CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP048384	Citrobacter freundii strain 62 plasmid p6_B, complete sequence	0 crisprs	DEDDh	0	1
NZ_CP048382	Citrobacter freundii strain 62 chromosome, complete genome	1 crisprs	RT,csa3,PD-DExK,cas3,DEDDh,WYL,DinG	1	355
NZ_CP048385	Citrobacter freundii strain 62 plasmid p6_C, complete sequence	0 crisprs	NA	0	0
NZ_CP048383	Citrobacter freundii strain 62 plasmid p6_A, complete sequence	0 crisprs	csa3,WYL,DinG	0	12

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

105744 : 172702

Escherichia_phage(23.08%)

transposase,integrase

attL 170434:170449|attR 175354:175369

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022542389.1\|105744_106749_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_001067855.1\|109666_110371_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018329.1\|110560_111376_-	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
WP_001067855.1\|111526_112231_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000480968.1\|112291_113128_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|113127_113931_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_001043265.1\|113991_114807_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	3.5e-09	27.6
WP_162648852.1\|115020_116451_+\|transposase	IS4-like element IS50R family transposase	Q9JMP3	Wolbachia_phage	4.5e-36	27.1
WP_000240536.1\|116657_117509_-	replication protein	NA	NA	NA	NA
WP_001067855.1\|118264_118969_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000381802.1\|119144_119678_-	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
WP_113979304.1\|119839_120757_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	7.4e-101	59.5
WP_000845048.1\|120883_121897_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_162620314.1\|122195_122561_-	hypothetical protein	NA	NA	NA	NA
WP_162620312.1\|123800_124364_-	hypothetical protein	NA	NA	NA	NA
WP_111231099.1\|125254_125773_-	DUF1566 domain-containing protein	NA	NA	NA	NA
WP_012585400.1\|126006_126255_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_003159185.1\|126383_126950_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	7.9e-45	54.3
WP_000845048.1\|127296_128310_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001083725.1\|128454_128952_+	trimethoprim-resistant dihydrofolate reductase DfrA12	A0A0A0PL85	Bacillus_phage	7.5e-23	40.9
WP_001336345.1\|129063_129354_+	DUF1010 domain-containing protein	NA	NA	NA	NA
WP_001206356.1\|129359_130151_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_000679427.1\|130314_130662_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_001445937.1\|131729_132686_-	hypothetical protein	NA	NA	NA	NA
WP_004152391.1\|133220_134936_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_004152392.1\|135045_138075_+\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
WP_004199214.1\|138181_139207_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
WP_004152394.1\|139203_139983_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
WP_004199234.1\|140270_141152_+	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
WP_004152397.1\|141401_142721_-\|transposase	IS1182-like element ISKpn6 family transposase	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
WP_004152398.1\|142997_144182_-\|transposase	ISAs1-like element ISKpn31 family transposase	NA	NA	NA	NA
WP_004152400.1\|144685_145045_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.6e-19	62.0
WP_004152402.1\|146210_146831_-	recombinase family protein	A0A219Y912	Aeromonas_phage	2.0e-09	31.5
WP_004152403.1\|146919_149817_-\|transposase	Tn3-like element Tn5403 family transposase	A0A1B0V7H9	Salmonella_phage	2.7e-181	37.7
WP_001067855.1\|149889_150594_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_161469620.1\|151644_152670_+\|transposase	IS630 family transposase	M4M9P8	Vibrio_phage	2.1e-11	67.4
WP_000027057.1\|153443_154304_+	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
WP_000935452.1\|154871_156176_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_001300294.1\|156214_156883_-	EAL domain-containing protein	NA	NA	NA	NA
WP_000993386.1\|156918_157155_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001277456.1\|157151_157514_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_162648853.1\|157531_159217_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	9.6e-38	28.5
WP_000522996.1\|159255_159681_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_000732275.1\|159708_159984_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294656.1\|159999_160365_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|160436_160892_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_000787563.1\|162238_162511_+	MafI family immunity protein	NA	NA	NA	NA
WP_011872911.1\|162805_163105_+	hypothetical protein	NA	NA	NA	NA
WP_111231093.1\|164387_165824_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	1.7e-35	27.1
WP_162648854.1\|166455_167304_+	CTX-M family class A extended-spectrum beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.7e-123	84.2
WP_162648855.1\|167391_168822_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.6e-36	27.1
WP_000791469.1\|169240_169693_+	hypothetical protein	NA	NA	NA	NA
WP_000278322.1\|169708_170311_-	hypothetical protein	NA	NA	NA	NA
170434:170449	attL	NA	NA	NA	NA
WP_000575657.1\|170572_170854_+	hypothetical protein	NA	NA	NA	NA
WP_000949433.1\|171152_171689_+	hypothetical protein	NA	NA	NA	NA
WP_000543934.1\|171691_172702_+\|integrase	tyrosine-type recombinase/integrase	A0A0K0N6I5	Gordonia_phage	3.1e-07	31.9
175354:175369	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP048383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 7694

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372340.1\|1202_1688_+	hypothetical protein	NA	NA	NA	NA
WP_009651680.1\|1775_2093_+	hypothetical protein	NA	NA	NA	NA
WP_016241545.1\|2114_2513_+	hypothetical protein	NA	NA	NA	NA
WP_007372341.1\|2831_3059_+	hypothetical protein	NA	NA	NA	NA
WP_007372342.1\|3239_4163_+	hypothetical protein	NA	NA	NA	NA
WP_007372343.1\|4198_4522_-	hypothetical protein	NA	NA	NA	NA
WP_007372345.1\|4804_5023_+	hypothetical protein	NA	NA	NA	NA
WP_016241542.1\|5234_5501_-	hypothetical protein	NA	NA	NA	NA
WP_007372347.1\|6080_7694_+	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	2.2e-07	37.0

DBSCAN-SWA_2

13553 : 49538

Escherichia_phage(33.33%)

integrase,transposase

attL 21687:21701|attR 61718:61732

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648829.1\|13553_14534_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	5.7e-184	98.5
WP_016241614.1\|14641_15283_-	recombinase family protein	NA	NA	NA	NA
WP_162648848.1\|15450_15993_+	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_001067855.1\|15883_16588_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001000602.1\|16780_17932_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	6.7e-99	53.7
WP_162648830.1\|19119_20586_-	TolC family protein	NA	NA	NA	NA
WP_162648831.1\|20675_21290_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_162648832.1\|21365_22475_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
21687:21701	attL	NA	NA	NA	NA
WP_162648833.1\|22471_25582_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_162648834.1\|25574_26405_+	oxidoreductase	W8CYX9	Bacillus_phage	1.9e-07	40.5
WP_000019445.1\|26505_27486_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_000780222.1\|27763_28045_-	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_000493286.1\|28025_28355_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000156887.1\|29054_30077_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_001114073.1\|30766_31120_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-23	50.0
WP_000783215.1\|31167_31530_+	arsenite efflux transporter metallochaperone ArsD	NA	NA	NA	NA
WP_001556710.1\|31547_33299_+	arsenite efflux transporter ATPase subunit ArsA	NA	NA	NA	NA
WP_000922630.1\|33346_34636_+	arsenite efflux transporter membrane subunit ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.5e-171	73.5
WP_000065758.1\|34648_35074_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	1.2e-50	70.7
WP_004118313.1\|35104_35509_-	arsenic transporter ATPase	NA	NA	NA	NA
WP_001556711.1\|35517_36090_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.0e-83	89.0
WP_012817690.1\|36253_39262_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	64.5
WP_001752509.1\|41163_41664_-	non-heme ferritin-like protein	NA	NA	NA	NA
WP_001067855.1\|41990_42695_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_162648835.1\|42731_43547_-	EAL domain-containing protein	NA	NA	NA	NA
WP_003132004.1\|43543_43780_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_000995360.1\|43776_44142_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_162648836.1\|44159_45845_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-40	29.1
WP_003131987.1\|45916_46192_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_003131974.1\|46204_46555_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_003131969.1\|46626_47061_+	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_048227261.1\|47884_48481_-	DUF2913 family protein	NA	NA	NA	NA
WP_048227260.1\|48531_48765_-	hypothetical protein	NA	NA	NA	NA
WP_048227271.1\|48761_49538_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	1.4e-52	92.0
61718:61732	attR	NA	NA	NA	NA

