSKGKAEPYRLKFRRPSFVNLQILPKLLVGETMTNLITILGGIDIVVGEVDC
>NZ_CP048286.1|WP_162642409.1|4045053_4046259_+|protein-NuoC
MSDDKEKESGQPPAPESSEPAAGDSAANESSATVQPEGEPVPSEVTDASPKADGASTPAASSDAAPLIGEPEQGAGPAAADAAASGAAPPAAEATSPSGGASAADATAPSGEAPAVDPEREAKLKAAAEARAARAAAKAAAEGEAPAAGTAAPSGEAPAVDPEREAKLKAAAEARAARAAAKAAAEGGASAADAAAPSGEAPAVDPEKEAKVKAAAEARAARAAAKAAAEGEAAAPAEPKPPSPMQPQLDLAAELIRTAVSGDAIEEAYINELDGHRPTLIIRGEHLLATSQLLKTHAKLQMNYMRNLSGVDYETHLEVVYHLVSLQSGQEITVKVKTNREAASVPSVVPVWETANWNEREIYDLLGIDFPGHPDLRRIMMPDNWVGYPLRKDYEPLDLEV
>NZ_CP048286.1|WP_162642408.1|4044538_4045057_+|NADH-quinone-oxidoreductase-subunit-B
MEFNLESITPEERQELERNVFMGTLEQLKAWARSNSLWPLTFGLACCAIEMMGTGASHYDLDRFGVMFRTSPRQSDVMIVAGTVTKKMGPLLRRLYDQMPEPKWVIAMGSCATAGGPYVKSYAVMKGVDQIVPVDVYIPGCPPNPAALIYGINKLQEKIRYEAKTGKRVTDR
>NZ_CP048286.1|WP_162642418.1|4055826_4058436_+|S8-family-serine-peptidase
MDVVRPADSGADTAEWLLRLQNTPEIAYVEPVGRVQMLAAEPASNDPELPKQQFLNQIGAKQAWTKVRDQKDITIALIDTGVDLNHPDLKDNLVPGTNLVAPGKPPEDDNGHGTEVAGVIAGEGNNKLGIAGILWHAKIMPVKALDADGYGDEERLGEAITYAVDHGARIVVLSVGLYRYSPYLKDIATYAESKGALLVAASGNDGEVLGDKAKVKYPAAFPTVMAVAGATPGGSPETRSNAGPEIDLAAPWRVYTTALGGGYTQEEGTSMAAPQVAAAAALVWAVHPEYKPYQIRGLLRQTAQDIGNPGFDNASGYGLLQIDKAVTASLQADSFEPNNSRQSAKLFPLDTKIAAELSGSADADWYRIEAPYDGTVSIQVQSLPAAGESVPTLELTHGGDTSDQSVKQTKLSNQTVEWHVKKGRNDFEVRLFNRSSKQKMAYLLTSSFQIAPDAYEMNDKQYQAFTLQPKSQQIVGNFHQTGDQDWYAIHFETGGTLKLSVTTDSARMDPALAYQRQGGTLLEEDANSEGEGEATEPIDISPGTYYIRMRNAMSAQASSTASQYKLNLQFITRYADPNEPNDKSYEATGVSPGARYSGVIGVQGDVDWYQVRLAAASMVTVQLSGIPAGISMKAEVFDKRQKQVTSMKSAPSASAVAKEQRLEAGLYYIKVTASAAFDKQYYGLQVKAETLVAGFRDIDGHWAESAIVALNKKGIVGGSGNYRFNPDQSISRAETVSMLARAIKPQGSASKVKFNDVSASHWAYASIVNAAGAGWIGGYPGGGFGPGRPVTREEMTVILLRALHVQSVRPTAAAFNDVPANRWSAPAIWTAAHKGLMGGYSDNRFEPERPATRAEFASVLLRALNANLG
>NZ_CP048286.1|WP_162642419.1|4058450_4058696_+|DUF1146-domain-containing-protein
MDQVASSAGMHALMSIVIELFSIALAWIVIQEIKWDAIMKRPRGPQVRLVQIVLSIVLGHGFASFVLAYWNWSGLLRGIVE
>NZ_CP048286.1|WP_162642420.1|4058910_4060323_+|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MSKIIVRGGKRLSGTVRVSGAKNAVLPILAATLLAKDGESVIHDVPFLDDVQTIQQVLSALGGKLTYDNETMRISAENLVSFEAPYEWVRKMRASFLVMGPLLARLGRARISLPGGCAIGTRPIDQHLKGFEAMGAEIALGQGFIEARTEGKLKGAKIYLDFASVGATENIMMAAVLADGTTTIENAAKEPEIVDLANYLNAMGAIVRGAGTGIIRIEGVESLSGVSHTVIPDRVEAGTYMIAAAMTGGDVHIEGAIGDHLAPVISKLQEMGVAITETDIGIRVTAAKKLKSVDVKTLPYPGFPTDMQSQMMALLMVSEGTSIVTETVFENRFMHVEEFQKMNAHIKVDGRTAIVSGGTKLTGAKVTATDLRAGAALVCAALCADGESEITGIHHVDRGYVDITGKLASLGADILREENTESAQPLYVKVLEDVAAALEEAEPAIVAARTQEPAKREKELPRMKAQPTWA
>NZ_CP048286.1|WP_162642421.1|4060507_4061701_+|stage-II-sporulation-protein-D
MNRARWKAGRSYRRRFWTRGWWLGFLWGLLLVLLVKGAVYFLAHERAKEEGLRPPTPAFLSESAPAEADNTIANPTTGGNGSTSPESDGTSQEDAQAASGSAADKPAETVSDYDRLWVSVYLTEEKRIERMPIELYVRGVLAGEMPVDFELEALKAQAIAARTYIYRRLLTGDRSGLTDKAKKADVDDTVMNQVYVSLGALLGRWSGSEKEANLQKLNEAVEGTKGLIVTYGGEPIQASFFSTSNGYTENASDYWNVDLPYLRSVASPWDKEISPKYEEKVTMKLKEAAAKLGVKTAEVRSMRILDTTSGERVKDIKVGGETFTGREIREKLSLASSDFAWTIDGNEISFTTKGYGHGVGMSQWGADGMAENGATARQILSHYYSGAKVEPASGTLN
>NZ_CP048286.1|WP_162642422.1|4061809_4062565_+|M23-family-metallopeptidase
MSDNKSKFNEEAPKNAMGGKAVKPSAWRKLMAKKWAAPSAFLAAAAIIVTLMWLYGGAGETSDKPASTSVDATQGVTDETTLDDQTTDADKMVEKSQDELMKWPADKSQLDVLAPYYDVQSSSENRAAALIQTYDNKFIPNMGIDLGKNDVAFDVKAALSGVVTVAEKNPINGNVVQIKHANGMVTIYNSLSDVQVKVGQDVKQGAVIAKAGRDELEKDLGVHVHFEVRQNGKPMNPSTLIEAASSGTEAQ
>NZ_CP048286.1|WP_090575384.1|4062751_4063039_+|sporulation-transcriptional-regulator-SpoIIID
MHDYIKERTIKIGRCIVETKHTVRTIAKEFGVSKSTVHKDLTERLPEINPDLADQVKHILEYHKSIRHLRGGEATKIKYKKSSGRKREVLAAAKS
>NZ_CP048286.1|WP_162642423.1|4063143_4064154_+|MreB/Mrl-family-cell-shape-determining-protein
MFSKDIGIDLGTANVSIHVRGRGVVLDEPSVVAIESETKRVLAVGEEAHRMVGRTPGNIIAIRPLRDGVIADFEITEIMLKAFIDRVGGRSWYSRPRILICAPTNITSVEQKAIREAAERSGAKDVFLEEEPKAAALGAGMDIYQPSGNMVVDIGGGTTDVAVLSMGDVVTASSIKVAGDKFDEAIMKYIKSKYKLLIGERTSEDIKIKIGTVYDNGFRDEIDIRGRDMVTGLPLTVTIYSDEVREALWEPVSSIVSAAKSVLERTPPELSADIIDRGVILTGGGALLGGLDALLAEELKVPVLIAEDPMHCVVKGTGLLLDYLDRVPRRADNAKR
>NZ_CP048286.1|WP_162642424.1|4064340_4065207_+|flagellar-hook-basal-body-protein
MLRGLYTAAAGMISQQNRHDTITNNIANINTPGYKQKYAVTHSFPDMLLHLTGSNDIDNGKSVGKLNTGVFAEESLQINLQGDLMQTNQFSDFAIVSDIGVPGVNFDSSGKALTADGQLIFQPQAFFTVQNQDGETRYTRDGQFKLDEQGFLTLPDGSRVLGADGKPFQLPAGMTFNELSLTTDNRLVNPVTGQSAGQLLLTRVDNPNKLVREGDGKFKLADGETVARPINAADRVEVRQGFVERSNVDASQSMVDMMSASRAYEANQKVIQFYDKSMDKAVNEIGRI
>NZ_CP048286.1|WP_162642425.1|4065311_4066133_+|flagellar-hook-basal-body-protein
MNGSMITAMASMNGLQQKLDMLADNIANVNTVGYKKKVGTFEDLLTTLKEQPEAFNQPGRLTPMGFNQGWGSRLTMVQPDLSQGPLQQTDQPFDVAIEGNALFQVQVDDAGHLGYTRGGSFQTSFTNNGINILTTKEGYPVSSTSGQPIEIPPEMKAVSIDASGNVIGTSPAGQIVQLGQLQLVQVDKPALLNQVSDNLFAIADGVATASVLHDVTASPESKIAVKQGYLEQSNVVLADEMTDLISVQRAYQLSARALTSSDTMMGLANNLRA
>NZ_CP048286.1|WP_162645315.1|4066273_4066495_+|DNA-directed-RNA-polymerase-subunit-beta
MTAKETKAAARKKRHPAVRVIRWMLLKSIVPILCVLAVIGGMYIGYAVLGKRPGAEIFEVETWKHMYDLIFAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_12

4388186-4388261

Orphan

Consensus_repeat	Method
TTTGTACGAAAAATCGTACAAAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_12

>merge|NZ_CP048286|12|4388186-4388261|CRISPRCasFinder
TTTGTACGAAAAATCGTACAAAGTAGCGTGCGAGGCAGCTTGTCGCCAGTGTTTTGTACGAAAAATCATACAAAGT

>NZ_CP048286|12|11|4388186-4388261|CRISPRCasFinder
TTTGTACGAAAAATCGTACAAAGT	AGCGTGCGAGGCAGCTTGTCGCCAGTGT
TTTGTACGAAAAATCATACAAAGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162642644.1\|4380886_4382662_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225519
NZ_CP048286.1\|WP_162642642.1\|4378315_4378993_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|129802
NZ_CP048286.1\|WP_162642641.1\|4377418_4378300_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP048286.1\|WP_162642649.1\|4386198_4388055_+\|glycoside-hydrolase-family-127-protein	unknown	unknown	gnl\|CDD\|369609
NZ_CP048286.1\|WP_162642652.1\|4390094_4390526_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240039
NZ_CP048286.1\|WP_162642650.1\|4388436_4388922_+\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
NZ_CP048286.1\|WP_162645333.1\|4390647_4391118_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP048286.1\|WP_162642657.1\|4395127_4396054_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162642639.1\|4375385_4376621_+\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|235410
NZ_CP048286.1\|WP_162642658.1\|4396238_4396976_+\|trehalose-utilization-protein-ThuA	unknown	unknown	gnl\|CDD\|227150
NZ_CP048286.1\|WP_162642651.1\|4389067_4390003_+\|serine-acetyltransferase	unknown	unknown	gnl\|CDD\|200082
NZ_CP048286.1\|WP_162642653.1\|4391166_4391604_-\|pentapeptide-repeat-containing-protein	unknown	unknown	gnl\|CDD\|224276
NZ_CP048286.1\|WP_162642647.1\|4384378_4385335_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP048286.1\|WP_162642640.1\|4376738_4377293_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642643.1\|4379222_4380890_+\|response-regulator	unknown	unknown	gnl\|CDD\|381091
NZ_CP048286.1\|WP_162642654.1\|4391759_4392656_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162642655.1\|4392953_4393907_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350126
NZ_CP048286.1\|WP_162642656.1\|4394140_4395010_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642645.1\|4382779_4384231_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
NZ_CP048286.1\|WP_162642648.1\|4385331_4386162_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162642644.1\|4380886_4382662_+\|sensor-histidine-kinase	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	1.26894e-48
NZ_CP048286.1\|WP_162642642.1\|4378315_4378993_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|129802	TIGR00719, Probable_L-serine_dehydratase_beta_chain, L-serine dehydratase, iron-sulfur-dependent, beta subunit. This enzyme is also called serine deaminase. This model describes the beta chain of an iron-sulfur-dependent L-serine dehydratase, as in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of beta chains from the homologous region of single chain forms such as found in E. coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	1.25098e-59
NZ_CP048286.1\|WP_162642641.1\|4377418_4378300_-\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	4.5533e-90
NZ_CP048286.1\|WP_162642649.1\|4386198_4388055_+\|glycoside-hydrolase-family-127-protein	gnl\|CDD\|369609	pfam07944, Glyco_hydro_127, Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.	2.18853e-169
NZ_CP048286.1\|WP_162642652.1\|4390094_4390526_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240039	cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.8008e-41
NZ_CP048286.1\|WP_162642650.1\|4388436_4388922_+\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	2.63376e-09
NZ_CP048286.1\|WP_162645333.1\|4390647_4391118_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.19642e-21
NZ_CP048286.1\|WP_162642639.1\|4375385_4376621_+\|sodium:proton-antiporter	gnl\|CDD\|235410	PRK05326, PRK05326, potassium/proton antiporter.	1.29064e-65
NZ_CP048286.1\|WP_162642658.1\|4396238_4396976_+\|trehalose-utilization-protein-ThuA	gnl\|CDD\|227150	COG4813, ThuA, Trehalose utilization protein [Carbohydrate transport and metabolism].	5.619e-132
NZ_CP048286.1\|WP_162642651.1\|4389067_4390003_+\|serine-acetyltransferase	gnl\|CDD\|200082	TIGR01172, Serine_acetyltransferase, serine O-acetyltransferase. Cysteine biosynthesis [Amino acid biosynthesis, Serine family].	1.26495e-53
NZ_CP048286.1\|WP_162642653.1\|4391166_4391604_-\|pentapeptide-repeat-containing-protein	gnl\|CDD\|224276	COG1357, COG1357, Pentapeptide repeats containing protein [Function unknown].	5.91493e-05
NZ_CP048286.1\|WP_162642647.1\|4384378_4385335_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	4.65944e-86
NZ_CP048286.1\|WP_162642643.1\|4379222_4380890_+\|response-regulator	gnl\|CDD\|381091	cd17536, REC_YesN-like, phosphoacceptor receiver (REC) domain of YesN and related helix-turn-helix containing response regulators. This family is composed of uncharacterized response regulators that contain a REC domain and a AraC family helix-turn-helix (HTH) DNA-binding output domain, including Bacillus subtilis uncharacterized transcriptional regulatory protein YesN and Staphylococcus aureus uncharacterized response regulatory protein SAR0214. YesN is a member of the two-component regulatory system YesM/YesN and SAR0214 is a member of the probable two-component regulatory system SAR0215/SAR0214. Also included in this family is the AlgR-like group of LytTR/AlgR family response, which includes Pseudomonas aeruginosa positive alginate biosynthesis regulatory protein AlgR and Bacillus subtilis sensory transduction protein LytT, among others. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.84225e-41
NZ_CP048286.1\|WP_162642654.1\|4391759_4392656_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.45329e-24
NZ_CP048286.1\|WP_162642655.1\|4392953_4393907_+\|hypothetical-protein	gnl\|CDD\|350126	cd18614, GH130, Glycosyl hydrolase family 130; uncharacterized. This subfamily contains glycosyl hydrolase family 130 (GH130) proteins, as classified by the carbohydrate-active enzymes database (CAZY), most of which are as yet uncharacterized. GH130 enzymes are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.	6.92624e-13
NZ_CP048286.1\|WP_162642657.1\|4395127_4396054_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.89887e-25
NZ_CP048286.1\|WP_162642645.1\|4382779_4384231_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.93095e-73
NZ_CP048286.1\|WP_162642648.1\|4385331_4386162_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.59627e-76