DBSCAN-SWA_3

58550 : 60699

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106671846.1\|58550_60026_-	copper/silver sensor histidine kinase SilS	W8CYF6	Bacillus_phage	3.6e-28	30.5
WP_001572351.1\|60018_60699_-	copper/silver response regulator transcription factor SilR	W8CYM9	Bacillus_phage	2.1e-31	35.6

DBSCAN-SWA_4

64072 : 71320

Leptospira_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110246277.1\|64072_67219_+	Cu(+)/Ag(+) efflux RND transporter permease subunit SilA	S5VTK5	Leptospira_phage	4.0e-61	22.5
WP_106671853.1\|67304_67745_+	hypothetical protein	NA	NA	NA	NA
WP_143194471.1\|67842_70311_+	Ag(+)-translocating P-type ATPase SilP	E4ZFI9	Streptococcus_phage	1.4e-82	34.5
WP_000843494.1\|70351_70549_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_106671857.1\|70582_71320_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2H4JAF5	uncultured_Caudovirales_phage	1.3e-10	31.9

DBSCAN-SWA_5

76373 : 79700

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008786781.1\|76373_77054_+	copper response regulator transcription factor PcoR	W8CYM9	Bacillus_phage	1.3e-30	34.8
WP_008786782.1\|77050_78451_+	copper resistance membrane spanning protein PcoS	W8CYF6	Bacillus_phage	6.4e-19	27.3
WP_008786783.1\|78657_79092_+	hypothetical protein	NA	NA	NA	NA
WP_008786784.1\|79346_79700_+	As(III)-sensing metalloregulatory transcriptional repressor ArsR	A0A2H4J145	uncultured_Caudovirales_phage	2.8e-24	51.9

DBSCAN-SWA_6

92634 : 98784

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008786793.1\|92634_93051_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.0e-36	54.7
WP_009652912.1\|93050_94316_+	translesion error-prone DNA polymerase V subunit UmuC	A0A1W6JNT0	Morganella_phage	9.8e-144	60.6
WP_007372144.1\|94465_95356_+	DNA replication protein	NA	NA	NA	NA
WP_127649377.1\|95668_96049_+	hypothetical protein	NA	NA	NA	NA
WP_001333498.1\|96337_96595_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	8.3e-18	65.7
WP_000217395.1\|96765_97257_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_007372145.1\|97342_97834_-	hypothetical protein	NA	NA	NA	NA
WP_008786797.1\|98382_98784_+	hypothetical protein	Q1MVE8	Enterobacteria_phage	3.5e-47	69.9

DBSCAN-SWA_7

102067 : 170680

Escherichia_phage(36.36%)

integrase,transposase

attL 102158:102175|attR 163805:163822

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|102067_103048_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
102158:102175	attL	NA	NA	NA	NA
WP_001548175.1\|103908_106041_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_001549868.1\|106042_107392_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_001549866.1\|107388_108270_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_000989158.1\|108284_110204_-	TolC family protein	NA	NA	NA	NA
WP_162648837.1\|110280_123669_-	tandem-95 repeat protein	NA	NA	NA	NA
WP_063841712.1\|124216_125197_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_072146302.1\|125800_125992_+	hypothetical protein	NA	NA	NA	NA
WP_007372176.1\|126198_126969_+	siderophore-interacting protein	NA	NA	NA	NA
WP_162648838.1\|127072_128722_-	glycerone kinase	NA	NA	NA	NA
WP_007372178.1\|128796_130215_-	dihydroxyacetone kinase subunit DhaM	NA	NA	NA	NA
WP_007372179.1\|130225_130858_-	dihydroxyacetone kinase ADP-binding subunit DhaL	NA	NA	NA	NA
WP_007372180.1\|130868_131939_-	dihydroxyacetone kinase subunit DhaK	NA	NA	NA	NA
WP_007372182.1\|132495_133593_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_007372183.1\|133782_134061_-	dihydroxyacetone kinase	NA	NA	NA	NA
WP_007372185.1\|134621_135719_+	glycerol dehydrogenase	NA	NA	NA	NA
WP_009653098.1\|135808_137734_+	PTS-dependent dihydroxyacetone kinase operon transcriptional regulator DhaR	NA	NA	NA	NA
WP_007372187.1\|137711_138242_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_007372188.1\|138242_138596_-	hypothetical protein	NA	NA	NA	NA
WP_007372189.1\|138612_139776_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_007372190.1\|139798_140227_-	heme-binding protein	NA	NA	NA	NA
WP_016241522.1\|140619_142287_+	propanediol/glycerol family dehydratase large subunit	NA	NA	NA	NA
WP_009652918.1\|142298_142883_+	propanediol/glycerol family dehydratase medium subunit	NA	NA	NA	NA
WP_007372193.1\|142885_143314_+	diol dehydratase small subunit	NA	NA	NA	NA
WP_007372194.1\|143324_145136_+	diol dehydratase reactivase subunit alpha	NA	NA	NA	NA
WP_007372195.1\|145189_145993_+	aquaporin	M1HJ75	Acanthocystis_turfacea_Chlorella_virus	2.1e-14	31.5
WP_024196074.1\|146044_146374_-	acid-activated periplasmic chaperone HdeB	NA	NA	NA	NA
WP_023157605.1\|146612_147929_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	4.1e-36	30.5
WP_016154572.1\|147993_148548_+	hypothetical protein	NA	NA	NA	NA
WP_162648839.1\|149175_150180_+	hypothetical protein	NA	NA	NA	NA
WP_077695998.1\|150457_150565_-	hypothetical protein	NA	NA	NA	NA
WP_077695999.1\|150598_150787_-	hypothetical protein	Q71TE9	Escherichia_phage	4.1e-06	51.2
WP_006812027.1\|150995_151232_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_111963071.1\|151365_152775_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_162648840.1\|152911_153538_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_006809979.1\|153610_154105_-	hypothetical protein	NA	NA	NA	NA
WP_162648841.1\|154139_157271_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	1.2e-73	27.5
WP_162648842.1\|157270_158695_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_021569984.1\|158684_160394_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	8.5e-42	27.9
WP_019077728.1\|160662_161124_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001581470.1\|161186_161789_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_019077727.1\|161832_162528_+	B3/4 domain-containing protein	NA	NA	NA	NA
WP_000019445.1\|162931_163912_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
163805:163822	attR	NA	NA	NA	NA
WP_162648843.1\|163910_164171_+	hypothetical protein	NA	NA	NA	NA
WP_049043034.1\|164534_165743_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	5.1e-49	48.9
WP_001247776.1\|166069_166333_-\|transposase	transposase	A0A218MNG9	uncultured_virus	6.3e-05	41.0
WP_001295708.1\|166347_166611_+	hypothetical protein	NA	NA	NA	NA
WP_000643630.1\|166839_167121_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000350437.1\|167155_167725_+	small heat shock protein sHSP20	NA	NA	NA	NA
WP_162648844.1\|167830_170680_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	2.4e-129	41.4

DBSCAN-SWA_8

175208 : 211474

Escherichia_phage(27.27%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000786816.1\|175208_175649_+	heat resistance system thioredoxin Trx-GI	A0A023NHA9	Dinoroseobacter_phage	2.6e-11	34.7
WP_019077719.1\|175652_177368_+	heat resistance system K+/H+ antiporter KefB-GI	NA	NA	NA	NA
WP_000843382.1\|177364_177862_+	heat resistance protein PsiE-GI	NA	NA	NA	NA
WP_162648845.1\|177839_178805_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_000323729.1\|178829_179981_+\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	7.5e-26	30.3
WP_016154552.1\|181896_182760_+	GTPase family protein	NA	NA	NA	NA
WP_001548934.1\|182851_183673_+	DUF945 domain-containing protein	A0A2C9CX26	Yersinia_phage	4.7e-46	38.7
WP_001548933.1\|183889_184591_+	WYL domain-containing protein	NA	NA	NA	NA
WP_001115854.1\|184627_184864_+	hypothetical protein	NA	NA	NA	NA
WP_103468661.1\|184863_185304_+	hypothetical protein	NA	NA	NA	NA
WP_032200803.1\|185329_185797_+	hypothetical protein	NA	NA	NA	NA
WP_000194654.1\|185873_186113_+	DUF905 domain-containing protein	NA	NA	NA	NA
WP_000211838.1\|186210_186669_+	antirestriction protein	NA	NA	NA	NA
WP_000811693.1\|186684_187161_+	RadC family protein	NA	NA	NA	NA
WP_001548171.1\|187169_187391_+	DUF987 domain-containing protein	A0A142F0X9	Klebsiella_phage	3.1e-05	38.9
WP_006812013.1\|187410_187728_+	type IV toxin-antitoxin system YeeU family antitoxin	NA	NA	NA	NA
WP_006812012.1\|187748_188090_+	toxin	NA	NA	NA	NA
WP_007372197.1\|188291_188696_+	FCD domain-containing protein	NA	NA	NA	NA
WP_009652914.1\|188722_189109_-	plasmid stability protein	NA	NA	NA	NA
WP_007372199.1\|189122_190085_-	plasmid stabilization protein	A0A222YXF2	Escherichia_phage	9.6e-59	41.1
WP_001254932.1\|191332_192484_+\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
WP_009652923.1\|193403_193718_+	hypothetical protein	NA	NA	NA	NA
WP_099531012.1\|194004_194280_+	hypothetical protein	NA	NA	NA	NA
WP_001515737.1\|195933_197211_-	serine dehydratase subunit alpha family protein	NA	NA	NA	NA
WP_000948259.1\|197558_198200_-	hypothetical protein	NA	NA	NA	NA
WP_000449980.1\|198199_199138_-	MCE family protein	NA	NA	NA	NA
WP_000254595.1\|199139_199943_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.8e-10	27.7
WP_001325018.1\|199936_201082_-	ABC transporter permease	NA	NA	NA	NA
WP_001515736.1\|201195_201447_-	hypothetical protein	NA	NA	NA	NA
WP_001067855.1\|201505_202210_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_162648846.1\|202286_202454_+	hypothetical protein	NA	NA	NA	NA
WP_063841712.1\|203833_204814_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_016241569.1\|204909_205341_+	hypothetical protein	NA	NA	NA	NA
WP_009652897.1\|206217_206907_+	hypothetical protein	NA	NA	NA	NA
WP_007372259.1\|207501_208065_+	hypothetical protein	NA	NA	NA	NA
WP_007372260.1\|208299_208494_+	hypothetical protein	NA	NA	NA	NA
WP_007372261.1\|208615_208867_+	hypothetical protein	NA	NA	NA	NA
WP_001254932.1\|210052_211204_+\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
WP_001547737.1\|211123_211474_-\|transposase	transposase	Q716C1	Shigella_phage	5.2e-39	97.7

DBSCAN-SWA_9

215410 : 224050

Salmonella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372267.1\|215410_216004_+	hypothetical protein	J9Q753	Salmonella_phage	1.4e-07	34.5
WP_007372268.1\|216096_216363_+	hypothetical protein	NA	NA	NA	NA
WP_007372269.1\|216471_216930_+	hypothetical protein	NA	NA	NA	NA
WP_007372270.1\|216965_217442_+	hypothetical protein	NA	NA	NA	NA
WP_007372271.1\|217516_217792_+	hypothetical protein	NA	NA	NA	NA
WP_007372272.1\|217906_218179_+	hypothetical protein	A0A192YCJ5	Morganella_phage	1.5e-09	37.2
WP_016241563.1\|218333_218639_+	hypothetical protein	NA	NA	NA	NA
WP_007372274.1\|218651_218945_+	hypothetical protein	NA	NA	NA	NA
WP_016241562.1\|219039_221112_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.7e-44	24.4
WP_016241561.1\|221132_221453_+	hypothetical protein	NA	NA	NA	NA
WP_024196082.1\|221540_221963_+	hypothetical protein	NA	NA	NA	NA
WP_024196081.1\|222235_222631_+	hypothetical protein	NA	NA	NA	NA
WP_016241560.1\|222812_223004_+	hypothetical protein	NA	NA	NA	NA
WP_007372278.1\|223134_223830_+	hypothetical protein	NA	NA	NA	NA
WP_032155220.1\|223852_224050_+	restriction alleviation protein, Lar family	A0A0U2QQP4	Escherichia_phage	2.6e-11	48.4

DBSCAN-SWA_10

227799 : 229354

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016241558.1\|227799_227958_+	hypothetical protein	A0A2P1JU39	Erwinia_phage	1.7e-05	58.3
WP_007372288.1\|228112_228667_+	hypothetical protein	NA	NA	NA	NA
WP_007372289.1\|228736_229354_+	hypothetical protein	A0A076G6Q2	Escherichia_phage	4.1e-63	53.4

DBSCAN-SWA_11

238550 : 239393

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372307.1\|238550_239393_+	HNH endonuclease	G0X580	Salmonella_phage	1.8e-16	39.5

DBSCAN-SWA_12

243272 : 252411

Salmonella_phage(71.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007372313.1\|243272_244277_+	peptide transporter	A0A1B0V750	Salmonella_phage	3.0e-18	27.2
WP_008786583.1\|244400_244802_+	hypothetical protein	NA	NA	NA	NA
WP_007372314.1\|244773_246474_+	AAA family ATPase	A0A172JHZ0	Bacillus_phage	3.5e-96	36.7
WP_162648847.1\|246900_247101_+	hypothetical protein	A0A1V0E5M0	Salmonella_phage	3.3e-14	77.1
WP_023279773.1\|247126_248095_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-180	96.6
WP_079828476.1\|248147_248390_+	hypothetical protein	NA	NA	NA	NA
WP_016241550.1\|248501_248927_+	hypothetical protein	A0A0K1YBA5	Cronobacter_phage	1.6e-26	42.8
WP_007372337.1\|249080_249800_+	HNH endonuclease	G0X580	Salmonella_phage	2.2e-07	39.5
WP_007372338.1\|251328_252411_-	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	1.1e-79	56.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP048382

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048382_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048382_1