>NZ_CP048286.1|WP_162642649.1|4386198_4388055_+|glycoside-hydrolase-family-127-protein
MSIVNNPVKGWQGVPFSSVNINDAFWRPRLEVLKNVTISVCLDQCEQTNRIANFAVAGGLQEGKFEGIYYNDSDVYKVLEGAAYALMTDRDPELEAEIDRIIGLIEAAQEPDGYLCAYFTIEAPERKWTDMEKHEMYNGGHLIEAAVAYYQATGKRRLLDVACRLADHYDALFGPGKRHWAEGHEEIELALVKLFRATGEERYWKLALWLLEERGHGHGVGAIWDKPEWGPAYCQDDVPVRDIREVKGHAVRAMYLYTAMADVALASGDAAYIEALDRVWAHTAERNMYVTGGIGPSQHNEGFTSDYDLPNESAYCETCAAIAMAFWNHRMNLLHGDGKYADLVEREMFNGALAGISLSGDKFFYVNPLASKGEHHRVEWFHTSCCPTNLARFLPAIGQYAYAVTEDGIAINQYMNSETTINAANAAGGGKVQVLQSTAYPWDGRVAITILPEQAGKFAVRLRVPGWCRGYRVSLQGDDRIGGGADTKTDKGYIVLNRHWMPGDTVLLELDMPVEAIRSRPEVEANRGRVAFQRGPVVYCAEGAGNDGLAYDEFALSAGAPFAIEHREELLGGVTALRGQTSEGKACSLTPYYAWDNREAGFMQVWMREAEDRQLYRF
>NZ_CP048286.1|WP_162642648.1|4385331_4386162_+|carbohydrate-ABC-transporter-permease
MRESRLKLAAGYVALLIVSVMFIVPFVWLLRSSVMDLSQIFIMPPEWIPRPFHFDNFKNAMTVVPFGAFFKNTLIIVVGVLLGTVVSSTIAAFGFSRIRWKGRDMVFAILMSAMMLPGAVTLIPSFLGWKTLGFYDTFYPLIVPAYFGGGIFNIFLLRQFYLTIPQDFDEAAFVDGANYFQIYWRILLPLSRSAVIVVALFTFLGSWNDFMGPLIYLKSDSHFTLALGLQMFQGSYTAQWDLLMAASAAVVMPCVVVFLIGQRYFLEGITLTGLKG
>NZ_CP048286.1|WP_162642647.1|4384378_4385335_+|sugar-ABC-transporter-permease
MEAPALDRQSALDTQAIRKRKNARERKALFYGLLFTSPAILGFLIFTLGPMIASFYLSLTDYNVFKEGTDFIGFDNYAKLFSGEDDLFYQSLGTTFYFVVLRVPAVIIISFILALLLNMNVKGRSVFRTIIYLPSIVPAVASSMIWLWLLNPDLGLVNNVLQKLHLPTSSWLFGEGSVIPSIVLTTLWGIGGTVIIFLAGLSGIPKQYYEAIDVDGGGWFHKLRHITIPMVTPTIFFNTIMTIIGSFQVFSEAYILTQGGPNNKSLFFVFYLWRTAFRDTEMGYASALAWVLFIIILVFTAIVFKTSKSWVHYEGERT
>NZ_CP048286.1|WP_162642645.1|4382779_4384231_+|sugar-ABC-transporter-substrate-binding-protein
MFRNQWKLVSMLLVLLVAAVTVLSGCTKSDAGGNTNAAQGNGGTNEAGADNADAGTANAGSGEPVKLRLTGWGAPDEVAAYKLAIAKFEKAHPNIKVDFQAITADYDTKLTTMVAGNDEPDVAMMESATIAYPLAEQGKFLNLQDYLDNDGEITPDALVPNITYSSEPGNVIGIGPGPETFVLYYNEDVFKDAGLTPPPADPAQAWTWEQFVDVAKKLTVDSKGRNASEEGFDPKNIKQFGINLPTWWGVYSNFIYSNGGDFLSADGKTLGLNQPEAVEALQKLADLINVYHVAPSPLQAKNIPGTNVALQTKKVAMAFDGQWATASLAQSKFHYNVGALPVMKQPVTTVVCGMFSIFKSTKHPQEAWELTKALLDPDASLDMLTAGTWMPSHKDWYTDADKLAKWTENLPSRPSGYKGAVIDVLLNHSHPTPTAYVKNFNKIMDVINPALDKVWLGKQSAKEALDAVAAKAQEQVQGRRDVN
>NZ_CP048286.1|WP_162642644.1|4380886_4382662_+|sensor-histidine-kinase
MTFRARLLLSYLVLIALPLFVLGTLFYRTSLNVVTEQAQKNVYAVVKKNDEVIDTKLGLAEQNSRALFVDKDLFQIFNNLNPANEEELVAADRQVSTILSKYFSQNEDVYAAQLWTTYFSFGTSRSMPQGDPAQSEIYKEAEQAAGKMVWYPTYDFIHMFNQPWLKKGTIEYRYLFSATRMLNFSHMDDSTLVKLKPNVERPVLTISYKSTVLDELFEQSIPAGSTYMVLNPDNIVVASSDKAQVTKRYKQDWIEAFRAKGSGTQRLKLNGRNQIVCFDQSEVTGWLSVVITPQSALVSNLVPIIRTTTIVSALVLSGVALLFAYFILGRIIGPIKKLMSAMRSVGEGDFHTRVDVARNDEFGLLTQRFNRMNDRIQMLVKENYEIKLKEKEAEIHALNMQMNPHFLYNTLNIMNWTAIENNQKELSKMLVCLSNMLHYTSRKEWGAVHLSEEMEWMKNYFYIMSARFEGKFSVSYEIEPSLFEEKLPRLLFQPFVENAILHGFSQMEEGGRIAIRGWTEGASRYFEIRDNGRGISKEGIDAILYKESASVGIKNTISRIRMAYGDVYGIQIRSAPGGGTSVVIHLSHNTQ
>NZ_CP048286.1|WP_162642643.1|4379222_4380890_+|response-regulator
MNILIVDDEPRHLRGMAAMIRTMRPHAQVSVAKDGEVALASIRSELPDVVLSDIQMPNMDGLALLKLVAEEGIRTKIVMVSAFNLFDYAQTAIRHGACDYLLKPIDADKVEELLQRLEHQLAMEEKERGESAELKQRLRLASSAYRSRLLHLWLSGDLPPEEREELADWALLREVDALIVTEIGSGTNDADDANDQQALLPSLLQSLTGQLEQAGAAFGQACAWPLQTEPGQNIRIVTALRLRRPVPISAAELNELNRGIRAVLLALSASRQPDLRLSHGIGAAVFPAEPDTGAARIPNLYLQAQTALAYAFHDEWQGIVNGAELLPAPAAIFRLDGEQLFEALQEPSPAAAEALCRAAFQELAASGHADPKLMKDYAALTIMKIKSRTKDIVERQLGSVLTETAVSGIPACVSSGALIELLLLRLNEVHRSLNARKQGRSELIIEQCLCWIQEHYREDVTLEMAADRFHFNASYFSTLMKSRTGRSFSDHLTETRMRRAKELLGAGQLRIYEIAEQCGYRDTKYFTRMFKRQVGLSPEAYKHMESKSSGNEGEA
>NZ_CP048286.1|WP_162642642.1|4378315_4378993_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MRFKDVFSIIGPPMIGPSSSHTAGAARIGRAARQLFGRLPQRADVIFYGSFAATYEGHGTYAAVVGGLLDMATDDVRLPDSLDIAMQEGMQPEAITGKGLYPHPNTAELHLYENSEDEEPAFTLVGTSIGGGNIEIVSIDGFKVKMTGNYPTLVIQNADAPGMIAIVARLLQHHGINIGTMTVDRKSRSGEAMMVLETDEDFPPTLRGELAAYAEIHTVRFVHIT
>NZ_CP048286.1|WP_162642641.1|4377418_4378300_-|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MHFRTLRQLSEQAEAAGLSIGRYMLKEQAEETGKSPEEEFQQMAAYYGIMKEAVQRGLTEDTTSRSGLTGQDAKRIMAYREAKDSLLGADASLAMGYALAVSEVNASMGRIIATPTAGSCGIIPGVFLSCQERFGWSDEDMTYGLFAAGAIGYVIANNSFVSGAEGGCQAEVGSAIGMAAGALADVRGAKPTQAIHAVGLALKNSLGLVCDPVGGLVEVPCIVRNGFGAVTALAAADMALAGVRSVIPSDEVVQVMLEVGSAMPDTLRETAGGGLAQTPTGKRIMEDLRRKKK
>NZ_CP048286.1|WP_162642640.1|4376738_4377293_+|hypothetical-protein
MMRRRRVPALWFALLFPVQLVIQLLLVLFGQRPDSVVQAFLATSGFHLSRLPAPPPEMVGGDGHYLCTVAARGHRRVVKPLRAGIRHGAAITANRQLMIANAFENVLEQYMPACHRTIRRLYDTYGYPVSRQIRSKLAADAVFIVMKPMEWSFLLVLYTVDSRPENRIQVQYSEFGKKGRPTGD
>NZ_CP048286.1|WP_162642639.1|4375385_4376621_+|sodium:proton-antiporter
METSTTEIIGYLMQLLLIVIGTGMIAGTLAKKLHLPDVALFILAGMLIGPGLHWIHESDSSLTNQLILITGSVLILFDGGRNIRLHGLRQVGWTVGLLSVPGVLVTVAVVGTAIHWLFGLEWLYAFLCAAVIASTDPASIIPVFRQVRIRERVRETVESESAFNDATGSILTFALLAAATGKSALDAGSITLDFLKTGLGGIAVGCALGYAVSFAVSHFRFGLLRDYTTIAMLGTAIGAYAVGEMLHVSGYMATFAAGLIWGNSSSFNLHMGHKQEEMGHYLDNMTVLLRMLIFILLGSQVDFGVMAEYLWQSVLAIIVLMFVARPIAVLLCALPDVKSRWTLKEMAFMMWVRETGVIPAALAGMLAGLGVKHANVISSVTFMAVMLTIVLQASTTSWMARKLGITVTSHE
>NZ_CP048286.1|WP_162642650.1|4388436_4388922_+|SMI1/KNR4-family-protein
MSMEELIARIRMTPDCIVLPPSGLPATDEHLRLPEDVRTFYALCGGVTLYQFADYSVNIVPPEEFEPANPVIVGERCEDDISAQWYIAADDGNGDYFTIDLAPERCGKCYDSFHETHGLVGNTPVIARSFTELLERLLANKGQYWYWLDEGFEPLGDAYEE
>NZ_CP048286.1|WP_162642651.1|4389067_4390003_+|serine-acetyltransferase
MFHKQIGGLVSTISNSYREQSHTILLDAKDLPNRDTIIEVIHQLRELLFPGYFGKQNLVNDTIEYHIANLLLSIHEKLHEQITRVLRHQALENNDVVLDADAKADAIIDAFLSKIPELRCILATDVQAAFTGDPSAETTSEVIFSFPGIFAVSIYRLAHELYKLSVPLIPRIMTEYAHSETGIDIHAGATIGNHFFIDHGTGVVIGETTTIGNGVKIYQGVTLGALSTRGGQSLRGVKRHPTIEDEVTVYSGASILGGETVIGEGVVIGSNAFITVSVPSGTKVSVRSPELVFKGRRPQELQQEFVADWII
>NZ_CP048286.1|WP_162642652.1|4390094_4390526_+|NUDIX-domain-containing-protein
MKTPLFYGAVHLLFYQDERVLLLKRQNTGFEDGKWSVVAGRIDGNEEVKSAAIREAKEEAGVDILPDDLDVVGVVHRKNVSSEWIDFYLKVRAWQGEITNMEPHKCEELTWFHLRELPENIIGYIRLAVERDHGHMWFESLGW
>NZ_CP048286.1|WP_162645333.1|4390647_4391118_+|GNAT-family-N-acetyltransferase
MVIREFHASDAARIVSLFYETVHAVNKRDYAQEQLDAWAPRGEEAQRAEAWQESMVRNRSYVAEMAGVIAGFADMTNAGHLDRLYVHKDYQRRGIASMLVNKLESDARELGLPEMDTEASITARPFFERRGYRVERAQTVERNSVRLDNFRMSKLL
>NZ_CP048286.1|WP_162642653.1|4391166_4391604_-|pentapeptide-repeat-containing-protein
MDQTRGQLFTGDLTNATIENASLNETTIKFANMKNAQFLHVDFTGSTVRASNLSEVNVEGNAWWGMRMNACDVFDMQFNAGILEGATVSNSHLVHLTIDNCVIDGLVINGVSIKELIENHPDYRLHAESVPSRTRYDESRNRLNE
>NZ_CP048286.1|WP_162642654.1|4391759_4392656_-|helix-turn-helix-domain-containing-protein
MPPQDLIVQIPPLPHFLTAGSDVFLPGSRHVERQMIGVFDLIVVSSGALFMGEAGEDIRIGAGQALVLRPDLHHYPTKPCEEATHFYWVHFQAHAPWTTHDEHATLPFSSQQRSTERLRPGDFGRQYDLRLPCFITLPDPQEVYADIEGLLALDARSDLTGSWKQQTVFHNLLFRLCGEAQQGRTDSAAIQLAERTASFLKANYRQTVTNELLRTELNYHPIYITRCMRAVFGRTPNEYVNEYRLEQAKLLLLTTDKPVADIAASVGFEDPAYFARRFAKGAAMSPSAYRKQFEVGGG
>NZ_CP048286.1|WP_162642655.1|4392953_4393907_+|hypothetical-protein
MSEQLWNLFGGNYRQNCLSWHHSAHNPVIPASGNTWRSVWVANPDVLTFNGKQLLYYRGNGIQPNTDGKRHDRLGVAEIAGLTRDTIALRDLNDGEPIVDVGGPDEFDGKDVLDPSVIAFEGRVFVYYSAIGAGPDCVGLAVSEDGVHFNKVGNIMEGRAPAVIVKDGHVYMIYQLLQNNGYRLYLARSRDGIHFEQVSDQPIFEGTPGNWDALSIVTARLMKDGDSYYMMYGGSSYLADEPDFFGLARSTDLLHWEAHPGNPIFGCGAMGQEDGGAIWFPALLETEDAFVILYEGSRGKYSWDISSQICMASIPKA
>NZ_CP048286.1|WP_162642656.1|4394140_4395010_-|hypothetical-protein
MKFWLLDYHPAHARWEFEDMEDFERLAFDGQPMLASWIPPRLKCASSKKPTDFLMRHNGALLVTEKAAKLFQRHLRHGEAEFLPVEHKGETLYFVHVLNIPDCLDVPNCLEERIGDTLTGYKQYAFHERLAAPHGILRIRLHEGDRLVNYPFVGDTLQAAISESDLAGYQLLEMWDSACSWQQKEADFEAMVEASDRARTKNFDFGAASPYMKKKGMTVYSGKWAMRHDPEKGLLIGDLLGDGTYSWIDPMFIPPILLGLTWGIKDPEPSPSGMLGKIAGVFAGGRKKA
>NZ_CP048286.1|WP_162642657.1|4395127_4396054_-|AraC-family-transcriptional-regulator
MTVEIQHEHVAYQNPFLAIKIWQIDSDRAQNKSLRAEQDERKTALAPWNYHDEIEFLLIHRGEMFAYYGDEQLILRKGDVALFGSAEPHMTIQTKDSPLSYLVLQLNLRKYWDQSTMNNMMHFAETIRPLSALNYIFGENREARAGIAALIRDIYKEMNDRQIGYELAVSSRIKSMLLLLLRSDSRKMLHYHDHLLYERLRPAINYIEEHVDEKLSVEAVSELLNMSPTHFMKTFKKALGMTFTEFVVFKRIKRAEQLLLTSDISIADAAVAVGMSNLGHFYQLFNRLNDCSPKQFRDRLRSDAAGRG
>NZ_CP048286.1|WP_162642658.1|4396238_4396976_+|trehalose-utilization-protein-ThuA
MTQQKINVTIWNEYRHEKKNPVVGEIYPQGMHAAIAEGLSVQGEIKFATLDDAEHGLSEEVLNNTDVLIWWGHLAHGEVQDEIVERVYNRVLHGMGLIVLHSGHFSKIFRKLMGTSCDLKWREADEKERIWVVNPAHPIAAGIGEYIELPAEEMYGEHFDIPQPDDLVMVSWFEGGEVFRSGCCYNRGAGKVFYFRPGHETYPTYYNPQVRKVIDNAVKWAAPVGSEYPKYGHAKTPLEPIKGAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_13