3793073-3793196

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048382_1

>merge|NZ_CP048382|1|3793073-3793196|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>NZ_CP048382|1|1|3793073-3793196|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CGGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048382.1\|WP_162648717.1\|3791414_3792167_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP048382.1\|WP_053069592.1\|3782635_3783109_+\|SnoaL-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377824
NZ_CP048382.1\|WP_162648714.1\|3786346_3787822_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP048382.1\|WP_003029278.1\|3792153_3792876_-\|solute-binding-protein	unknown	unknown	gnl\|CDD\|270259
NZ_CP048382.1\|WP_162648715.1\|3787928_3789191_+\|4-aminobutyrate-transaminase	unknown	unknown	gnl\|CDD\|182078
NZ_CP048382.1\|WP_003029271.1\|3796234_3796876_-\|DUF1120-domain-containing-protein	unknown	unknown	gnl\|CDD\|185203
NZ_CP048382.1\|WP_032935863.1\|3802979_3803984_-\|tryptophan--tRNA-ligase	unknown	unknown	gnl\|CDD\|183400
NZ_CP048382.1\|WP_162648719.1\|3797569_3799984_-\|fimbrial-biogenesis-usher-protein	unknown	unknown	gnl\|CDD\|237937
NZ_CP048382.1\|WP_162648716.1\|3790413_3791418_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP048382.1\|WP_003029273.1\|3795181_3796162_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311
NZ_CP048382.1\|WP_162648713.1\|3785094_3786303_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|379187
NZ_CP048382.1\|WP_003029251.1\|3804185_3805970_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP048382.1\|WP_044699932.1\|3797021_3797573_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|185201
NZ_CP048382.1\|WP_063841712.1\|3800808_3801789_+\|IS5-like-element-ISKpn26-family-transposase	unknown	unknown	gnl\|CDD\|225581
NZ_CP048382.1\|WP_003029285.1\|3789371_3790427_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238562
NZ_CP048382.1\|WP_016150164.1\|3783198_3785091_+\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|379192
NZ_CP048382.1\|WP_044712332.1\|3806089_3807199_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP048382.1\|WP_162648718.1\|3794092_3795103_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|223135
NZ_CP048382.1\|WP_139935353.1\|3781196_3782624_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143411
NZ_CP048382.1\|WP_162648827.1\|3800105_3800774_-\|fimbria/pilus-periplasmic-chaperone	unknown	unknown	gnl\|CDD\|236632

Protein	Function_ID	Function_description	E-value
NZ_CP048382.1\|WP_162648717.1\|3791414_3792167_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.90128e-78
NZ_CP048382.1\|WP_053069592.1\|3782635_3783109_+\|SnoaL-like-domain-containing-protein	gnl\|CDD\|377824	pfam07366, SnoaL, SnoaL-like polyketide cyclase. This family includes SnoaL a polyketide cyclase involved in nogalamycin biosynthesis. This family was formerly known as DUF1486. The proteins in this family adopt a distorted alpha-beta barrel fold. Structural data together with site-directed mutagenesis experiments have shown that SnoaL has a different mechanism to that of the classical aldolase for catalyzing intramolecular aldol condensation.	8.6951e-20
NZ_CP048382.1\|WP_162648714.1\|3786346_3787822_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.31144e-138
NZ_CP048382.1\|WP_003029278.1\|3792153_3792876_-\|solute-binding-protein	gnl\|CDD\|270259	cd13541, PBP2_ModA_like_2, Substrate binding domain of molybdate-binding proteins;the type 2 periplasmic binding protein fold. This subfamily contains domains found in ModA proteins of putative ABC-type transporter. ModA proteins serve as initial receptors in the ABC transport of molybdate in eubacteria and archaea. Bacteria and archaea import molybdenum and tungsten from the environment in the form of the oxyanions molybdate (MoO(4) (2-)) and tungstate (WO(4) (2-)). After binding molybdate and tungstate with high affinity, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ModA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	5.38213e-90
NZ_CP048382.1\|WP_162648715.1\|3787928_3789191_+\|4-aminobutyrate-transaminase	gnl\|CDD\|182078	PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional.	0
NZ_CP048382.1\|WP_003029271.1\|3796234_3796876_-\|DUF1120-domain-containing-protein	gnl\|CDD\|185203	PRK15303, PRK15303, hypothetical protein; Provisional.	1.77492e-20
NZ_CP048382.1\|WP_032935863.1\|3802979_3803984_-\|tryptophan--tRNA-ligase	gnl\|CDD\|183400	PRK12282, PRK12282, tryptophanyl-tRNA synthetase II; Reviewed.	0
NZ_CP048382.1\|WP_162648719.1\|3797569_3799984_-\|fimbrial-biogenesis-usher-protein	gnl\|CDD\|237937	PRK15304, PRK15304, putative fimbrial outer membrane usher protein; Provisional.	0
NZ_CP048382.1\|WP_162648716.1\|3790413_3791418_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.72892e-82
NZ_CP048382.1\|WP_003029273.1\|3795181_3796162_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	2.93083e-79
NZ_CP048382.1\|WP_162648713.1\|3785094_3786303_+\|c-type-cytochrome	gnl\|CDD\|379187	pfam13442, Cytochrome_CBB3, Cytochrome C oxidase, cbb3-type, subunit III.	3.52941e-10
NZ_CP048382.1\|WP_003029251.1\|3804185_3805970_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.06208e-57
NZ_CP048382.1\|WP_044699932.1\|3797021_3797573_-\|hypothetical-protein	gnl\|CDD\|185201	PRK15301, PRK15301, hypothetical protein; Provisional.	2.39327e-08
NZ_CP048382.1\|WP_063841712.1\|3800808_3801789_+\|IS5-like-element-ISKpn26-family-transposase	gnl\|CDD\|225581	COG3039, COG3039, Transposase and inactivated derivatives, IS5 family [DNA replication, recombination, and repair].	9.18998e-54
NZ_CP048382.1\|WP_003029285.1\|3789371_3790427_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238562	cd01142, TroA_e, Periplasmic binding protein TroA_e. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	3.99191e-82
NZ_CP048382.1\|WP_016150164.1\|3783198_3785091_+\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|379192	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain.	6.47642e-06
NZ_CP048382.1\|WP_044712332.1\|3806089_3807199_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	5.43985e-41
NZ_CP048382.1\|WP_162648718.1\|3794092_3795103_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	2.05555e-174
NZ_CP048382.1\|WP_139935353.1\|3781196_3782624_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143411	cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like. NAD+-dependent, tetrameric, gamma-aminobutyraldehyde dehydrogenase (ABALDH), YdcW of Escherichia coli K12, catalyzes the oxidation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ABALDH can also oxidize n-alkyl medium-chain aldehydes, but with a lower catalytic efficiency.	0
NZ_CP048382.1\|WP_162648827.1\|3800105_3800774_-\|fimbria/pilus-periplasmic-chaperone	gnl\|CDD\|236632	PRK09918, PRK09918, putative fimbrial chaperone protein; Provisional.	9.19311e-95

>NZ_CP048382.1|WP_003029278.1|3792153_3792876_-|solute-binding-protein
MPSSILLFAAGSLRPAFTPLISQFTRMSGIDVKIEYGPAGLLRERIETGEPCALFASANREHPQNLLVRNKAVSTHTFCWNKLSLVSNRIGTWLDLLRDPTLRPGTSTPGCDPSGDYTWAFFDNMDVLEPGLGQQLRARAIPLVGGRDTVKIPQGELASAWILRQGLADLFIGYAHYAHALHAMTDVHYVAIPDEHNICCEYQLAVLDASKEVMALVEFILSRSGQAFLTAAGFLPLNAE
>NZ_CP048382.1|WP_162648717.1|3791414_3792167_+|ABC-transporter-ATP-binding-protein
MIPAALRVNQLSYGYRAPLFEPLTFCCQKGDIWAVLGRNGLGKSTLLDTLTGTLPALGGSIENNGGIGIVAQHSHLPFPYTVSDVVLMGRAQHVKLFAQPSQQDQQRAMQALEQLSIAHLASISFGSLSGGQQQLVMIARALVTECQTLLLDEPCSALDLANQQVVLQLISDLAHQQRCSILFSTHDPLHALQVASHTLLLLPEGKWRAGPTDSIVTEENLFLAYGLPLRKLSVENHSTPFIAPLFSIRR
>NZ_CP048382.1|WP_162648716.1|3790413_3791418_+|iron-ABC-transporter-permease
MQLSNRFLPQQPLLIVVVLLLGVSSLCLGQYPLSLSEVFYHLTHYSDAEGIASQVIWTVRLPRILMALLAGGALGLCGATLQGVFHNPLVDPHIIGVTSGAAFGGTLAILLGLSPLLMMGSTFFFGLTALILVYAIAVLQGLENTLVLILSGIILSGFFAALVSLIQYQADTEETLPNIVFWLLGSFATANWHKVLLLAVPVGIAATVLFQLRWRINLLSLNDKDARALGVAVVPLRRSVLVCCAFLVAAQVAVSGSIAWVGLVIPHLARLLVGVDHRRLLPCAFWLGGGFMIVVDDIARTLMHAEIPLGIITALFGAPLFAFLLIRTSRREKS
>NZ_CP048382.1|WP_003029285.1|3789371_3790427_+|ABC-transporter-substrate-binding-protein
MLTFRSFVLVCASMLFAFSAQADRTITDQLGRQVTIPDHVDKVVVLQHQTLNILVQLNAQQDIVGVMSSWKKQLGPEFARFMPTITTLPTPGDLTSVNIESLLAIHPQVVFVANYAPAEMIQQIQNAGIPVVAISLRKDADGQQNKMNPTMADEEQVYNEGLKQGIRLIADVVGRKPQAETLIDYVFAARAKFNAPVANIPDAQKVRIYMANPDLMTYGSGKYTGLMMQHAGGLNVAAASVKGARQVALEQVLAWNPQVIFVQDRYPQVVTQIQNDPNWQGIDAVKNHRVWLMPEYAKAWGYPMPEALAIGELWMAKKLYPDAYKDVDVDAQAQDYYQRFYRVNWQSDAAK
>NZ_CP048382.1|WP_162648715.1|3787928_3789191_+|4-aminobutyrate-transaminase
MNNKNLQQRRLDATPRGVGVMCDFYAQSAENSTITDIEGNQYIDFAAGIAVLNTGHRHPRLVQAVEAQLQAFTHTAYQIVPYESYVSLAEKINAVAPIDGKRKTTFFTTGAEAVENAVKIARAHTGRPGVIAFGGGFHGRTYMTMALTGKVAPYKKGFGPFPGSVYHAPYPSELQGISTADSLKAIERLFKADIDPTQVAAIIFEPVQGEGGFVVAPPEFVAAIRRICDEHGIVMIADEVQSGFARTGQLFAMDHYSDKADLMTMAKSLAGGMPLSGVVGKAEIMDAPAPGGLGGTYAGNPLSIAAAHAVLDIIHDEQLCQRAAALGEQLRAALTDAQAGCPELAEVRGLGSMIAAEFCDAATGEPNASAAQRVQKKALEQGLLLLTCGQYGNVIRFLYPLTIPLDQFAKALQIIKAATK
>NZ_CP048382.1|WP_162648714.1|3786346_3787822_-|PLP-dependent-aminotransferase-family-protein
MRSLAGDVIKHAFSQQTDEKLHRRLYAAICSCILEGSLKPATRMPPSRDLAGELMLSRNTVLRVYEQLQAEGYISARTSSGTFVTDSVLDNLNLRPNKEPVATALEDHTRLSARCLELLGNASASPRQWGAFIPGVPDVEHFPHRVLKKIQDRLARRLRPEFLTYDAAGGVNELKEALADYLRTARGVRCSPEQILITEGIHQALDLVTRTLCNPGDHAWIEEPGYWGIKNILRINAVNFSAIPVDEQGMVPPDAGETPPKLIFVTPSHQYPLGSVMSLSRRRQLIFRARETRSWIVEDDYDSEFRFSGQPIPSLQGLEEETPVIYIGTFSKTLYPALRLGYVVLPKSLAAPLKKVHNDLYRGGHLLIQAALAEFIHEGYYAAHIRKMRQLYSRRRQMLVELISRQLGEHYLGSFSSNAGLHMILQLPAGSDDAVIAQQANAQGLLVRPLSRYYVNEEKRSGLLLGFASIEEHEMSAAFTRLADIIRVNTV
>NZ_CP048382.1|WP_162648713.1|3785094_3786303_+|c-type-cytochrome
MRNVTILAACLFTASVSAAESNGEYIARISDCVACHTAEGGAAMAGGKKFPTPVGDIYSTNITPDKAQGIGNYSYEDFEKAVRQGIAKDGHPLYPAMPYPSYAKLSDEDVQALYRYFMHDVTPSAQPNKENAIPWLLSARWPLHIWNWLFTDAPATTVDSAKPDDNAALVKRGAYLVEGPGHCGSCHTPRGMAMNEKAYTHADAEYLSGAMIDGWYAPSLRGSGMSEQALKSLLLTGKSKHAAVSGSMAEVVTQSTQYLTDEDATAIAQYLLSLKSAKPETVRAAATTASWSNSPEAGKVTYNRYCSTCHGLEGKGTDDNAPSLVNNPLVMVDDPTPLFRVIAHGAETPTTRGSVSFKMPAYGGMLSDNEMRDVINYVRQTWGEGNGEVSHEDLAGIKKASH
>NZ_CP048382.1|WP_016150164.1|3783198_3785091_+|NAD(P)/FAD-dependent-oxidoreductase
MAITRRDFLNGVAVTIAAGLTPLEWVRATGKGNAFIDGNYYPPALTGLRGNHPGSFEMAHALGREQKHFDLNALPVEEEYDLVIVGGGISGLAAGCFWRQVAGQNSRILILDNHDDFGGHAKRNEFTSSGKKLLGYGGSEAFQSPAHNFSPEVQKLMETVGVSVTRLKESFDVNFYPDWQLSRGVFFDKKNFGVTKIVSGDPGRAVSDDIPPDRLNGRKIEDFINDFPLGENDRKALIDLHVRPGDYLPGMTVDEKMEWLDTHSYSEFLATKVGLSKMALLYFQQRSNDFFAIGIEGISCSDARACALPGMEGMGLPPLDGESLADLEEPYVYHFPDGNAGLARLLVRYMLPDALPGNTMEDSVLARLHYEKLDLPENTTRLRLNSTVINAANVQDGVVVTYLRDGKMHRVRGKNTIMAGYNMMIPYLVPEMPEQQQADLKLNVKAPLVYTNVVVKNWQAFKQLGVHEFYSPAAPYSRVKLDYPVSIGGYQHPASPDDPMVIHMVYVPTYPGSNLSAREQFRLGRAYLLGTTFAAHEEMIRSQLQEMFGSTGFDNQRDISAITVNRWAHGYAYYANSLFDDMDKMPEIIERARQPVGRIAIANSDSDWSAYAHTAIDQAWRAVNELKDMG
>NZ_CP048382.1|WP_053069592.1|3782635_3783109_+|SnoaL-like-domain-containing-protein
MKTVKIAVLSLVMLSGYSLAESTSLNTVKEYMAAWNAHDASRAAQYLADDAVYYDAAAGEPINGREKAEKEVIGAFIKAVPDLNWKMVGKPVYDEDTVAFRWEFSGKNSGEWAGSPPTNNPIKFEGVSYIHVKAGKITWQGDYYDSKKLDEELKPVK
>NZ_CP048382.1|WP_139935353.1|3781196_3782624_+|aldehyde-dehydrogenase-family-protein
MKTLKHFINGHYVAGSSEDSFELVSPVDGETYAISPNANEAEVEQAYSAAEAAFSIWRKSTPAQRQKALLLLADEIERNVERLVTAQSQETGQLRHFIEKEEIAASCDAIRFFAGAARCLEGKAAGEYSAGFTSTIRREPLGIVGQVTPWNYPFMMAVWKIAPALAAGNTVVLKPSDTTPVSTLLLAELAAPLFPRGAFNVVLGKASTGSLVVSNPKASLVSITGSVRAGLQVAASAAANLTRAHLELGGKAPAVVFADADMDKAIATITTAGFFNAGQDCTAATRILVEQSIYAEFLEKLIQKTKSIKFGPPEDQNALYGALNSRNQLEQVKGFIERLPAHAKIETGGRAGPGPGFYFEPTIVSGLHQNDEAIQHEVFGPVMTIQSFSTDEEVLHKANDVEYGLAASVWTRNHGRAQRFSIYLDFGTVWINNHIPLCAEMPHGGFKKSGYGKDLSSYSLEEYTRVKHIMCDISE