4536979-4537092

Orphan

Consensus_repeat	Method
TAGCTCAGTTGGTAGAGCAACTGACTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_13

>merge|NZ_CP048286|13|4536979-4537092|CRISPRCasFinder
TAGCTCAGTTGGTAGAGCAACTGACTTGTAATCAGTAGGTCGTGGGTTCGACTCCTATCGCCGGCACCATTTTTTTGTTCGAGTCATTAGCTCAGTTGGTAGAGCACCTGACTT

>NZ_CP048286|13|12|4536979-4537092|CRISPRCasFinder
TAGCTCAGTTGGTAGAGCAACTGACTT	GTAATCAGTAGGTCGTGGGTTCGACTCCTATCGCCGGCACCATTTTTTTGTTCGAGTCAT
TAGCTCAGTTGGTAGAGCACCTGACTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162642764.1\|4542014_4543406_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274819
NZ_CP048286.1\|WP_162645342.1\|4527776_4528151_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224639
NZ_CP048286.1\|WP_162642763.1\|4540061_4540607_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|376823
NZ_CP048286.1\|WP_162642753.1\|4521453_4521981_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379324
NZ_CP048286.1\|WP_162642767.1\|4546112_4547006_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP048286.1\|WP_162642758.1\|4526334_4527759_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226657
NZ_CP048286.1\|WP_162642756.1\|4524252_4525254_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP048286.1\|WP_162642762.1\|4538307_4539702_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP048286.1\|WP_162642754.1\|4522086_4522992_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP048286.1\|WP_162645344.1\|4540708_4541941_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP048286.1\|WP_162642760.1\|4529039_4529975_-\|SPFH/Band-7/PHB-domain-protein	unknown	unknown	gnl\|CDD\|223407
NZ_CP048286.1\|WP_162642765.1\|4543460_4545155_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173857
NZ_CP048286.1\|WP_162642768.1\|4547018_4549241_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP048286.1\|WP_162642755.1\|4523198_4524239_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176201
NZ_CP048286.1\|WP_162642759.1\|4528490_4528967_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP048286.1\|WP_162642761.1\|4529981_4530407_-\|NfeD-family-protein	unknown	unknown	gnl\|CDD\|224501
NZ_CP048286.1\|WP_162642757.1\|4525297_4526167_+\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580
NZ_CP048286.1\|WP_162642769.1\|4549324_4550659_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274819
NZ_CP048286.1\|WP_162642766.1\|4545167_4546097_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP048286.1\|WP_162645343.1\|4537772_4538189_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|366361

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162642764.1\|4542014_4543406_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP048286.1\|WP_162645342.1\|4527776_4528151_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224639	COG1725, COG1725, Predicted transcriptional regulators [Transcription].	2.50764e-20
NZ_CP048286.1\|WP_162642763.1\|4540061_4540607_+\|OsmC-family-protein	gnl\|CDD\|376823	pfam02566, OsmC, OsmC-like protein. Osmotically inducible protein C (OsmC) is a stress -induced protein found in E. Coli. This family also contains a organic hydroperoxide detoxification protein that has a novel pattern of oxidative stress regulation.	4.08282e-17
NZ_CP048286.1\|WP_162642753.1\|4521453_4521981_+\|AAA-family-ATPase	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	5.20302e-07
NZ_CP048286.1\|WP_162642767.1\|4546112_4547006_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.07136e-101
NZ_CP048286.1\|WP_162642758.1\|4526334_4527759_-\|hypothetical-protein	gnl\|CDD\|226657	COG4194, COG4194, Predicted membrane protein [General function prediction only].	1.22479e-08
NZ_CP048286.1\|WP_162642756.1\|4524252_4525254_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	5.34023e-59
NZ_CP048286.1\|WP_162642762.1\|4538307_4539702_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.29443e-20
NZ_CP048286.1\|WP_162642754.1\|4522086_4522992_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	7.26778e-30
NZ_CP048286.1\|WP_162645344.1\|4540708_4541941_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.51706e-87
NZ_CP048286.1\|WP_162642760.1\|4529039_4529975_-\|SPFH/Band-7/PHB-domain-protein	gnl\|CDD\|223407	COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones].	3.69427e-46
NZ_CP048286.1\|WP_162642765.1\|4543460_4545155_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173857	cd08492, PBP2_NikA_DppA_OppA_like_15, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.02184e-178
NZ_CP048286.1\|WP_162642768.1\|4547018_4549241_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.61804e-170
NZ_CP048286.1\|WP_162642755.1\|4523198_4524239_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176201	cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	2.25032e-110
NZ_CP048286.1\|WP_162642759.1\|4528490_4528967_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.49052e-11
NZ_CP048286.1\|WP_162642761.1\|4529981_4530407_-\|NfeD-family-protein	gnl\|CDD\|224501	COG1585, COG1585, Membrane protein implicated in regulation of membrane protease activity [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	1.03351e-13
NZ_CP048286.1\|WP_162642757.1\|4525297_4526167_+\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	4.23577e-23
NZ_CP048286.1\|WP_162642769.1\|4549324_4550659_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP048286.1\|WP_162642766.1\|4545167_4546097_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	4.98404e-116
NZ_CP048286.1\|WP_162645343.1\|4537772_4538189_-\|VOC-family-protein	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	1.17294e-10

>NZ_CP048286.1|WP_162642761.1|4529981_4530407_-|NfeD-family-protein
MLAVAWLVLAVALVLIELHTGTFYCLLLAAASTVTIIAALAGLPLLVQCFTFVVAITLMYIFLLPLLRKLIPSTSKTPFRPITDEWIGQEAYVIQTIRPDDAGLVHLNGEVWTAIANETIEEGSKVKVVEVRVTKLFVTKG
>NZ_CP048286.1|WP_162642760.1|4529039_4529975_-|SPFH/Band-7/PHB-domain-protein
MIGIIVFIVILAVVVAIIVKGIRIIPQQTVAIVERLGKYNKTLNAGVNLIIPVIDNIRRRHDLRIHQETVPSQSVITKDNVAIGIELATFFNVMDAKLATYGIADYVGGIHNIVASALRATIGKMELDEILSNRDRIQTDLRLVLDQASENWGVRIDRVEVLQLAIPSDIQNSMEKQMRAEREKRAIILQAEGEKQSTVLRAEAQQAAVVLAAEAEKKRQILDAEAKQKAQELEALGKAEAIKHVAEAERTRIEAIKLAGLDAQILAYKSFEALGQMAEGRATTIFIPTEAVNALGSAGMIGKIFDITNPK
>NZ_CP048286.1|WP_162642759.1|4528490_4528967_+|GNAT-family-N-acetyltransferase
MITLQKITLENRRQIFNLEVSEEQRRFVASNLSSVASCYVLATNGGHPFPFAIFKDEQPVGFVMITYRITGYEDPPFAHDSYCILRLMIDQRYQNKGYGREAMKEIMAFIRTFPAGPARYCWISYKADNTPAKKLYESFGFRDNGDIIEDAQITVLQL
>NZ_CP048286.1|WP_162645342.1|4527776_4528151_-|GntR-family-transcriptional-regulator
MGITLALGFGTPKCLHETTGQLEPQEKLPTVRQLAEDLGINTMTVNKAYSLLKQEGYIVIDRRHGAKVSPRSAGRDNSQPAEQLEEQLQLLIAQAAIEGIHEAQFHALCARIFARMKIQIQPLA
>NZ_CP048286.1|WP_162642758.1|4526334_4527759_-|hypothetical-protein
MLYALSFILLIPIIICYIAIWVTYKPQAAYRNGMLFAVTLPAHAMENEDIQRIRTRFNEQFRRASWRTGAALIPFVLLYMWPAYQITYFFVWLSAFFFVMAIPFRGAFRATLALKREHEWFVGAKRVIRGDLRVARLKNAQAASPWLFAIPLAMAIGTLVWAGSADSSRLWLAGGGLVFTLICLLIFSLMRRSRASVYSENSEVNMSLNQARRRSLSYLWLYMAIVENIHFILLLSYIMNDTPSLDGIWLAALLIFAILPAGIAILTYRHIDAQKSEVLRQDGQVIYSDDDEYWSNGFTYHNPDDRTIMVPKRVGIGETVNTATWTGKIIIWGTIGIAAAAMFFASFMLIRSELTSPTLTFSADRRIEINYPMYTFDFNIDDMEELKLVDDPPGKGSKMNGEATNKVARGKFRLNGLGPARLYIFKNDPPYIRIKLKDTYIFYNDKDPEQTKLLFEQLRQSRESGQSGQSGQSR
>NZ_CP048286.1|WP_162642757.1|4525297_4526167_+|phytanoyl-CoA-dioxygenase-family-protein
MTTNRELPGSLTLEQLEQYNREGFLVLEDLLDNHDMEAPRQAMMQKVDWIADELHADGRIADKLEGEPFKYRLAKLFAELTDQDFLKYGRSWRDRIEGYYRLMSNPKILNAVESLIGGEIFANPVYNVRPKVPIVAAGAVPWHQDKSYWPDSSANPVITVWISFVDATLENGCLHIKPRTQRKKVLEWHAETYTGTGYTALHEHQLGKSKTVELPVKAGTAILFNDRLIHMSTPNGSDHVRWSVDLRYQSTEQDPMVQHGIGFLARSSKFPNRVATLEDWLAERPEHEG
>NZ_CP048286.1|WP_162642756.1|4524252_4525254_+|Gfo/Idh/MocA-family-oxidoreductase
MTASGRTTKVALVGTGGWGEQHARVLSAHPDVELCAIAGRNAERTQARAERYRTNGYTNIREMLEREQPDLVSLCLPNEQHFEATLEVIQAGYPLLVEKPIVFDLREADRLLDEAAKRNLFFAINFNHRYAKPMQLAKSRIDEGRLGEPVFGTWRFGGEGGSPDASPHGNLIETQCHGFDSLEYLMGRIVSVSAEMTDMTGKGFTTMSIGLRFENGAVGNLLGTYDSSYAYSDTQRLEINGTDGRILIEDTVRRFSFQAAGSETAEVWQAGYFNDRDREFHRTFDAHLNAVIAAFRCGGEPPIHAAAGLRALRLAQAAIRSQESGKRIMVQPV
>NZ_CP048286.1|WP_162642755.1|4523198_4524239_+|alcohol-dehydrogenase-catalytic-domain-containing-protein
MNPITIPDQMVSSVFAGSGRVAFVTKDVPKPGPGQLLILTKANALCGSDKGFYLNGSGERTPGHEIAGIVADAGPDTKAKPGTHGVVFLMDFCGSCRSCKLGYTNQCFNKRADMGFSHDGGYGEYVLINENIFFAIDADLSFSDATLLLDIMGTGGHSIRRALLARPDIESVLIAGAGPIGLGILGMVKIMLGQDIPVYVTDMNEYRLALAAQLGGIPVHAGTEDLAARLAADGLTDGVDAAFDSSGQTAARQACVQRLGKRGVLVCVGHGGDVSLRVSEELIGPERTVLGSEYFTYRELEANAEYLRQHREYLSQIITHRFPASQLQEASDLFFGGQCGKVVVER
>NZ_CP048286.1|WP_162642754.1|4522086_4522992_-|AraC-family-transcriptional-regulator
MPTLRDREHSWNDYPVLPYVRLCYRFVSPPFFQGERRLLDYLFLYLEKGRYALTVEGVDYELNEGDFALIQPGLPFTTRGYGDCVVPNAHLDFFYNPAREQSFVTTPGQTNLEPYRQLLQPRLNDFPDVRIPVLLQAQPPRPFKDTLLRMMEHFKHNDIGSALKVQQHALELLGLLLGSGGTGGSGASFAFEGQQFVQKMNAFLSFSLSAPLSVEAMAKHAGYSESHFTTVFAQHFGTTPHQYLLQLRLQKAQELLGTTALKLTQIADYCGFASDAHLSKAFKRQLGVSPREFRASPPHRR
>NZ_CP048286.1|WP_162642753.1|4521453_4521981_+|AAA-family-ATPase
MDHQLIGRKQVIYLISGPLGVGKSTTSKALAQTMQPCVLIEGDHILHMFQGYSTSWEERLRLSWKNILALTRNFIQDGFDVVVDFVVEDELAWFCSQVADLPANLNYVALMADEPRIIERLHTRGDIQCLDRSLFLRNQMLLSPSNQPFLYDTTMKDTAQIVEDIIAGDRFRVSY
>NZ_CP048286.1|WP_162645343.1|4537772_4538189_-|VOC-family-protein
MSVNQPHATNEGALPVSPVKNKVGSYFVPVRDIEKSRSWYCRVLALDENSCEIIGGHLCPLPMEGTGLILDTMPMWGGEEPGGAPSISTPAFMLLTADLQGSLDYMKQLGVELVTEIMHDHWFVVKDPDGNKLMICRE
>NZ_CP048286.1|WP_162642762.1|4538307_4539702_-|AraC-family-transcriptional-regulator
MSYADAVQRALDYIEDYLDDDEALDLAALAEEAYASVAQLYRMFYALTGHPVKDYIRKRRMSVAANHLRYSKRTVEELAGESGFASYHAFAKVFKKIVGLTPAAYRSAGIHYSFEPIRLGEQFAYMEDKEQSERFPDIKVIRFQPGTMAAYLHISEQEAGMENEAFRIVYEKLAVNGSAVKRKTRIFGYNVDLPNVDGHPRYGYRVLVLTNEPSLPDGDFEEEPFPGGLYAVRKIAAASPETVQDGWNRLVSEWLPKSSFELGRPPYIEEFIAYNGKVTRMHLFLPVLRKRHRESIEIVRLSERRAYCFRGYGEEAQTLAEQRLMDWHATGRADCGERRVANEDRYYMSFPYGVREAADYWWENGFISAPQELALNTAPTASWDGPEERRFDAGDYACCVTKTYGLLTGVLDNMHRWIAASESYRLDEGRQWYAEYRALPGMDVERDTIVSIYLPIRPSREHHP
>NZ_CP048286.1|WP_162642763.1|4540061_4540607_+|OsmC-family-protein
MSSLNEFLRQKRIALFARRTKAESAPEQAVAKLRAKARVLGRSGVREIRIRDFQVISDSPPDFAGYDLGPSSPELQLGVLGSCLTHIALIQAAERQVSLHAVEVEVEGEMHPLAGRPGHEEIPVYPHNLRYKLVLESDESEETLQALHEVIERVCPIFNLLRQPQHIEGQLVIHRPKATDE
>NZ_CP048286.1|WP_162645344.1|4540708_4541941_+|multidrug-efflux-MFS-transporter
MNSLPDWKRNLGILWLGLFFNFMAYTLSVPFFPLFLQQDLGVRSGVEAWAGVSISISFLISGICAPFWGSLGDKYGSKLMLVRSGIGLGVAHLANYFVHDPYTFILVRIFQGLMAGFGPTSMALVGTNTPEKHVGYALGVMSTSTAAGGIIGPLVGGVLSHWVGLRGCFIASGIITICSAMIVLGVKEAEKRRSANRPSVWQDLKRAALDSSLLRVYGLILLVSTSVMILDPLLTIYVVQIGGSAKNAAISSGIVFSAVGVATVIMGPRWGRIGGRLGYGRTLFIGLIGGGIGNLLQAVIHNLVGFGVLRFGYGLFFAAVYPALNALIIQYADKDFRGRAVSLSQSASQFGIVIGPLLGGFLGGWIGIPYVFLLTGMALLGAAWAGRAIGTGKRSDLEAGQTAELRSSPP
>NZ_CP048286.1|WP_162642764.1|4542014_4543406_+|LLM-class-flavin-dependent-oxidoreductase
MSQRQLKLGANLSGVGNSISFWRHPDVPINASVSLKFYQEQARIAEAGKFDLLFIADGLFINEKSNPHFLNRFEPLTLLSALAASTGHVGLVATLSTSYSEPFTVARQFASIDQLSGGRAGWNVVTSPLEGSALNFGKGEHPNHALRYEIAEEHLEIVRGLWDSWEDDAFVGDKAAGVFFDPSKMHALNHKGTHFSVQGPLNVARSQQGHPVVFQAGSSESGKDLAAKSADAIYTAHETFDEARAFYADVKARAETYGRKPEELLIFPGIGPIVGRTEEEAERKYREITELVAIEQALNYLGRYFEHFDFSQFPLDEPFPEIGELGSNSFRSGTDKIKREAKAKGLTLRQVALQASTPRSAFIGTPEKVANLIQQWFEGGAADGFNVRTVVPNGLADFVDLVVPILQERGLFRTEYESDTLRGNLGLPIPRNRYAPGAETAASIKDNASIEDGARVGATADHE
>NZ_CP048286.1|WP_162642765.1|4543460_4545155_+|ABC-transporter-substrate-binding-protein
MSKGLGVKMSVLLVIAVMLLSACDSSGAKNNAGSANAAGDKGSAGATNAAGDKNAETKAADGGELTYALATSPDSLDPARSGLAVSVRVFRTIYDSLVAQLPDNTIKPWLATEWTISPDGKSYTFKLRKDVKFQDGTPFNAEAVKYSFDRILDPATKAANASALLKPYQSSEIIDDYTIKLNLETPSVAFLGNLSQAMLGIVSPTAAKQSGDQFGKNPVGTGPFSFVKWEDNTDIQVKRNPDYAWAPELVENKGAAHLDTIDFKIIPEEATRIGSVQSGQVKAIETVPPQNVVSLKSDNKLQVLQVNTAGLPYTLFFNQTAAHAPWNELKARQAVQYAVDIDSIVKSLYLGTYQRAWSPLSPNTFGYDPSLENGIKPDLDKANQLLDELGWTKGSDGIREKDGKKLTLHYVDGSPNREKRNDIAAIIQQQLKKVGIDVQVEITKDVATVVYTNWAYDLYGNSQVNSDPAALNSFYHTTAPDARPSLSHLADPALDKLLEQGAIESDPAKRKEIYVKVQHAIIDNAAILPIYVFPYTVAATKDLSGLKFDSLGYPLFNDASLAQK
>NZ_CP048286.1|WP_162642766.1|4545167_4546097_+|ABC-transporter-permease
MLKIIAVRLLSSVGVVAGSSILVFCILYVLPGDVVMNMIDPSSMSPEAIANLRHQLGVDRPFYEQLLHYFNAMLHGDFGHSLVNSEPVLPKIMAHFPATLELTAAASAIAILVGVVLGVLSAIHRNKPIDIAARIIGLFGISMPTFWSGILMILIFSVTLGWLPAMGSDGWKTLVLPALTLGLLGAGFIVRMVRNSMLEVLGEPFITTLRAKGLLERSVMYRHALRNALIPAVTMMGILVGEMLAGTVVIETVFSRQGIGRIISDAIMSKDLPVVQGVVLFTAIVYVAINALVDISYSYIDPRVRRLQH
>NZ_CP048286.1|WP_162642767.1|4546112_4547006_+|ABC-transporter-permease
MREAASVKTVWRTKAASSAFRRRMPKVSVTRLMVYAASLVVLFLIACALVPQWIAPYSPTDMQADRILLPPGAAHWFGTDYFGRDIFSVVVHGTRESLFIGFASVIVGGLAGTLIGASAGYFGGWVDGVLMRVIDVFMTIPGVLLALAVAAVLGPGLWNLILAVALASIPNYARIMRGQILSVKNRPFILASRSIGASELPIFFKHVLPNSLSPLLVMACIGVGTSILTGSGLSFLGLGVIKEIPDWGALLSQGRGYLTVAWWICTFPGLAITLFVLSVNVIGDELRDALDPRKRRA
>NZ_CP048286.1|WP_162642768.1|4547018_4549241_+|ABC-transporter-ATP-binding-protein
MSQLLDIERVSVEFANGRGVLEAISDVSFSIKAGETVCLVGESGSGKTVTSKAVMRLIDDENGRISAGAIHLNGVDIAALPDQALRSLRGKKMAMVFQEPMSAFDPVFSIGRQIVETIRRHDRSRTQSEARQRAVDLLRRVGIPEPELRMKQYPNELSGGMLQRAMIAMALSCQPELLIADEPTTALDVTIQAQILQLLQELKSEFNMAILLITHDLGVAAAIADRIVVMYAGQVVEQASAADLFAEPHHPYTMGLLQSITTMDSDRSQKLFTIPGSIPSLADLPAGCRFHPRCPFATEKCLNEAPPLHDRGERQAACWHVEQFVADPMERQPAQEAEAAFHAEWSGEAASASASPDAPASPAASAGALMEPEPEQGVARASLEASGMAAALAPAPAESVADSLIELRHVTKHYPFDRSIFSWTKKAVQAVDDVSFAIRKGETFGLVGESGSGKSTLGRVLLQLEKPTSGSVIFEGRELGALTSAGLREERKHMQMIFQDPYGSVDPRWKVGDIVGEPFSVHGKLSAGEKREAVQELLQLVGLNPTAYDRFPHEFSGGQRQRIGIARAIALRPKFLLADEAVSALDVSVQAQIVNLLQDLRQRLNLTSLFIGHGLNIVRYVSDRIGVMYLGKLVEIAPSEQLFRRPAHHYTRALIASIPVPVPDRHRELSALHGEIPSPANPPSGCRFRTRCPAATARCAAEQPEMREIDRGHFVACHDPLDQVLNIEAGRRPVSADWRI
>NZ_CP048286.1|WP_162642769.1|4549324_4550659_+|LLM-class-flavin-dependent-oxidoreductase
MGTKRQIKLGAILHGVGGNISGWRHPDAVTDASVNFELYKQWTQKAEAGKFDFVFIADGLYITEKSIPHFLNRFEPLTILSALAGVSSKIGLVGTLSTSYSEPFTVSRQFASLDMISRGRAGWNVVTSPLEGSALNFGKTEQQHPAHSERYRIADEYLEVATGLWNSWEEDAFVRNKETGVFFDPAKMHTLDHKGSYFSVKGPLNIARSKQGETVIFQAGASESGKQFAAKWANAIFTGQESAEEAKLYYDDVKGRAAALGRNPEEIVIMPGIGPIIGRTQEEAERKYEAIANLVSIDKALDFLGRFYEYHDFTQYALDEPFPELGELGRNSFRSATDRMKERAKEEGLTLRQVALQVATPKPTFLGTPESVADKLQAWFEAGAADGFIVGSAAPNGLEEFVDHVVPILQARGLFREEYEADTLRGNLGLPTPVNRHAAALSNR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_14