>NZ_CP048382.1|WP_162648718.1|3794092_3795103_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MVKVGINGFGRIGRNVLRAALGNSDIQIVAINDLTDSKTLAHLLKYDSLLGKLDANVAASEGQLVVNGNSITVFSERDPAKIPWRQREVDIVIEATGFFTERDKAAVHIHSGGAKRVIISAPGKNDDLTIVMGVNDHLYSADKHFVVSNGSCTTNGLAPAAQVLHQHFGIKHGLMNTTHAYTNSQALHDQPEKDLRGARAAALSIVPYSSGAAKALGKVIPELDGRLTGYSLRVPVPVVSIVDLTVTLERDVTEEEVNNAFRNAAATGPLKGILGYSDEPLVSSDYQGDPRSSIIDGLSTLVIGGNMVKILAWYDNEWGFSNRLVDLALLMAKNER
>NZ_CP048382.1|WP_003029273.1|3795181_3796162_-|helix-turn-helix-domain-containing-protein
MKKILIIVPDGGMLFESAGIADIMMQANRLHPKSATETCYQVQLATTQPHQVIHGQSGLNLLADHRLHEIDPREPLDTIIITGRGQNPQEGIAVVDWLRLAAPHARRIASICGGAMLLAQTGLLDGRRATTHWKLLETMQAEFPQVRVESGPLYIQDEHIWTSGGVSSGFDLTLALVEEDYGFSLARDVAQDFVMYLRRPGGQLQFSRYNLQHTSTLGPINDLLVWLLENLTADLSVDKLAEKVAMSPRNFTRVFTRETGASPARYVAEARLAAARQRLEQTNETLERIAEQTGFGSSINLRRLFEKQLHLTPGEYRQRFHCRKMA
>NZ_CP048382.1|WP_003029271.1|3796234_3796876_-|DUF1120-domain-containing-protein
MITKAYAENTVDVSFSAEMIPAACRVSLDNGGTVDYGTLSLSSIRSSSPYLLTPRVIGLHIQCESLRQVAWMVNDEKAETRVRNLIIDSHDDKTSGRHSSDTLFGLGVTSGQKPIGGYLITALAGESAVEGDIASWGYQTGEQERSMWQSAGTALTLISGIMRLTPVDAKNNPVAIRQLTIPLRISAAIASDGLSLQDETELQGEATISLIYL
>NZ_CP048382.1|WP_044699932.1|3797021_3797573_-|hypothetical-protein
MIRLISLCCGIYFIVSPVVQAQCNIIASQLRHEYGKVRFQDTEPTGQVQWQQLPARQVQVQVRCDVPQPIHIRFDDNDRRGLDFSFGEEGRATVMFSEAFVDNKSSQFVVHHELNKSSESRSQTPIAVLNGDTVELQQHHQPVNGMSATFLLTVIPRVQARSFQVSDQQASTLSLRMTVPERE
>NZ_CP048382.1|WP_162648719.1|3797569_3799984_-|fimbrial-biogenesis-usher-protein
MPFNLIRTLPVHRYAYYLFLGLLGSYSMMLSAEPLLFDDGRLKNRGLDAGLSHYFSHAARFSPGEYPVSWVINGRNKRQLMTRFNAQGEPCITPETSRNLGLAYEFNQGCLDYQTLYPAAQLTADPYKNQISITVPTSALTPESILLRKDIIQGGTSGLLNYNLQSSTTVQSGKHETYQLGLFESGLNLNDWLLRSRHTVSYSDGTRRSQRLYTYVQKTFQSLQQTFQAGEIYARQTLLAIPGLTGLQLFPDSALRPARSGVSVQGIARSAQARVEVYQNGQLIEATQVPEGPFSLDNISMLSTQFPLDVKVTEQDGQLTTFSVPVTALQTPADAPLYGSVALGKVRETVASDESAPWLITGSQGMRISRQATLSGSALASAQYQSAAASLSFIPIPAWSLSLQTTMAQEQYTHHAGSKESLSLRYQLNPSASIQAAWTTTSAGFRELSDAVNHTTSTANSYYNVGGNWAHEHLGLFSLSYSTSSARDHAATPKSWYASWSKNWRWAGHGQINLSATWQRVSGSRTSTQRDDDVFYIRLGLPLGHDRVNLSLRRQGSRTYNDVQTSGQWDDMSYSLSAGRDWQNAQNTISGSFGQNLHYAQMSGYASQTANYWGYGGSLSGGISVNQEGILFSPYAIQESYGTLSLNSPLSGIKVSTPQGPVWTDYRGKALVPGLTPWQPSRLNIDVKTLPRHVDLTNGAAELTVSRGAVAFTQFRVSDTRRVLMTVRRTNGKLLSKGKGIVDSDGQYVTNSLEKGLVFFSNLQPGESFFVGDDNGSPMCQLQYSLPPTPPQDGLYEELTGVCE
>NZ_CP048382.1|WP_162648827.1|3800105_3800774_-|fimbria/pilus-periplasmic-chaperone
MISYQELVRTFLSMATGMQPDSSLLLIQEKESGGSMNVTNTDNIPSLLYTQVINVDGEDDTIKLLPTQPVVRVEGGKTQQVRFILKTEKPLITEHLKRVIFEGIPPKIPGSNKIGITIRQNLPVLIHPEGLPERKDPWTLLTWHKEGNQLKVTNPGPYVVRLAQQFVTLPSKTQFDLGRTYLLPGQHITLSSASSLTADNEVRFVPVSRYGVQVSEFIASLN
>NZ_CP048382.1|WP_063841712.1|3800808_3801789_+|IS5-like-element-ISKpn26-family-transposase
MSHQLTFADSEFSTKRRQTRKEIFLSRMELILPWQNMTAVIEPFYPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVKTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWERSQ
>NZ_CP048382.1|WP_032935863.1|3802979_3803984_-|tryptophan--tRNA-ligase
MNNKTIILTGDRPTGPLHLGHYVGSLRQRAALQHDYRQFILVADLQGLTDNGSTPQKIRDNIPEVLADYLAAGIDPSLTTICLQSALPALAELTALYMNIVTVARVERNPTVKNEIAQKGFARSLPVGFLVYPISQAADITAFKAEVVPVGDDQLPMIEQTNEIVHKMNSLLPAPVLSHCKALLSETSRLPGIDGNAKMSKSLGNTLLLSASEETIHHAVSAMYTDPNHLKVSDPGQIDGNMVFIYLDAFHPDKAKVAEMKAHYQRGGLGDRTCKNELEVCLQELIAPMRELRATYIQDKGMLMAMLKKGSEQAHEITQQTLREVKQGLGLPVF
>NZ_CP048382.1|WP_003029251.1|3804185_3805970_-|diguanylate-cyclase
MRIATITNWAYSATVCLTIASGVVMLMASSADNTERQVVEQRYQFDQLTEEVELDAWSLSDLARDYVIAKDPEVLNAYRQKEASLKAVEHRLSKLKDLGATDEELALLHEGLRIADALQDEQAEALASVARGEESQAIALLYGKAYEQELERAQDRIDHFRQLLDSRVRNTIEDATQSSRMLRTASEVMVGLTALLFLFVLGFILKRRVLRPVVRLSDVVNRLASQDYAVETPSFNQIDEIGDMAQAIRIFRENGLARQRLEKERDADWAIRDLLARMTQRLQGCENFADVINVAELFAPNIAPGIAGRLYILDREPWQMRCVAQWLSPQGKADAFHPDECWAVRRGQSHPPVQGEPDIACYHLPDSCQQHTLCVPLIAQGEAIGLLSFQNLSDDSAPSRAYLELMAEALGLALANQRLRDALLEKALYDPLTGLRNRHHLEDTLRTQMSQAVRNKEPISCLMIDIDHFKNINDRFGHEAGDSVIKSIAATIQRVVHDSGMAFRYGGEEFLVLLANTDEQAANRLATDIYNGVRELSLRFGVSEIGHVDVSIGVASYPQHAQSDNLLRAADVALYRAKELGRSRIVSFGMLEAS
>NZ_CP048382.1|WP_044712332.1|3806089_3807199_-|AI-2E-family-transporter
MRFNGLTKGFFIFILALVTWAFFDVLSPYFSAILWAAILTTIFNPVKNRLRSALGERNGLASLITIVIICLIVFIPLMVILSSLAIELNVVYTKLQQNDTQFPEVVASVLSYLPDWARGFLAEHNLDDVAQIQKKLSDVVLQGGQYLAGSAFLIGKGTFGFAISFGIMLYLLFFLLKDGPYLVRQILDSLPLSDFAKQHLFAKFVGVTRATVKGTAVVALVQGILGGIAFAIVDIDGSVLWGALMAFLSLVPAVGSAIVWVPAAIFLFATHQLWQGLFIVGFFVIIVGLVDNILRPLLVGKDTKMPDYLILITTLGGMEIYGINGFVIGPLVAALFITCWNLFSGRDHEGNVEGIDEAFMEEGKNPPDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048382_1	1.1\|3793116\|38\|NZ_CP048382\|CRISPRCasFinder	3793116-3793153	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	3	0.921

1. spacer 1.1|3793116|38|NZ_CP048382|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 3, identity: 0.921

cggacgcaagatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
*.******..****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 32512

Burkholderia_virus(51.52%)

transposase,integrase,tail,plate,capsid

attL 914:929|attR 32094:32109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648073.1\|481_1060_-\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	7.1e-65	64.2
914:929	attL	NA	NA	NA	NA
WP_162648074.1\|1052_2156_-\|plate	baseplate protein	A4JWL6	Burkholderia_virus	1.1e-109	55.1
WP_054181147.1\|2146_2494_-\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	1.0e-34	62.4
WP_162648075.1\|2549_3146_-\|plate	phage baseplate assembly protein V	A4JWL4	Burkholderia_virus	1.0e-26	44.2
WP_162648076.1\|3142_4312_-	phage late control D family protein	Q6QIA2	Burkholderia_phage	3.9e-86	49.2
WP_054181144.1\|4299_4515_-	hypothetical protein	Q6QIA3	Burkholderia_phage	7.0e-18	58.6
WP_162648077.1\|4511_5396_-\|tail	phage tail protein	A4JWL1	Burkholderia_virus	1.5e-50	47.5
WP_162648078.1\|5395_7861_-\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	2.7e-174	43.4
WP_054181141.1\|8033_8354_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_054181140.1\|8452_8734_-	hypothetical protein	NA	NA	NA	NA
WP_054181139.1\|8736_9258_-\|tail	phage major tail tube protein	A4JWK6	Burkholderia_virus	1.0e-67	69.4
WP_162648079.1\|9257_10685_-\|tail	phage tail sheath family protein	A4JWK5	Burkholderia_virus	2.8e-216	78.2
WP_162648080.1\|10674_10929_-	hypothetical protein	NA	NA	NA	NA
WP_162648081.1\|10925_11390_-	hypothetical protein	Q6QIB2	Burkholderia_phage	3.7e-40	52.3
WP_162648082.1\|11389_11836_-	DUF1320 domain-containing protein	A4JWK2	Burkholderia_virus	7.9e-32	49.7
WP_162648083.1\|11837_12194_-	DUF2190 family protein	NA	NA	NA	NA
WP_162648084.1\|12204_13158_-	hypothetical protein	A4JWK0	Burkholderia_virus	3.7e-63	42.7
WP_162648085.1\|13171_14269_-	peptidase	A4JWJ9	Burkholderia_virus	5.0e-96	49.6
WP_000135510.1\|14483_14942_-	phage virion morphogenesis protein	Q6QIB8	Burkholderia_phage	3.8e-29	43.0
WP_111763638.1\|14944_15766_-\|capsid	minor capsid protein	Q6QIB9	Burkholderia_phage	2.6e-97	61.9
WP_111763637.1\|15746_17243_-	DUF935 domain-containing protein	A4JWJ5	Burkholderia_virus	1.7e-174	61.5
WP_111763636.1\|17242_18766_-	hypothetical protein	A4JWJ4	Burkholderia_virus	5.8e-183	62.2
WP_011410682.1\|18762_19308_-	DUF3486 family protein	A4JWJ3	Burkholderia_virus	1.2e-58	67.6
WP_006122433.1\|19307_19619_-	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	3.2e-32	63.6
WP_000175096.1\|19611_19944_-	hypothetical protein	Q6QIC4	Burkholderia_phage	1.1e-17	47.7
WP_111763635.1\|19940_20594_-	hypothetical protein	J9SVN7	Pseudomonas_phage	3.4e-07	32.6
WP_111763634.1\|20583_21306_-	transglycosylase SLT domain-containing protein	Q5ZQZ1	Pseudomonas_phage	2.4e-62	59.3
WP_016191696.1\|21308_21659_-	hypothetical protein	A4JWP3	Burkholderia_virus	1.2e-22	53.9
WP_094948385.1\|22013_22613_-	DUF2441 domain-containing protein	NA	NA	NA	NA
WP_111763633.1\|22860_23631_+	DNA adenine methylase	A2I2Y7	Vibrio_virus	2.6e-99	65.3
WP_001569386.1\|23678_24212_-	hypothetical protein	NA	NA	NA	NA
WP_001569385.1\|24247_24658_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_001041677.1\|24746_24971_+	hypothetical protein	NA	NA	NA	NA
WP_000042842.1\|24967_25273_+	helix-turn-helix domain-containing protein	Q5ZR02	Pseudomonas_phage	9.2e-24	58.0
WP_006687266.1\|25282_26191_+	DUF3102 domain-containing protein	A4JWN3	Burkholderia_virus	6.3e-76	55.4
WP_089438549.1\|26194_27964_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	2.4e-228	67.8
WP_089438548.1\|27974_29141_+	AAA family ATPase	A4JWN1	Burkholderia_virus	2.2e-121	60.9
WP_000835317.1\|29143_29413_+	hypothetical protein	NA	NA	NA	NA
WP_006118595.1\|29430_30042_+	DUF3164 family protein	A0A2D1GNM4	Pseudomonas_phage	1.2e-75	68.5
WP_111763632.1\|30121_30310_+	hypothetical protein	NA	NA	NA	NA
WP_001569383.1\|30306_30603_+	hypothetical protein	NA	NA	NA	NA
WP_111763631.1\|30589_31279_+	DUF2786 domain-containing protein	A0A1W6DYA0	Aeromonas_phage	2.5e-24	33.3
WP_057060307.1\|31275_31503_+	hypothetical protein	NA	NA	NA	NA
WP_111763630.1\|31492_31708_+	hypothetical protein	NA	NA	NA	NA
WP_162648086.1\|31697_32126_+	regulatory protein GemA	A4JWM5	Burkholderia_virus	3.7e-26	49.6
32094:32109	attR	NA	NA	NA	NA
WP_001281697.1\|32122_32512_+	DNA-binding protein	Q6QIE8	Burkholderia_phage	3.8e-30	53.4