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_14

4555200-4555274

Orphan

Consensus_repeat	Method
CGAAAACGCGCAAAGAGGTGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_14

>merge|NZ_CP048286|14|4555200-4555274|CRISPRCasFinder
CGAAAACGCGCAAAGAGGTGCACCCCGTGCACGACATCGCCGGAAACCCGACGAAATCGCGCAAAGAGGTGCACC

>NZ_CP048286|14|13|4555200-4555274|CRISPRCasFinder
CGAAAACGCGCAAAGAGGTGCACC	CCGTGCACGACATCGCCGGAAACCCGA
CGAAATCGCGCAAAGAGGTGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162642780.1\|4570241_4571366_+\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|372652
NZ_CP048286.1\|WP_162642771.1\|4551593_4552421_-\|TIM-barrel-protein	unknown	unknown	gnl\|CDD\|366542
NZ_CP048286.1\|WP_162642782.1\|4571605_4573384_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225519
NZ_CP048286.1\|WP_162642774.1\|4554160_4555054_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642767.1\|4546112_4547006_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP048286.1\|WP_162642772.1\|4552447_4552696_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642777.1\|4561717_4562389_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|163429
NZ_CP048286.1\|WP_162642769.1\|4549324_4550659_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274819
NZ_CP048286.1\|WP_162642773.1\|4552833_4553832_-\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187575
NZ_CP048286.1\|WP_162645345.1\|4559796_4561644_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP048286.1\|WP_162642765.1\|4543460_4545155_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173857
NZ_CP048286.1\|WP_162642783.1\|4573376_4574999_+\|response-regulator	unknown	unknown	gnl\|CDD\|381091
NZ_CP048286.1\|WP_162642768.1\|4547018_4549241_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP048286.1\|WP_162642770.1\|4550891_4551461_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP048286.1\|WP_162642779.1\|4567147_4570057_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271154
NZ_CP048286.1\|WP_162642778.1\|4563776_4566956_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187677
NZ_CP048286.1\|WP_162642776.1\|4558043_4559792_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP048286.1\|WP_162642775.1\|4556963_4557833_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|225312
NZ_CP048286.1\|WP_162642781.1\|4571340_4571541_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162642766.1\|4545167_4546097_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162642780.1\|4570241_4571366_+\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|372652	pfam13624, SurA_N_3, SurA N-terminal domain. This domain is found at the N-terminus of the chaperone SurA. It is a helical domain of unknown function. The C-terminus of the SurA protein folds back and forms part of this domain also but is not included in the current alignment.	0.00318137
NZ_CP048286.1\|WP_162642771.1\|4551593_4552421_-\|TIM-barrel-protein	gnl\|CDD\|366542	pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.	1.13088e-13
NZ_CP048286.1\|WP_162642782.1\|4571605_4573384_+\|HAMP-domain-containing-protein	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	5.42684e-47
NZ_CP048286.1\|WP_162645345.1\|4559796_4561644_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	4.3446e-179
NZ_CP048286.1\|WP_162642767.1\|4546112_4547006_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	6.07136e-101
NZ_CP048286.1\|WP_162642777.1\|4561717_4562389_+\|TerC-family-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	4.6297e-68
NZ_CP048286.1\|WP_162642769.1\|4549324_4550659_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP048286.1\|WP_162642773.1\|4552833_4553832_-\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187575	cd05265, SDR_a1, atypical (a) SDRs, subgroup 1. Atypical SDRs in this subgroup are poorly defined and have been identified putatively as isoflavones reductase, sugar dehydratase, mRNA binding protein etc. Atypical SDRs are distinct from classical SDRs. Members of this subgroup retain the canonical active site triad (though not the upstream Asn found in most SDRs) but have an unusual putative glycine-rich NAD(P)-binding motif, GGXXXXG, in the usual location. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.51087e-58
NZ_CP048286.1\|WP_162642765.1\|4543460_4545155_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173857	cd08492, PBP2_NikA_DppA_OppA_like_15, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.02184e-178
NZ_CP048286.1\|WP_162642783.1\|4573376_4574999_+\|response-regulator	gnl\|CDD\|381091	cd17536, REC_YesN-like, phosphoacceptor receiver (REC) domain of YesN and related helix-turn-helix containing response regulators. This family is composed of uncharacterized response regulators that contain a REC domain and a AraC family helix-turn-helix (HTH) DNA-binding output domain, including Bacillus subtilis uncharacterized transcriptional regulatory protein YesN and Staphylococcus aureus uncharacterized response regulatory protein SAR0214. YesN is a member of the two-component regulatory system YesM/YesN and SAR0214 is a member of the probable two-component regulatory system SAR0215/SAR0214. Also included in this family is the AlgR-like group of LytTR/AlgR family response, which includes Pseudomonas aeruginosa positive alginate biosynthesis regulatory protein AlgR and Bacillus subtilis sensory transduction protein LytT, among others. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.27731e-40
NZ_CP048286.1\|WP_162642768.1\|4547018_4549241_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.61804e-170
NZ_CP048286.1\|WP_162642770.1\|4550891_4551461_+\|N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	4.12358e-29
NZ_CP048286.1\|WP_162642779.1\|4567147_4570057_+\|hypothetical-protein	gnl\|CDD\|271154	cd14488, CBM6-CBM35-CBM36_like_2, uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.	1.80988e-19
NZ_CP048286.1\|WP_162642778.1\|4563776_4566956_+\|hypothetical-protein	gnl\|CDD\|187677	cd09619, CBM9_like_4, DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.	2.01452e-11
NZ_CP048286.1\|WP_162642776.1\|4558043_4559792_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.99373e-156
NZ_CP048286.1\|WP_162642775.1\|4556963_4557833_+\|VOC-family-protein	gnl\|CDD\|225312	COG2514, COG2514, Predicted ring-cleavage extradiol dioxygenase [General function prediction only].	2.17248e-87
NZ_CP048286.1\|WP_162642766.1\|4545167_4546097_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	4.98404e-116

>NZ_CP048286.1|WP_162642774.1|4554160_4555054_+|hypothetical-protein
MKLNVLSKTEIEQFMELGWIRLEEAIPRKQALAAADFLWDKVEEQGAIRHDPATWTKPMIRLNEDYDTPEFRACNTERLWGAIEDLIGADRAINRANAGWGYWVMNFSVGANRPWSLPTGGWHQDGSHFRHFIDSGDQGLLQLAFFSEVGSHGGAPLVIEGSHNVVARVLKQHPEGLDVFDAMRLEFQHPWIAGITDPPVDESRSAEEVAQDRIERYMNADYTDPEGYRMKVVEATGTVGDVILAHPFLIHNSSQNHLGIPRFLMTKTVPLKERMNLNRPDAADYSPLELSTVRAMG
>NZ_CP048286.1|WP_162642773.1|4552833_4553832_-|NAD-dependent-epimerase/dehydratase-family-protein
MRIVILGGTGTISTSIVRLLLQQGHDVTCYNRGQSGRELPNGVRVIHGDRGDRETFERVMQEEQFDAAIDMISFGPEDARSSLRAFRGVKHFVQCSTVCTYGVDYDWLPVTEDHPLRPTTGYGRGKVEADTVLMEAYYREGFPVTIMKPSTTYSSQSGILRQVAWDFNWIDRIMKGKPLLVCGDGKALHSFLHADDAAKAFAGVLGKTHCIGQTYNVVPRGFTTWEQHHKLAMQVLGREVELVGVSLETLKSTDAERFSICDEIFAHNVIYSPDKLMRDVPEFVPTVSLAEGMRQAFAAMVAEGRIPNSDDAAWEDEIIEAQREAFAKLANK
>NZ_CP048286.1|WP_162642772.1|4552447_4552696_-|hypothetical-protein
MIEVMTIEDFTTYKSQQGYFIIADSTGRKLHSTRCAAVDSSSFKDKAGDAASHSRRCFYTDDFFEAREYPKVKKCEECRRLL
>NZ_CP048286.1|WP_162642771.1|4551593_4552421_-|TIM-barrel-protein
MSYLSLSTWSLHRNLGPLRWTQWDADTRTHVSVETPQPELMKLVDLPAFLAKEGFGALEIGHFHFPSTDDSYLAELRGAFEQAGISFDTVLLDYGDLSTADEVRRQADIGYIRQWIDIAQKAGAKNIRVVAGESEPTDEAALARSIAGLKELHAYGQSRSVRVITENFKPLTSTAANCLAIIEAFDGKLNIVDDFGNFKGETKYEQLAAILPYAVSIHAKAQYDENGIADAEEYTRCLELLKEGSYNGAISLIYDGPGDMWEGINRVRRIVEAYL
>NZ_CP048286.1|WP_162642770.1|4550891_4551461_+|N-acetyltransferase
MNIEAVFGSFPAIQTERLNLRQLQTKDAEDLYSFWADAKVTRYLDWDGPGSVEDSGQLIESWNQAYQERRLLPWGISYRQQSELLGTITLMPTRGTFEESRYPLVMGYDLTPKQWNQGIMSEALNGVLDFTRRSLRPYRIQAEVSPENTASLKLLKKLGFQQEGVLRSYLMHEVTHKLLDIAVMALLCN
>NZ_CP048286.1|WP_162642769.1|4549324_4550659_+|LLM-class-flavin-dependent-oxidoreductase
MGTKRQIKLGAILHGVGGNISGWRHPDAVTDASVNFELYKQWTQKAEAGKFDFVFIADGLYITEKSIPHFLNRFEPLTILSALAGVSSKIGLVGTLSTSYSEPFTVSRQFASLDMISRGRAGWNVVTSPLEGSALNFGKTEQQHPAHSERYRIADEYLEVATGLWNSWEEDAFVRNKETGVFFDPAKMHTLDHKGSYFSVKGPLNIARSKQGETVIFQAGASESGKQFAAKWANAIFTGQESAEEAKLYYDDVKGRAAALGRNPEEIVIMPGIGPIIGRTQEEAERKYEAIANLVSIDKALDFLGRFYEYHDFTQYALDEPFPELGELGRNSFRSATDRMKERAKEEGLTLRQVALQVATPKPTFLGTPESVADKLQAWFEAGAADGFIVGSAAPNGLEEFVDHVVPILQARGLFREEYEADTLRGNLGLPTPVNRHAAALSNR
>NZ_CP048286.1|WP_162642768.1|4547018_4549241_+|ABC-transporter-ATP-binding-protein
MSQLLDIERVSVEFANGRGVLEAISDVSFSIKAGETVCLVGESGSGKTVTSKAVMRLIDDENGRISAGAIHLNGVDIAALPDQALRSLRGKKMAMVFQEPMSAFDPVFSIGRQIVETIRRHDRSRTQSEARQRAVDLLRRVGIPEPELRMKQYPNELSGGMLQRAMIAMALSCQPELLIADEPTTALDVTIQAQILQLLQELKSEFNMAILLITHDLGVAAAIADRIVVMYAGQVVEQASAADLFAEPHHPYTMGLLQSITTMDSDRSQKLFTIPGSIPSLADLPAGCRFHPRCPFATEKCLNEAPPLHDRGERQAACWHVEQFVADPMERQPAQEAEAAFHAEWSGEAASASASPDAPASPAASAGALMEPEPEQGVARASLEASGMAAALAPAPAESVADSLIELRHVTKHYPFDRSIFSWTKKAVQAVDDVSFAIRKGETFGLVGESGSGKSTLGRVLLQLEKPTSGSVIFEGRELGALTSAGLREERKHMQMIFQDPYGSVDPRWKVGDIVGEPFSVHGKLSAGEKREAVQELLQLVGLNPTAYDRFPHEFSGGQRQRIGIARAIALRPKFLLADEAVSALDVSVQAQIVNLLQDLRQRLNLTSLFIGHGLNIVRYVSDRIGVMYLGKLVEIAPSEQLFRRPAHHYTRALIASIPVPVPDRHRELSALHGEIPSPANPPSGCRFRTRCPAATARCAAEQPEMREIDRGHFVACHDPLDQVLNIEAGRRPVSADWRI
>NZ_CP048286.1|WP_162642767.1|4546112_4547006_+|ABC-transporter-permease
MREAASVKTVWRTKAASSAFRRRMPKVSVTRLMVYAASLVVLFLIACALVPQWIAPYSPTDMQADRILLPPGAAHWFGTDYFGRDIFSVVVHGTRESLFIGFASVIVGGLAGTLIGASAGYFGGWVDGVLMRVIDVFMTIPGVLLALAVAAVLGPGLWNLILAVALASIPNYARIMRGQILSVKNRPFILASRSIGASELPIFFKHVLPNSLSPLLVMACIGVGTSILTGSGLSFLGLGVIKEIPDWGALLSQGRGYLTVAWWICTFPGLAITLFVLSVNVIGDELRDALDPRKRRA
>NZ_CP048286.1|WP_162642766.1|4545167_4546097_+|ABC-transporter-permease
MLKIIAVRLLSSVGVVAGSSILVFCILYVLPGDVVMNMIDPSSMSPEAIANLRHQLGVDRPFYEQLLHYFNAMLHGDFGHSLVNSEPVLPKIMAHFPATLELTAAASAIAILVGVVLGVLSAIHRNKPIDIAARIIGLFGISMPTFWSGILMILIFSVTLGWLPAMGSDGWKTLVLPALTLGLLGAGFIVRMVRNSMLEVLGEPFITTLRAKGLLERSVMYRHALRNALIPAVTMMGILVGEMLAGTVVIETVFSRQGIGRIISDAIMSKDLPVVQGVVLFTAIVYVAINALVDISYSYIDPRVRRLQH
>NZ_CP048286.1|WP_162642765.1|4543460_4545155_+|ABC-transporter-substrate-binding-protein
MSKGLGVKMSVLLVIAVMLLSACDSSGAKNNAGSANAAGDKGSAGATNAAGDKNAETKAADGGELTYALATSPDSLDPARSGLAVSVRVFRTIYDSLVAQLPDNTIKPWLATEWTISPDGKSYTFKLRKDVKFQDGTPFNAEAVKYSFDRILDPATKAANASALLKPYQSSEIIDDYTIKLNLETPSVAFLGNLSQAMLGIVSPTAAKQSGDQFGKNPVGTGPFSFVKWEDNTDIQVKRNPDYAWAPELVENKGAAHLDTIDFKIIPEEATRIGSVQSGQVKAIETVPPQNVVSLKSDNKLQVLQVNTAGLPYTLFFNQTAAHAPWNELKARQAVQYAVDIDSIVKSLYLGTYQRAWSPLSPNTFGYDPSLENGIKPDLDKANQLLDELGWTKGSDGIREKDGKKLTLHYVDGSPNREKRNDIAAIIQQQLKKVGIDVQVEITKDVATVVYTNWAYDLYGNSQVNSDPAALNSFYHTTAPDARPSLSHLADPALDKLLEQGAIESDPAKRKEIYVKVQHAIIDNAAILPIYVFPYTVAATKDLSGLKFDSLGYPLFNDASLAQK
>NZ_CP048286.1|WP_162642775.1|4556963_4557833_+|VOC-family-protein
MSNEIAARTSIGTVQLRVSQLQQSLEFYQSVVGLRLLSQDRTSAELGVPDSERPLLRLIEIANAVPRPRRSGAGLYHAALLLPDRRSLGLALRNLIASGIHVGQSDHLVSEALYISDPDNNGIEIYRDRPRHEWQWDANGHVRMAVDPIDWDGLLAEAGDAPWNGLPAGTTVGHIHLHVTELPTTEHFYVDVLGFNLVAHMADSAMFISAGGYHHHIGLNVWAGVGATLTPDTAPGLDYFEIALPDEEAQMAVFARLQAASVPLRTNQGTVIVHDPSGIQIHIVVRGSA
>NZ_CP048286.1|WP_162642776.1|4558043_4559792_+|ABC-transporter-ATP-binding-protein
MVSRRGLLISFIRSKWYIYASGVSFTLAANLFQSYYPKVLGKFTDQLENQGLTQTAVLDASLSLLFIGLAYGILGGIGQFHIMYVGRLFEKYTRKRLFKHFTKLGEQFYSKNGVGKLLSYVMNDVTTVRESISMGVNQTANALMLIVSAIVMMVLSDIPMVLILVCISPLVAIPWIVVKFGPAIRARSHKVQESLGKMTEAAEEQFGGIRVTKKFAVEDIMNDRFGTTVDVIKENQLKLVRVSSFFQALIPFLGALSLIITLAYGGYLTLKNEISLGNFVALTLYVRMMVNPLQAIGNVINTIQRSRASLERVNDLMNKEPEIVEHEHAVDVDWAHSALTVRNLSFSYPGTSKEALKGVSFSLPPGKTLGIIGKTGSGKTTLVKLLLRVFESPAGTIDIGGTPLNELTMDSLRGGIAYVPQDGFLFSTTIRDNIAFFRRSSELPLVEKAAKQAKIHDSIKSFPDGFETKLGERGVTLSGGQRQRTALARGLLMNAPILILDDSVSAVDAVTETAIIDTIRKERRDKTTILIAHRISALKHADEIIVLDEGRIVQRGTHESLLGQKGIYAMLHAIQEEGSSVG
>NZ_CP048286.1|WP_162645345.1|4559796_4561644_+|ABC-transporter-ATP-binding-protein
MEDLRNGSKADGHQPDQPKTNNSSAYKGLYQYAKPHLWTFLGVFGCIIVAIAADLLQPYLVKVAIDDHLTKGDKNANTLFLIAGIYLLLSVGGFVFTYLQNNLLQYAGQSIVASIRKHLFRHITKQSMSYFDRMPSGSLITHVSSDTETINQFFSQVLLSVLRDGLTLVFIIVLMFQLDVRLTLYCLILLPIIALNAIAFRSYMRKTYQMARTNLSRLVAFVAENLAGMHIIQVFHQEKEQQKQFSERNQTYFRSNLREIRTNVLFNRSFDMLGNLSVAFVTWLGGNAVLGHSVPFGVLFAFITYIRQFFQPINTITQQWNTLLSASVSMNRIWSIFDTVPSVQDKPGAAVDISGVKGQIDFNGVKFSYTDDQPVIHHLDLHIQPGEMIGIVGTTGAGKSSLISLLCRFYDVKEGSVTIDGTDVRDIPQEKLHRLIGLVQQEPYLYSGSIVDNVRLFDDAVSREEVMQACRLVGADVLIESLKDGYDTLLSERGSGLSAGERQLISFARIIVFKPKVLILDEATANLDSHSEQLIQRALAVVSEGRTTLVIAHRLSTIMGADRIIVMRQGEIVEEGKHRELLQQGGYYEELYRHSQGRIEASGKPGSGAPAIEAG
>NZ_CP048286.1|WP_162642777.1|4561717_4562389_+|TerC-family-protein
MDLLLLILEILLVNLVLSGDNAVVIALASRNLPEANRKKAVWWGALAAVGLRIVLTVVAVYLLKIPFIQIAGALLLFWVAVSLLKDDGESKDIKGASSLWKAIRTIVVADFIMSLDNVLAIASIAENRIWIMAIGVALSIPIIVWGSQLIMLVLHKFPIFIYLGAGILGYTAGEMLQENDRLASTILKVADWADNAFPIVCGLLVIAIGYLLQKRERSRVQEA
>NZ_CP048286.1|WP_162642778.1|4563776_4566956_+|hypothetical-protein
MSRKFKWLKTLSLMSLLLGSANGLFAAGQASADAGSGTGSAVTFDGTGKFKDTLDTLDNVFMEAGVNATGGLVTGPGDLYYYAGSTSFKGVAIDVNANKWSLNFTASDELKVFEATYDSGTGTFTDGNEVTMVRKLKPDLVTSHEQLLASYVSGKMTAGTKYLHIRLPLASHFIDSGSYANFALDNVTLTSTASSSAANDYISDRLGDLSKLAPGADTSNLSVVSFASSIWDARTFSNLAIVERADATKADQGLTYEVPEGKEVKSVYAEGYFNFVPSKYFEVWTSPDGATYTNATQSSSYHKPITAYNSDWLPTTIDIGSLPAGTRFVQVRMPAFTSGELYGIKHPRMTRVAIGYGDPSGDSTPVETPGQTTIKQGTGPISINGSIDLDDEGRPTGEWQGANAITLTGITDTNGNYHGAKVYFKYDADNLYVGAVIQDPTPMINESTGNGIWAGDNLELFFGTEDLDYSQHPDKKNTMLESDVQVVISGSISNGPQSYVYRNSNFSYPTIPLAGTKAADGLSYTLEAAIPLSELGITNPWDHKSMLLNSVLNDGSSSGRGQWGWTTTGESVKKNRGQWGKADLEAGTAPAQDVSVDVSVDSGTNRITVSGQAASVTGKDITLLVTDPNGAIAYIDQAPSDDEGRYSFTFPITGTNYASGLYTATVGGDGIGRPTNATFSFTPGEPGPIDLGEPRGTLSGPASAAAGSSIQLEAGFLGSDQSLNMMQAVIHYDKDKLAFAVDPENADRLAEGVITSAVSGLSVLDAAIKPDQGQILVLLGSTNPDFAAQGHLFNLNATVKADAAAGETTVSMQQFQLSNETTIINAADSSAVIQLTVADHSALIEAIADAQHTHDTAVAGSEAGQYPASAISGLQSAIDAAQAVADNAAASQEELATAITGLNDAVSAFLNSVNIPQADADKTALGHAIDAAQSTYDAAAEGSKVGQYPQAAKAALAAAIGQANEVFHNASALQAVVDQAVTTLQAAVQTFTGQFISLVPGATHITIQDLSILAKFFGMTSEDPNWSSIEKADMFDEGEITIRSLAAIAQLITNNWLNE
>NZ_CP048286.1|WP_162642779.1|4567147_4570057_+|hypothetical-protein
MKASKRWKACLLAALGALTLQLADVGTFASGTAAAEAAGTTYYVDSVSGNDSNSGTSTGQPWKTLGKISSFGFSGQLHPGDQVLLKSGSVWNASLDIAFSGSAAGQITIGSYGGEVKPIINGGGGSYAVRIENRQYITVQDIEITNFNAAKPNDYKTEFHRRSGVWVISHHEGPMSGIQLKDLDIHDVAGISVSGEDWVTDTDGETVNKNHNAAIMINAWEWEANVPADKHAYFKDLLVENNHIHDVQTIGLNMDGFANDTSQYHQNVVIRGNTIERTGSDGIVVGVAKNPLIENNAVYDVAINSYDFKWIAGIWVWKTDGAIFRHNEVARVHYLNAASTDSSAFDTDISAQGDHVYEYNYSHDNAGGFVMDMGQLQNGTNYYRYNVSRNDQHHRSSGKTVEVHDTGLFYNNVFYNDNGEGFLLSDNPKSTYINNIFYTSQGSQPYPASPKFYNNDFYGATPPSQGVRNLNVDPKFVAPSGGDGMDKVDGFKLNANSPLIGEGRVIAGNGGKDFWGNALYTGSPDIGMFEDPASTKNDTAAPSAPTGLTAQERTDSTLKLAWTAAENGVPLDADIYNASTNEKVASVIMANSATLTGLTADTDYSFYVKARDLSGNVSPASSTLAVRTTSASIIVDDADAAKTGTWTAATGGNANGFVYAAKGSGAKTIQWTPNLTNGGYYGVYYWLPPRASNESRATNAVFTVQFAGGTKSYTVNEYTSATGQWLLLGNHKFEAGTGGSVTLSDNANDKVVADAVRFQYLADFGPESMTSVTVTPGKQQLKTGDSTPLSVIGADAAGKTLDLKTEGVAIAYHSDAPTIASVSAQGVVTAVAAGTAHIQAVVTINGHDIASNAAAIIVGNGLTVSAPVFTNGEGAPITTLQPSGIVKVSTTIVNSTDADQGVTLIVGVYNSNGLLLSTTENANVKSFTNRTLTATIVLPANTNGVSIKAFVWDGKSTLHPLAGKTLFPH
>NZ_CP048286.1|WP_162642780.1|4570241_4571366_+|peptidyl-prolyl-cis-trans-isomerase
MRNAVLKSPARPLAARTPAFFFQKRLQVMLMTAAALLLAVIAAALLLHLRGGDSGPRVTATVNGEPIAREELQQAMALQKAKTAAYFKAQYGADDEAGFWTKAYGGEVPLEKLKKDALAQAVQLKVQQAMAKREGLTDDIAYASFLKRLKAENKRRANAEDDQPGVYGPKQYSEAAYYSLINSDLLGALKNKLEAAMTWSDDQLRAFYDAHAAEQFTERAAIQADTISVPYGDGAAMNATEAETAVKSIAEKLDTGMSATAAAAAFQGEAAVATVKLDADTARAANLETPMLLSKVQRLQAGQHTGIFRENGAYVIAVVTERAEGKTHSFEEVKEGIAAQLADEAYGALVDKAVRTAAIAIDHEVYDGIGPDNQ
>NZ_CP048286.1|WP_162642781.1|4571340_4571541_+|hypothetical-protein
MASAPIINKPLAVASSNPQAAVRKRQSASSNPQAAIRKRQSASSNPLAAPTRTRAVRSLWERAVFF
>NZ_CP048286.1|WP_162642782.1|4571605_4573384_+|HAMP-domain-containing-protein
MNIIVRKKRTLRYKFFIGFIIVTVPLILFLFYNNYYAMNVVREQVSQSNSNLISTQAAKKDIAMGQTVNYLLRQVTNNPSYPNLLTLSSYPEESGDYFFAKQSLLTSFEQDQGAYKEVDTFFVYLDKPKRLITSQRTYWEIERYHEVLDAYMADAKSRKVHEWDILETDNVNYFVRIEQVPGSTAFVGALIKAEKLIDDLNTASSDSGLEQLLVSNAGVPLTATTLTNEDVANIEDSLKKPGSEAYRKFNRSSGLGYLAVSADFEQAPIHLVAIVPENNLLKQLFYFQWAIYLIPVLGLIVILFYSIFLKRTLLKPMQALMSGMRRIMHGDLSVRLKEGSSFEFAFLIETFNGMAGQISRLKIDVYEGMLKKQEAEFKHLQAQINPHFYLNSLNIIYSLSSLRKNDLVEQMTEHLADYFRFITRAHREFITLSEEIDHIANYLEIQKLRFPDKLAFEVDLPERYAGCSLPPLTIQPFIENAVIHGMPEGERLYVISITVKPLQDGSGDCEIVIADNGRGLSPEKLQQLQTGMAEEGEGKGAGGLGIWNVKRRLGMIYGNRADVRFSAGDAGGTVITIRLPIDSDNEGGNNDV
>NZ_CP048286.1|WP_162642783.1|4573376_4574999_+|response-regulator
MYNLLVVDDEKYAVEAVLNCIDWPSAGVTGLFSAYGVESAKEQLLANPIDIIVCDIEMPGSNGLELLEWVNEHKPDTLTIFFTGHANFAYAQQAIQLGSFDYLLKPVKHKQIAEVVSRACEKLRQERDKRHYSERYEKYAQLWETQKPLLWEKFWQDVLGARVIMNDERLGQAIRTYGLPIQPETRVRPILLSVEEFREAFSKRDEEILEYALLKSAEEMFLESRRGAVFRDAGGILFVLLYEDEQTLDDRELTRICRTYMEASSTYFYCRLSCYVGEPAAIGGLTETYHALLEMEQSNVAAPETLLFLRDYGFERSGMRQAQAPSYIDWAEWTVLFESGKKTELMDRLNAAFKELAAQPVTHESLEAVYYLLLHMVYHVSHRKGWPAKEVVGGKLLGDERAATRSLSRLKSWAERLLAAGMDYFSHHEGDHRANIEKVKKYVQTHIRDVNREDIAAHVYLNSAYLSRLFKKETGQSLMDFIIMAKINQAKILLTETNQKISDIGESLGYENFSYFGKVFKKTVGITPQEYRKRYQGIVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048286_15