DBSCAN-SWA_2

35947 : 36721

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071698180.1\|35947_36721_-	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	2.8e-08	27.7

DBSCAN-SWA_3

41077 : 42595

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028127.1\|41077_42595_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-88	44.0

DBSCAN-SWA_4

49092 : 50229

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648089.1\|49092_50229_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	2.7e-20	26.9

DBSCAN-SWA_5

58709 : 59795

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028170.1\|58709_59795_-	chorismate synthase	A0A291AU41	Pandoravirus	5.9e-89	47.0

DBSCAN-SWA_6

68934 : 72752

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028193.1\|68934_69876_+	formate/nitrite transporter family protein	E7DYY8	Enterobacteria_phage	1.7e-148	89.3
WP_003839291.1\|70049_70679_-	hypothetical protein	NA	NA	NA	NA
WP_032936544.1\|70853_72752_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.4e-14	24.3

DBSCAN-SWA_7

80809 : 81730

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_096878701.1\|80809_81730_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	2.4e-75	53.9

DBSCAN-SWA_8

86207 : 86942

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936528.1\|86207_86942_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	1.6e-13	25.8

DBSCAN-SWA_9

111666 : 121533

Lactobacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670126.1\|111666_112593_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.6e-08	25.9
WP_003038103.1\|112682_113681_+	bile acid:sodium symporter	NA	NA	NA	NA
WP_003038102.1\|113677_113896_-	DUF3820 family protein	NA	NA	NA	NA
WP_003838570.1\|113897_115913_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.5e-149	43.4
WP_003038097.1\|115984_116992_-	cell division protein ZipA	NA	NA	NA	NA
WP_003838567.1\|117222_117984_+	sulfate transporter CysZ	NA	NA	NA	NA
WP_003038091.1\|118147_119119_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	3.3e-75	51.0
WP_003038086.1\|119502_119760_+	phosphocarrier protein Hpr	NA	NA	NA	NA
WP_003038080.1\|119805_121533_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	7.4e-17	31.1

DBSCAN-SWA_10

125443 : 134928

Streptococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838552.1\|125443_126355_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-60	43.8
WP_003038066.1\|126422_127520_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G3M9Y6	Bacillus_virus	9.4e-26	33.7
WP_003038064.1\|127509_128385_-	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
WP_003038061.1\|128384_129218_-	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
WP_003038059.1\|129218_130235_-	thiosulfate/sulfate ABC transporter substrate-binding protein CysP	NA	NA	NA	NA
WP_003038057.1\|130392_131184_-	SDR family oxidoreductase UcpA	Q06VL0	Trichoplusia_ni_ascovirus	6.8e-18	31.8
WP_003838547.1\|131356_132256_-	porphyrinogen peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
WP_046670129.1\|132349_132925_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
WP_003847269.1\|132984_133434_-	DUF2919 domain-containing protein	NA	NA	NA	NA
WP_003038048.1\|133420_133846_-	GNAT family acetyltransferase	NA	NA	NA	NA
WP_003038046.1\|134058_134928_+	N-acetylmuramoyl-L-alanine amidase AmiA	A0A0N9SGH1	Paenibacillus_phage	1.5e-18	33.3

DBSCAN-SWA_11

170808 : 171522

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670138.1\|170808_171522_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HWF9	Synechococcus_phage	9.1e-38	35.7

DBSCAN-SWA_12

181368 : 186967

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049002454.1\|181368_182658_-	uracil permease	Q9KX94	Enterobacteria_phage	1.7e-63	36.7
WP_003037929.1\|182754_183381_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_061548989.1\|183564_184995_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
WP_003838485.1\|185291_186329_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	6.3e-72	42.4
WP_003838482.1\|186325_186967_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	4.5e-28	40.6

DBSCAN-SWA_13

193394 : 199574

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049002457.1\|193394_193598_+	DUF2633 family protein	G9L6F2	Escherichia_phage	5.6e-17	71.4
WP_003838477.1\|193962_194841_+	small-conductance mechanosensitive channel MscS	NA	NA	NA	NA
WP_003037760.1\|194938_196516_-	glutamine-hydrolyzing GMP synthase	NA	NA	NA	NA
WP_003037756.1\|196579_198046_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.7e-87	38.5
WP_046670144.1\|198206_199574_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	3.4e-41	35.0

DBSCAN-SWA_14

210878 : 212420

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037736.1\|210878_212420_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.4e-160	57.6

DBSCAN-SWA_15

221397 : 221829

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037710.1\|221397_221829_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	5.3e-17	37.1

DBSCAN-SWA_16

231673 : 238028

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037696.1\|231673_232957_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	9.9e-35	35.4
WP_003037694.1\|233018_233219_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_003037690.1\|233230_233566_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_003838439.1\|233567_235418_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-103	41.9
WP_003037683.1\|235433_235949_-	co-chaperone HscB	NA	NA	NA	NA
WP_003037681.1\|236057_236381_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	9.2e-22	47.7
WP_002913991.1\|236401_236788_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	2.7e-52	77.3
WP_003838433.1\|236813_238028_-	cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6

DBSCAN-SWA_17

243648 : 245157

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048217267.1\|243648_245157_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-15	26.4

DBSCAN-SWA_18

264449 : 275775

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037627.1\|264449_265703_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.9e-100	53.4
WP_016150774.1\|266029_267220_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_002914032.1\|267321_267660_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
WP_003838398.1\|267720_269058_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	1.4e-10	34.1
WP_003847079.1\|269054_269798_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
WP_003847077.1\|269820_271251_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	2.0e-12	25.6
WP_071698715.1\|271887_275775_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	3.8e-130	59.0

DBSCAN-SWA_19

282076 : 282337

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037590.1\|282076_282337_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.7e-18	54.7

DBSCAN-SWA_20

285353 : 289093

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037579.1\|285353_286034_-	ribonuclease III	A0A2K9L5P0	Tupanvirus	1.6e-20	31.8
WP_003838377.1\|286303_287278_-	signal peptidase I	NA	NA	NA	NA
WP_003037577.1\|287293_289093_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	3.8e-24	25.1

DBSCAN-SWA_21

294069 : 389476

Salmonella_phage(72.92%)

terminase,transposase,integrase,tail,plate,portal,tRNA,head,capsid,lysis

attL 353924:353969|attR 390670:390715

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847060.1\|294069_294807_-\|tRNA	tRNA(1)(Val) (adenine(37)-N(6))-methyltransferase TrmN	NA	NA	NA	NA
WP_003037569.1\|294937_296266_+	ATP-dependent RNA helicase SrmB	E3T5E1	Cafeteria_roenbergensis_virus	2.5e-41	29.1
WP_003037563.1\|297381_297765_-	autonomous glycyl radical cofactor GrcA	A0A1W5N098	Cronobacter_phage	3.6e-33	70.9
WP_096890244.1\|298082_298772_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	4.6e-55	48.8
WP_003037560.1\|298805_299885_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
WP_003037559.1\|300092_300512_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	8.3e-15	36.5
WP_003847051.1\|300581_301280_+	DTW domain-containing protein	NA	NA	NA	NA
WP_054528661.1\|301316_303977_+	protein lysine acetyltransferase	NA	NA	NA	