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048286_15

7024126-7024223

Orphan

Consensus_repeat	Method
CGTGATCATTTGAACGCCGGAAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048286_15

>merge|NZ_CP048286|15|7024126-7024223|CRISPRCasFinder
CGTGATCATTTGAACGCCGGAAATTCGGCTGAAGAGAATCACTTATGAACAGCCAGCCACGGAAACGCCGGAAACGTGATCATTTGAACGCCGGAAAT

>NZ_CP048286|15|14|7024126-7024223|CRISPRCasFinder
CGTGATCATTTGAACGCCGGAAAT	TCGGCTGAAGAGAATCACTTATGAACAGCCAGCCACGGAAACGCCGGAAA
CGTGATCATTTGAACGCCGGAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048286.1\|WP_162644985.1\|7030254_7030737_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NZ_CP048286.1\|WP_162644982.1\|7025267_7026119_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381359
NZ_CP048286.1\|WP_162644977.1\|7016437_7017712_+\|homogentisate-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|226039
NZ_CP048286.1\|WP_162645546.1\|7010179_7010656_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|366353
NZ_CP048286.1\|WP_162644974.1\|7012238_7014248_+\|YjhG/YagF-family-D-xylonate-dehydratase	unknown	unknown	gnl\|CDD\|236189
NZ_CP048286.1\|WP_162644989.1\|7034396_7035155_-\|carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|223672
NZ_CP048286.1\|WP_162644973.1\|7011341_7012151_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP048286.1\|WP_162644988.1\|7033540_7034383_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235813
NZ_CP048286.1\|WP_162644976.1\|7015287_7016400_+\|4-hydroxyphenylpyruvate-dioxygenase	unknown	unknown	gnl\|CDD\|273528
NZ_CP048286.1\|WP_162644978.1\|7019764_7020727_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048286.1\|WP_162644986.1\|7032028_7032397_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379639
NZ_CP048286.1\|WP_162644981.1\|7024565_7024973_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380361
NZ_CP048286.1\|WP_162644979.1\|7020731_7022009_+\|fumarylacetoacetase	unknown	unknown	gnl\|CDD\|215461
NZ_CP048286.1\|WP_162644975.1\|7014284_7015118_+\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580
NZ_CP048286.1\|WP_162645547.1\|7017730_7019713_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341272
NZ_CP048286.1\|WP_162644984.1\|7027016_7028462_-\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP048286.1\|WP_162644980.1\|7022037_7023810_+\|aromatic-amino-acid-hydroxylase	unknown	unknown	gnl\|CDD\|237598
NZ_CP048286.1\|WP_162644990.1\|7035176_7036235_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
NZ_CP048286.1\|WP_162644987.1\|7032478_7033459_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381305
NZ_CP048286.1\|WP_162644983.1\|7026151_7026991_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187632

Protein	Function_ID	Function_description	E-value
NZ_CP048286.1\|WP_162644985.1\|7030254_7030737_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	7.25085e-23
NZ_CP048286.1\|WP_162644982.1\|7025267_7026119_-\|aldo/keto-reductase	gnl\|CDD\|381359	cd19133, AKR_AKR5F1, the AKR5F family of aldo-keto reductase (AKR). Klebsiella sp. 2,5-diketo-D-gluconic acid reductase (2,5-DKG reductase) is a founding member of aldo-keto reductase family 5 member F1 (AKR5F1). It catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG).	1.11695e-177
NZ_CP048286.1\|WP_162644977.1\|7016437_7017712_+\|homogentisate-1,2-dioxygenase	gnl\|CDD\|226039	COG3508, HmgA, Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism].	1.11971e-60
NZ_CP048286.1\|WP_162645546.1\|7010179_7010656_-\|C40-family-peptidase	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	1.2011e-29
NZ_CP048286.1\|WP_162644974.1\|7012238_7014248_+\|YjhG/YagF-family-D-xylonate-dehydratase	gnl\|CDD\|236189	PRK08211, PRK08211, YjhG/YagF family D-xylonate dehydratase.	0
NZ_CP048286.1\|WP_162644989.1\|7034396_7035155_-\|carboxymuconolactone-decarboxylase	gnl\|CDD\|223672	COG0599, COG0599, Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown].	7.40997e-11
NZ_CP048286.1\|WP_162644973.1\|7011341_7012151_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.18496e-64
NZ_CP048286.1\|WP_162644988.1\|7033540_7034383_-\|SDR-family-oxidoreductase	gnl\|CDD\|235813	PRK06482, PRK06482, SDR family oxidoreductase.	2.14193e-125
NZ_CP048286.1\|WP_162644976.1\|7015287_7016400_+\|4-hydroxyphenylpyruvate-dioxygenase	gnl\|CDD\|273528	TIGR01263, 4-hydroxyphenylpyruvate_dioxygenase, 4-hydroxyphenylpyruvate dioxygenase. This protein oxidizes 4-hydroxyphenylpyruvate, a tyrosine and phenylalanine catabolite, to homogentisate. Homogentisate can undergo a further non-enzymatic oxidation and polymerization into brown pigments that protect some bacterial species from light. A similar process occurs spontaneously in blood and is hemolytic (see . In some bacterial species, this enzyme has been studied as a hemolysin. [Energy metabolism, Amino acids and amines].	1.81672e-174
NZ_CP048286.1\|WP_162644986.1\|7032028_7032397_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379639	pfam14534, DUF4440, Domain of unknown function (DUF4440).	2.36196e-15
NZ_CP048286.1\|WP_162644981.1\|7024565_7024973_-\|cupin-domain-containing-protein	gnl\|CDD\|380361	cd02233, cupin_HNL-like, Granulicella tundricola hydroxynitrile lyase (GtHNL) and related proteins, cupin domain. This family includes archaeal, eukaryotic, and bacterial proteins homologous to hydroxynitrile lyase from Granulicella tundricola (GtHNL), a novel class of HNLs that does not show any sequence or structural similarity to any other HNL and does not contain conserved motifs typical of HNLs. HNLs comprise a diverse group of enzymes that vary in terms of their substrate specificity, enantioselectivity and the need for a co-factor. In plants, they catalyze the reversible cleavage of cyanohydrins, yielding HCN and aldehydes or ketones. Also included in this family is TM1010 from Thermotoga maritima, a protein of unknown function. Some but not all members of this family have N- or C-terminal carboxymuconolactone decarboxylase domains in addition to the cupin domain. Members of this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.68622e-47
NZ_CP048286.1\|WP_162644979.1\|7020731_7022009_+\|fumarylacetoacetase	gnl\|CDD\|215461	PLN02856, PLN02856, fumarylacetoacetase.	0
NZ_CP048286.1\|WP_162644975.1\|7014284_7015118_+\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	2.56318e-35
NZ_CP048286.1\|WP_162645547.1\|7017730_7019713_+\|AMP-binding-protein	gnl\|CDD\|341272	cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase. This uncharacterized acyl-CoA synthetase family (EC 6.2.1.16, or acetoacetate#CoA ligase or acetoacetate:CoA ligase (AMP-forming)) is highly homologous to acetoacetyl-CoA synthetase. However, the proteins in this family exist in only bacteria and archaea. AACS is a cytosolic ligase that specifically activates acetoacetate to its coenzyme A ester by a two-step reaction. Acetoacetate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is the first step of the mevalonate pathway of isoprenoid biosynthesis via isopentenyl diphosphate. Isoprenoids are a large class of compounds found in all living organisms.	0
NZ_CP048286.1\|WP_162644984.1\|7027016_7028462_-\|multidrug-efflux-MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.54135e-75
NZ_CP048286.1\|WP_162644980.1\|7022037_7023810_+\|aromatic-amino-acid-hydroxylase	gnl\|CDD\|237598	PRK14056, PRK14056, aromatic amino acid hydroxylase.	0
NZ_CP048286.1\|WP_162644990.1\|7035176_7036235_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP048286.1\|WP_162644987.1\|7032478_7033459_-\|aldo/keto-reductase	gnl\|CDD\|381305	cd19079, AKR_EcYajO-like, Escherichia coli YajO and similar proteins. Escherichia coli YajO is the prototype of this family. It is an uncharacterized aldo/keto reductase family oxidoreductase.	0
NZ_CP048286.1\|WP_162644983.1\|7026151_7026991_-\|SDR-family-oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.6128e-102

>NZ_CP048286.1|WP_162644980.1|7022037_7023810_+|aromatic-amino-acid-hydroxylase
MRKLPPHLKPYVSEQHYERYTPIDHAVWRYVMRQNRHALQDRAHDAYRNGLAQSGIGTERIPRVSEMNACLAQIGWGAVIVNGLIPGPVFYELLANGVLPIAAEIRKLTNLEYTPAPDIIHEAAGHAPILFDPEYRAYVRQIGAIGTRAFSVKEKQDAFDALRRLTIVMEDPASTAEEKAAAQQAVEEKQKATSGMTEAEMVSRLFWTTAEYGLIGDLQDPKIYGAGLLSSVGESKHCYTEAVAKIPYSVESCTEHPKVVTQMQTRLFVCGSFEELKAGAEALANTMAYRIGGTESLERAQRSKMIATFTYNSGLSVTGIVHALIKDDQGEAVYVNTIGETALTVEKQPLGGHGKDVHAKGFGSPIGLLQGKLALDACDDQALAQLGVIPGNHADLRFESGIHVTGRLKRIIRNEQQVVLLSFEDCTVLWDGRELYKKEWGAYDMAVGSRIVAAYPGEADPASVSVTEEEPDPVQESEAEAIMELGLELLMEAPVPLSELERLYQHVAVIREKNMNNITEESIRELDGIYRVLCGSYPNDWLLRLELLELAGTIPIPDLVQMSIALKDELHALSQVDSLANVINNGLAIL
>NZ_CP048286.1|WP_162644979.1|7020731_7022009_+|fumarylacetoacetase
MSRSFIEVEPDSHFPIQNLPYGVFRPLQGGDPRIGVAIGRYVLDLAALDEAGCFGHTAVHGKGVFAQPSLNAFMAMGRPVWQEVRSTVARLLDNDEPLLRDNDSLRMRVLRLQSEVELLLPAEIGDYTDFYASEAHATNVGTLFRGKDNALMPNWRHLPVGYHGRASSVVVSGTEVRRPQGQLKPPDAAAPVFGPSRQLDFELEMGWLIGAGNEQGRPIPIAEAEDHLFGLVLVNDWSARDIQAWEYQPLGPFLGKSFATSISPWVVPLEALAPFRVPALKQDPEPLPYLRHDGKAGSSSYDIHLEVSLQSEAMVSAERISASNYRHLYWTIAQQVAHHTVGGCNLRPGDLLASGTISGEKQEARGCMLELTWRGTEPIRLNGGEERVWLADGDRLTLSGWCQGDGYRVGFGVVTGLVLPALRMT
>NZ_CP048286.1|WP_162644978.1|7019764_7020727_+|hypothetical-protein
MTASMRSFMDKLIDYAGLFPPAQLPMEKAIQQYHDYSHDPDSWMLGRFVIPDSRLVELAPYMALFAVHHPLRLSVIGGRTRTAAECVMQFMKSMERVETFRKLNPEAVVIDMLELPLPPVPIQAQLLEELGNGASKLGLRTYCELTYALDAGWEANMLEALQAIADHNAVAVHEARIDVKVRSGGLAADAFPTPYQIATVLEACRDRSIALKFTAGLHHPIRMFRPEVNAKMHGFLNVFAAGLLASALSLDRHRITEIVEDEQAEHFHFSDEGLCWQNLFISSADISAYRHSACSSYGSCSFDEPREELRALQLLEQRRS
>NZ_CP048286.1|WP_162645547.1|7017730_7019713_+|AMP-binding-protein
MGHKPVWYPNKTEMEQTRLFRFMHKHGFDDYDAFYRQSIGDISWFWDAVVQDMDIAWERKYEQVVTMTSGIRWPSWFVGGRLNAADNAVDKWLQDAAVSARQAIIWEGEDGATSSFTYRELAEEVNGAAHGLRRLGIQQGDRVALYMPMIPETVAALLAIAKLGAICIPVYSGYGADAAAKRIAGAGCKLILTADGYYRRGKIVRMKEEADKAADASASVSKVVVVRRLGTPVPWRQERDVEWTSLTEGEGSEHSKAAPFDAVPMNSGDPLMILYTSGTTGAPKGIVHTHSGFPIKAAFDAGYAMDFRPGNVMLWITDMGWMMGPFLVYGTLFNAGTMVLYEGVPDFPGPERLFGLVQRHAVTHLGISPTLIRGIMKHGDACYRDCDISSLRVIGSTGEPWNLEPWLWLFNEVGKGRVPIVNYSGGTEISGGILGNVLLKPIAPVGFNSPIPGMCADVWSQEGKPVIGEVGELVLKRPWLGMAGGFWQEPERYEHTYWSRWPDIWVHGDWVHRDEDGYWTITGRSDDTLNVAGKRLGPAELESLLVEHPQVAEAAVIGVPDETKGEAAVCFVVVNQVLSEGRQSMELTAALFNWIAERLGKAFKPKSIHIVEALPRTRNAKVMRRVIRSAYLGSDPGDLSALENPEAVIAIRGLADGRNE
>NZ_CP048286.1|WP_162644977.1|7016437_7017712_+|homogentisate-1,2-dioxygenase
MPFYHRMGTIPPKRHTQFRRPDGGLFREQVMGTKGFSGIQSILYHRHAPAEITKARLLSACKPAYEPQGALRHRHIRTNSLQRQGDAVAGRQYVLGNEDLIIGVANVSEAMDYYYRNGDGDELLFVHEGTGKVETMYGALRYRPGDYIVLPIGTIYRIIPDTDTESGAEAGVESGVEAGAEGTVTSVKNVRNKFLVVETNSWITAPKRYRNEHGQLLENSPYCERDIRVPEVLETFAEPGEVEVRIKKDGYLHSHVLSHHPLDVVGWDGFLYPWILNIQDFEPITGRIHMPPPIHQTFEGNQFVICSFCPRMYDYHPLAIPAPYYHSNVDSDEVLYYVKGNFGSRKGIEEGSITIHPAGIPHGPHPGKAEESIGKKETSELAVMIDTFRPLHVVEGIQGAEDPNYAYSWVTQIRSPDASSARDQ
>NZ_CP048286.1|WP_162644976.1|7015287_7016400_+|4-hydroxyphenylpyruvate-dioxygenase
MKKQRKIDQRASDFFPVRGIDHIELYVGNAKQAAHYLSKGFGFQVTAYAGLETGESSKVSYVLEQNQARFAVTGSLSPDHPVAEFVKKHGDGVKDIAMRIDDVEKAYHEAVSRGGIPVMAPHEVTDADGTVTMAVIGTYGDTVHTLIDRSKYKGLFLPKYVHCELNIPHQPVGLVGFDHIVGNVEQMEEWVQYYQNVMGFKQMIHFDDKDISTEYSALMSKVMYSGGRIKFPINEPANGKRKSQIQEFLDFYHGAGVQHVAILTNDIVSTITALQQNGIEFLNSPDSYYDMLTERVGAIDEDIAKLRELNILVDRDDEGYLLQIFSKPIVDRPTLFMEIIQRKGAVGFGEGNFKALFESIEREQARRGNL
>NZ_CP048286.1|WP_162644975.1|7014284_7015118_+|phytanoyl-CoA-dioxygenase-family-protein
MTSNPLQHAEDINSRMYQFDRIHAPLPSAGAFTDEHVKQYREQGFIAIEQLLTPDEVHASIAAIMRIMMDPDTKAKIQFTKPRHELHSDEERELAIRKVYEYVDADPVLHAAAYHPVIGAIVERLLGEQPKLVQDQALLKPPFGGGEKPWHQDMAYGNLSYEQAVVGVWIALDEAGLDNGCMHVIPQSHMDGATPHYAVRDWQICDANVPVNKDVAIPLKPGGALFFHGLLYHGTPFNCSDQRRRALQFHYAPAAAAKMSPGEYKRMFTNALTSAEC
>NZ_CP048286.1|WP_162644974.1|7012238_7014248_+|YjhG/YagF-family-D-xylonate-dehydratase
MNEAIRFIMGPEDPEHYDIYTHAAGPEGKLPLTADMLLNLPSGDLFGLSQNVGMGWKPERLLGKQILILSTQGGVRGEDGSPIALGYHTGHWEVGLLVKEAALAVSGLGGVPFAAYVSDPCDGRSQGTTGMFDSLPYRNDAAIVFRRLIRSLPTRSGVIGVGTCDKGLPAMMIALAAMHDLPAIIVPGGVTLPPTVGEDAGKIQTIGARFSQGQITVDEAADLGCRVCATPGGGCQFLGTAASAQVVAEALGMALPHSALAPSGQPIWLDIAKQSARAVQWMHANGVAMRDILTDAAVENAMVVHAAFGGSTNLLLHIPAIAHAAGCRIPDVADWTRVNKAVPRLVSVLPNGPDYHPTIRVFMAGGVPEVMLHLRKLGLLNLQVKTVAGVSLGEQLDWWETSERRLEIRKRLLTVDGIDPDEVIMSPERAAVRGLTSTVAFPTGNLAPEGSVIKATAIDPDVVGEDGVYRHIGQAKVFTSEKAAVKAIKDGRIQEGDILVLMGRGPSGTGMEETYQLTSALKHLPFGKHVTLLTDARFSGVSTGACIGHIGPEALAGGPIGKLRNGDWIDVRIDRNTLDGSLHFVGQGDALFSPEAGASILAARPLHPDLAADPALPDDTKLWAALQAASGGTWRGSIYDVDRIVETLQAGMEALANARARTQSPSAND
>NZ_CP048286.1|WP_162644973.1|7011341_7012151_+|SDR-family-oxidoreductase
MDSKTGGIALSEAGLKGKNALVTGSSRGLGKQYALDLARAGANVIIHDIRNSSAAEFNEADSGEAVAEQMRALGVKSAFIAADLADPVQVQRLIESAINELGSLDILVNNAGGDIGANTPRPDPNDALDISVEDIRSVVERNLLSTMYACKFAGLHMRERRSGKIVNVGSVAGHVPVTGGLIYAAAKTGVSSYTRSLAEQLRPFDVNVNCISPAPTYTGRFLATRTVGSEEGRSRLQRIAQPEDMSGIVMFLCGPASDALTGETIVCWK
>NZ_CP048286.1|WP_162645546.1|7010179_7010656_-|C40-family-peptidase
MVDYNGRTGYVSRSYVTVHAGGTSSSKPPASTGSVSGSKIVSTAKSFQGRVKYVFGARDQSRLIFDCSSFTQYIFQLNGKSIPWGSKAQGSSGSAISKSSLQAGDLVFFSVNTPGQINHVGIYMGNGQFIHNLPNEGVIISDFNSSYWTSHYIKARRV
>NZ_CP048286.1|WP_162644981.1|7024565_7024973_-|cupin-domain-containing-protein
MAKHEEVKNGVIFPVGEKNEAFAQYFVGQSYLKTLVADQNVNVGVGNVTFEPGCRNNWHIHRNGFQLLLVTGGEGWYQEEGKPAQFLKAGDVVVTHDGVKHWHGASKDSWFEHIAITAGRPEWLEPVSDEEYNKL
>NZ_CP048286.1|WP_162644982.1|7025267_7026119_-|aldo/keto-reductase
MQKVTLNNGVEMPVLGFGVFQIPDAEECEQCAVDAITAGYRLIDTAASYQNEVAVGNAVKRSGVPRDELFITTKLWIQDSGYEQTKRALEKSLAKLQLDYLDLYLIHQPIGDVYGSWRAMEEMYREGKIRAIGVSNFTADRLVDLIIHNDVTPAVNQVEVHPFYQQHEYAKFMREHHVQMESWGPLVQGKHNVFQNDVLQSIAERHQKTVAQVILRWMTQRGVVAIPKSVRKERIIENISIFDFELTQEEFEKIATLDTNQSLYPQANRPETIQWLADRKLDL
>NZ_CP048286.1|WP_162644983.1|7026151_7026991_-|SDR-family-oxidoreductase
MVNTSEQVWMITGANKGIGAAIAKEALAQGFKVVAAARNTEGMEAALGTSPNLIITKLDITNEEQVHASVQAAQEKFGCIDVLVNNAGYGQLGYFEEITEEQLRQQMETNVFGTMRLTRTVLPVMRKQGSGTVMVFSSMMGLMSIPGGAVYSASKFALEGWAEGLKAELQHFGIKVMLVEPGPFRTDFTNKQTSAKFSELQIDDYSAQRDSMHDFYFAGEQFGDPDKLAKALMRVADDTNPPFRWLAGKGMVDAVIQHYQQRLTEYESWREVSDNTNFD
>NZ_CP048286.1|WP_162644984.1|7027016_7028462_-|multidrug-efflux-MFS-transporter
MEKTKPYNTRAIMFSLLMCSFIGMFSETSLNIALSNLMHVFQISAATAQWLTTVYLLVLGILMPMSGLLLQRFTTKQLFTASLISLIVGTFAAAISVNFEMLLAARVLQAFGMGLLLPLMFHTILLIYPTERRGAAMGLVGLVIMCAPTTGPTIAGILIQYLSWHYIFWLSLPFLIIGLFVGLKNLENITEVSKPRFDLASIIMSTIGFGGIVYGFSKAGEDTGGWTHPAVIASVAVGLVALVLFIVRQIRMRDPLLNMGVFKHPMYVMSVVMVVSSMLMAMSLAIILPLFLQNGKGLTTLTTGLMLLPGSLLNGILSNRMGQLFDKFGPRRLVIPGLVIAAVTLWFFTNISLASTVAFIITLHMVMMIGLAMIWVPAQTNGLNQLPPHLYAHGTAVMNTVQQVTGAIATAVSISILSSGTERYLRHSTAPSQPAEIANAMATGSEHVFWFTLIVAVVGLVVSLFIRRVVINHAVEAKPTH
>NZ_CP048286.1|WP_162644985.1|7030254_7030737_-|nuclear-transport-factor-2-family-protein
MTHTNEQESQSRLYDRIVELEHVRALRELVDTFSILADQKDTQKQTTLFTADATVDSIVDGNVVSSLRGTDEIGTAFESFLKNFDIVYHFNGQHNVSISGNTAKGTLYCLVDLIATVDGKKINNKSGVHYEDEYVFEDGHWLIAKRTSTFAWQDRQEINT
>NZ_CP048286.1|WP_162644986.1|7032028_7032397_-|nuclear-transport-factor-2-family-protein
MNEDKQKILAVFQQIDAAMINKDTESLARILDDDYVLVHMTGYHQRKAEWLNQIENEQMKYFKTMPQTTTITIDGNTAVLLCDTKIDARINGFRSTWPMKIEMHFEKRGYDWIPIHSVASSN
>NZ_CP048286.1|WP_162644987.1|7032478_7033459_-|aldo/keto-reductase
MDYVKLGNTGMDVSRICLGCMSFGEVQPGGHQWVLNEESSRTIIKRALDLGINFFDTANIYAGGTSEEIVGRALKEYANRDEIVLATKVWGRMHQGPNSAGLSRKAIMSEIDKSLKRLGTDYVDLYIIHRWDYMTPIEETMEAMHDVVKSGKARYIGASAMYAWQFQKALHVAEKNGWTRFVSMQNHLNLIYREEEREMMPLCKDQKIAVTPYSPLASGRLIRDWSETTPRFETDVVQKAKYDATADKDRLIVERVAEVADKRSVPRSHIALAWVLQKEQVAAPIVGVTKMKQLEESVGALSVKLTSEEISFLEEPYVPHPIVGAQ
>NZ_CP048286.1|WP_162644988.1|7033540_7034383_-|SDR-family-oxidoreductase
MNNLTWLITGVSSGFGYELTKQLLEKGDNVIGTVRDKSKVKDLIEKHPETFTCEVLDVTDVPAIHQLVDQSFEKFGRIDVIVSNAGYGLFGAAEELTDTQVDHIIATNLTGSIQLIRSALPHLRGQGGGRIIQLSSYGGQVAFPGNSMYHATKFGIEGFCESVAQEVAPFNIGVTIVEPGGARTEFRYGSARVANLMPEYEGNPAHGFLSMLDASNGLAPGDPARMAARIIESVDKEPAPLRMVLGSQALANTISTLKARIADYEKQTELAASTDFPAGE
>NZ_CP048286.1|WP_162644989.1|7034396_7035155_-|carboxymuconolactone-decarboxylase
MKVTEAAQRYHDKMFPGYESKFLETDLEFIERFDNFAFDEVVNQDDLDDRTRMMAILSVLIGCQGIDEFSAMLPAALNFGVTPVEAKEIVYQSVPYLGIGRVFPYLHAVNEILVSQGIELPLPSQATTTTENRLEAGILAQVDIFGESMRDFWQSGPEESRHINRWLADNCFGDYYTRKGLDYKQREMITFCFLLAQGGCEPQLTSHAAANMRLGNDKLFLIKVISQCLPFIGYPRSLNALRCVNEAAAKSE
>NZ_CP048286.1|WP_162644990.1|7035176_7036235_-|NAD(P)-dependent-alcohol-dehydrogenase
MCELHQSVTVRALSVPGAKAPFERTTIERRELRPDDVLIDIQYCGICHSDIHNAHNDFGRGVFPMVPGHEIAGVVAAVGREVTKFAVGDRVGVGCFVDSCGECEFCRSGEEQFCRKGVVVVFNSMDYDGELTYGGYSQKIVVKDRFVVRIPDGLAMDVASPLLCAGITTYSPLKHWNAGPGKKVAVLGMGGLGHMAVQFAHKMGAEVTVLSHSPNKKDEAFGFGASQYYVTTDPVTFTEQAGQYDLILNTVSANINVDALLSILKVDGALVHLGLPNKPEQYNVFSLFAGRRIITASNVGGIRETQEMLDFSAENGIAPMIEVIRADQVDEAYERVLNSDVRYRFVIDMATL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP048286_7	7.1\|3012859\|18\|NZ_CP048286\|CRT	3012859-3012876	18	NZ_CP048286.1	3012761-3012778	0	1.0
NZ_CP048286_7	7.1\|3012859\|18\|NZ_CP048286\|CRT	3012859-3012876	18	NZ_CP048286.1	3012810-3012827	0	1.0
NZ_CP048286_7	7.2\|3012910\|18\|NZ_CP048286\|CRT	3012910-3012927	18	NZ_CP048286.1	3012761-3012778	0	1.0
NZ_CP048286_7	7.2\|3012910\|18\|NZ_CP048286\|CRT	3012910-3012927	18	NZ_CP048286.1	3012810-3012827	0	1.0
NZ_CP048286_7	7.4\|3013022\|18\|NZ_CP048286\|CRT	3013022-3013039	18	NZ_CP048286.1	3013174-3013191	0	1.0
NZ_CP048286_7	7.5\|3013073\|18\|NZ_CP048286\|CRT	3013073-3013090	18	NZ_CP048286.1	3012761-3012778	0	1.0
NZ_CP048286_7	7.5\|3013073\|18\|NZ_CP048286\|CRT	3013073-3013090	18	NZ_CP048286.1	3012810-3012827	0	1.0
NZ_CP048286_7	7.3\|3012961\|28\|NZ_CP048286\|CRT	3012961-3012988	28	NZ_CP048286.1	3012710-3012737	1	0.964
NZ_CP048286_7	7.3\|3012961\|28\|NZ_CP048286\|CRT	3012961-3012988	28	NZ_CP048286.1	3013174-3013201	1	0.964

1. spacer 7.1|3012859|18|NZ_CP048286|CRT matches to position: 3012761-3012778, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

2. spacer 7.1|3012859|18|NZ_CP048286|CRT matches to position: 3012810-3012827, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

3. spacer 7.2|3012910|18|NZ_CP048286|CRT matches to position: 3012761-3012778, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

4. spacer 7.2|3012910|18|NZ_CP048286|CRT matches to position: 3012810-3012827, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

5. spacer 7.4|3013022|18|NZ_CP048286|CRT matches to position: 3013174-3013191, mismatch: 0, identity: 1.0

gattccccgcttttcctc	CRISPR spacer
gattccccgcttttcctc	Protospacer
******************

6. spacer 7.5|3013073|18|NZ_CP048286|CRT matches to position: 3012761-3012778, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

7. spacer 7.5|3013073|18|NZ_CP048286|CRT matches to position: 3012810-3012827, mismatch: 0, identity: 1.0

aattcaccgcttttcctc	CRISPR spacer
aattcaccgcttttcctc	Protospacer
******************

8. spacer 7.3|3012961|28|NZ_CP048286|CRT matches to position: 3012710-3012737, mismatch: 1, identity: 0.964

gattcaccgcttttcctccaatgtactg	CRISPR spacer
gattcaccgctttccctccaatgtactg	Protospacer
*************.**************

9. spacer 7.3|3012961|28|NZ_CP048286|CRT matches to position: 3013174-3013201, mismatch: 1, identity: 0.964

gattcaccgcttttcctccaatgtactg	CRISPR spacer
gattccccgcttttcctccaatgtactg	Protospacer
***** **********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP025922	Escherichia coli strain 103605 plasmid p103605_83, complete sequence	32090-32116	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP025912	Escherichia coli strain 204446 plasmid p204446_92, complete sequence	53563-53589	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP023348	Escherichia coli strain ETEC-2265 plasmid unnamed2, complete sequence	20518-20544	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP024224	Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed1	15326-15352	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_KT754161	Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence	33570-33596	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	CP042948	Escherichia coli strain 90-9133 plasmid p90-9133_1, complete sequence	50648-50674	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP024244	Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence	50018-50044	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	MH450052	Escherichia coli plasmid pHN32wt, complete sequence	733-759	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	MH450053	Escherichia coli plasmid pHN32_1, complete sequence	733-759	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP038299	Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence	57392-57418	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NC_022333	Escherichia coli plasmid pCss165Kan DNA, complete genome, strain: 4266 delta cssB::Km	17969-17995	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP024977	Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence	48253-48279	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP050381	Klebsiella pneumoniae strain 51015 plasmid p51015_OXA_244, complete sequence	61551-61577	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	CP025909	Escherichia coli strain 204576 plasmid p204576_83, complete sequence	1437-1463	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	CP025898	Escherichia coli strain 500465 plasmid p500465_79, complete sequence	63666-63692	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP030780	Escherichia albertii strain 05-3106 plasmid unnamed2, complete sequence	32669-32695	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP024250	Escherichia coli O182:H21 strain D181 plasmid unnamed2, complete sequence	56322-56348	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP027106	Escherichia coli strain RM14721 plasmid pRM14721, complete sequence	82922-82948	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP020338	Shigella flexneri 4c strain 1602 plasmid unnamed2, complete sequence	82160-82186	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_LT985275	Escherichia coli strain R71 plasmid RCS70_p, complete sequence	43230-43256	4	0.852
NZ_CP048286_1	1.1\|1674630\|27\|NZ_CP048286\|CRISPRCasFinder	1674630-1674656	27	NZ_CP025918	Escherichia coli strain 120899 plasmid p120899_76, complete sequence	58104-58130	4	0.852
NZ_CP048286_10	10.1\|3859075\|27\|NZ_CP048286\|CRISPRCasFinder	3859075-3859101	27	MT354569	Pseudomonas phage phiK7B1, complete genome	12773-12799	5	0.815
NZ_CP048286_14	14.1\|4555224\|27\|NZ_CP048286\|CRISPRCasFinder	4555224-4555250	27	NZ_CP017300	Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence	154794-154820	5	0.815
NZ_CP048286_5	5.1\|2424601\|59\|NZ_CP048286\|CRISPRCasFinder	2424601-2424659	59	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	2548092-2548150	6	0.898
NZ_CP048286_8	8.1\|3053605\|27\|NZ_CP048286\|CRISPRCasFinder	3053605-3053631	27	NC_022043	Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence	55971-55997	6	0.778
NZ_CP048286_12	12.1\|4388210\|28\|NZ_CP048286\|CRISPRCasFinder	4388210-4388237	28	NZ_CP012664	Defluviimonas alba strain cai42 plasmid pcai42C, complete sequence	51213-51240	6	0.786
NZ_CP048286_12	12.1\|4388210\|28\|NZ_CP048286\|CRISPRCasFinder	4388210-4388237	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	2507-2534	7	0.75
NZ_CP048286_12	12.1\|4388210\|28\|NZ_CP048286\|CRISPRCasFinder	4388210-4388237	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	713467-713494	7	0.75
NZ_CP048286_12	12.1\|4388210\|28\|NZ_CP048286\|CRISPRCasFinder	4388210-4388237	28	NZ_CP054617	Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence	400445-400472	7	0.75
NZ_CP048286_13	13.1\|4537006\|60\|NZ_CP048286\|CRISPRCasFinder	4537006-4537065	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	2548092-2548151	9	0.85
NZ_CP048286_5	5.1\|2424601\|59\|NZ_CP048286\|CRISPRCasFinder	2424601-2424659	59	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	900255-900313	11	0.814
NZ_CP048286_5	5.1\|2424601\|59\|NZ_CP048286\|CRISPRCasFinder	2424601-2424659	59	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1553264-1553322	11	0.814
NZ_CP048286_13	13.1\|4537006\|60\|NZ_CP048286\|CRISPRCasFinder	4537006-4537065	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	900254-900313	11	0.817
NZ_CP048286_13	13.1\|4537006\|60\|NZ_CP048286\|CRISPRCasFinder	4537006-4537065	60	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1553263-1553322	11	0.817

1. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP025922 (Escherichia coli strain 103605 plasmid p103605_83, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

2. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP025912 (Escherichia coli strain 204446 plasmid p204446_92, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

3. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP023348 (Escherichia coli strain ETEC-2265 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

4. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP024224 (Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed1) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

5. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_KT754161 (Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

6. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to CP042948 (Escherichia coli strain 90-9133 plasmid p90-9133_1, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

7. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP024244 (Escherichia coli O128:H27 strain 90-9281 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

8. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to MH450052 (Escherichia coli plasmid pHN32wt, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

9. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to MH450053 (Escherichia coli plasmid pHN32_1, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

10. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP038299 (Escherichia coli O157:H7 strain TB182A plasmid pTB182A-5, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

11. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NC_022333 (Escherichia coli plasmid pCss165Kan DNA, complete genome, strain: 4266 delta cssB::Km) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

12. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP024977 (Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

13. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP050381 (Klebsiella pneumoniae strain 51015 plasmid p51015_OXA_244, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

14. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to CP025909 (Escherichia coli strain 204576 plasmid p204576_83, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

15. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to CP025898 (Escherichia coli strain 500465 plasmid p500465_79, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

16. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP030780 (Escherichia albertii strain 05-3106 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

17. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP024250 (Escherichia coli O182:H21 strain D181 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

18. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP027106 (Escherichia coli strain RM14721 plasmid pRM14721, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

19. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP020338 (Shigella flexneri 4c strain 1602 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

20. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_LT985275 (Escherichia coli strain R71 plasmid RCS70_p, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

21. spacer 1.1|1674630|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP025918 (Escherichia coli strain 120899 plasmid p120899_76, complete sequence) position: , mismatch: 4, identity: 0.852

gaaccgccattcttttggcggcggtac	CRISPR spacer
gaaccgccattctgatggcggcgatgc	Protospacer
*************  ********.*.*

22. spacer 10.1|3859075|27|NZ_CP048286|CRISPRCasFinder matches to MT354569 (Pseudomonas phage phiK7B1, complete genome) position: , mismatch: 5, identity: 0.815

agtaacgtgtgaggtagcgggttgccg	CRISPR spacer
accaacgtgtaaggtggcgggttgcct	Protospacer
* .*******.****.**********

23. spacer 14.1|4555224|27|NZ_CP048286|CRISPRCasFinder matches to NZ_CP017300 (Rhodococcus sp. YL-1 plasmid pYLC1, complete sequence) position: , mismatch: 5, identity: 0.815

ccgtgc-acgacatcgccggaaacccga	CRISPR spacer
-tacgcgacgacatcgccgaaaacccga	Protospacer
 ...** ************.********

24. spacer 5.1|2424601|59|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.898

atgactc-aaagaaaaaatggtgccggcgataggagtcgaacccacgacctactgattac	CRISPR spacer
-taaccctcgaggaaaaatggtgccggcgataggagtcgaacccacgacctactgattac	Protospacer
 *.**.*  .**.***********************************************

25. spacer 8.1|3053605|27|NZ_CP048286|CRISPRCasFinder matches to NC_022043 (Paracoccus aminophilus JCM 7686 plasmid pAMI5, complete sequence) position: , mismatch: 6, identity: 0.778

tcggcctcgctcgctgctttgtacgag-	CRISPR spacer
gaggcctcgctcgctgctttg-gcaatt	Protospacer
  ******************* .*.*

26. spacer 12.1|4388210|28|NZ_CP048286|CRISPRCasFinder matches to NZ_CP012664 (Defluviimonas alba strain cai42 plasmid pcai42C, complete sequence) position: , mismatch: 6, identity: 0.786

agcgtgcgaggcagcttgtcgccagtgt	CRISPR spacer
gccacgcgagccagcttgtcgccggtgt	Protospacer
. *..***** ************.****

27. spacer 12.1|4388210|28|NZ_CP048286|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.75

agcgtgcgaggcagcttgtcgccagtgt	CRISPR spacer
agcgtgcgaagcagcgtgtcgcctcccc	Protospacer
*********.***** *******  . .

28. spacer 12.1|4388210|28|NZ_CP048286|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.75

agcgtgcgaggcagcttgtcgccagtgt	CRISPR spacer
agcgtgcgaagcagcgtgtcgcctcccc	Protospacer
*********.***** *******  . .

29. spacer 12.1|4388210|28|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054617 (Azospirillum oryzae strain KACC 14407 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.75

agcgtgcgaggcagcttgtcgccagtgt	CRISPR spacer
agcgtgcgcggcagcttgtcgaccacca	Protospacer
******** ************ * ..

30. spacer 13.1|4537006|60|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.85

gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatttttttgttcgagtcat	CRISPR spacer
gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatttttcctcgagggttaa	Protospacer
***********************************************.. .  *.**.*

31. spacer 5.1|2424601|59|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.814

atgactcaaagaaaaaatggtgccggcgataggagtcgaacccacgacctactgattac	CRISPR spacer
taatcctccatgaaacatggtgccggcgataggagtcgaacccacgacctactgattac	Protospacer
  . *..  * .*** *******************************************

32. spacer 5.1|2424601|59|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.814

atgactcaaagaaaaaatggtgccggcgataggagtcgaacccacgacctactgattac	CRISPR spacer
taatcctccatgaaacatggtgccggcgataggagtcgaacccacgacctactgattac	Protospacer
  . *..  * .*** *******************************************

33. spacer 13.1|4537006|60|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.817

gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatttttttgttcgagtcat	CRISPR spacer
gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatgtttcatggaggattag	Protospacer
******************************************* ***.     *..*.*

34. spacer 13.1|4537006|60|NZ_CP048286|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 11, identity: 0.817

gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatttttttgttcgagtcat	CRISPR spacer
gtaatcagtaggtcgtgggttcgactcctatcgccggcaccatgtttcatggaggattag	Protospacer
******************************************* ***.     *..*.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1044835 : 1053617

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162638957.1\|1044835_1045936_-	D-alanyl-D-alanine carboxypeptidase	A0A1P8VVG5	Erythrobacter_phage	1.0e-08	34.0
WP_162638958.1\|1046082_1046538_-	sporulation protein YtfJ	NA	NA	NA	NA
WP_162638959.1\|1046619_1047321_-	DUF2953 domain-containing protein	NA	NA	NA	NA
WP_162638960.1\|1047396_1048152_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	7.4e-14	30.8
WP_162638961.1\|1048117_1048900_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.8e-08	36.7
WP_162638962.1\|1048954_1049425_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.5e-41	55.6
WP_162645079.1\|1049466_1050699_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.0e-118	54.1
WP_162638963.1\|1050782_1051463_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.1e-37	42.6
WP_162645080.1\|1051545_1052643_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.0e-57	36.3
WP_162638964.1\|1053185_1053617_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.8e-20	46.1

DBSCAN-SWA_2

2664908 : 2675463

Synechococcus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162640290.1\|2664908_2666090_-	phosphoribosylaminoimidazolecarboxamide formyltransferase	S4VT61	Pandoravirus	3.3e-16	25.1
WP_162640291.1\|2666136_2666763_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.7e-27	35.5
WP_162640292.1\|2666762_2667806_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-70	44.1
WP_162640293.1\|2668080_2669559_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.9e-54	32.7
WP_162640294.1\|2669543_2671787_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.6e-159	42.5
WP_162640295.1\|2671764_2672460_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_162640296.1\|2672463_2672706_-	phosphoribosylformylglycinamidine synthase subunit PurS	A0A0E3FJ99	Synechococcus_phage	8.1e-07	36.4
WP_162640297.1\|2673092_2673983_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	9.9e-42	34.5
WP_162640298.1\|2674167_2675463_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	1.1e-20	27.0

DBSCAN-SWA_3

2734920 : 2742743

Escherichia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162640347.1\|2734920_2735937_-	dTDP-glucose 4,6-dehydratase	K7QJG5	Escherichia_phage	1.7e-74	45.2
WP_162645209.1\|2735945_2736503_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.9e-38	45.3
WP_162640348.1\|2736528_2737272_-	NTP transferase domain-containing protein	G3MA50	Bacillus_virus	1.8e-52	45.9
WP_162640349.1\|2737364_2737472_-	sulfotransferase	NA	NA	NA	NA
WP_162640350.1\|2737494_2738127_-	SIS domain-containing protein	A0A067XQR2	Caulobacter_phage	2.3e-16	30.8
WP_162640351.1\|2738154_2739246_-	acyltransferase	A9YX16	Burkholderia_phage	2.1e-33	32.4
WP_162640352.1\|2739280_2741482_-	glycoside hydrolase family 5 protein	NA	NA	NA	NA
WP_162645210.1\|2741512_2742037_-	HAD family hydrolase	NA	NA	NA	NA
WP_162640353.1\|2742047_2742743_-	NTP transferase domain-containing protein	A0A2K9L821	Tupanvirus	3.9e-09	25.3

DBSCAN-SWA_4

6605694 : 6614426

Bacillus_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162644644.1\|6605694_6606537_+	Fpg/Nei family DNA glycosylase	G3MA33	Bacillus_virus	1.6e-12	30.8
WP_162644646.1\|6606543_6607386_+	deoxyribonuclease IV	A0A2L2DJK8	Acanthamoeba_polyphaga_mimivirus	1.1e-21	28.8
WP_162644648.1\|6607382_6607688_+	cell division protein FtsJ	A0A0A0RP18	Bacillus_phage	8.4e-09	42.7
WP_162644650.1\|6607708_6608488_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.9e-13	27.4
WP_162645512.1\|6608536_6609511_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_162644651.1\|6609641_6611285_+	serine/threonine protein kinase	A0A2P1EMR8	Moumouvirus	8.3e-18	30.6
WP_162644653.1\|6611484_6612183_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-31	33.3
WP_162644655.1\|6612179_6613538_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_162644657.1\|6613562_6614426_+	carbon-nitrogen hydrolase family protein	M1IKC7	Paramecium_bursaria_Chlorella_virus	1.0e-06	26.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048286

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection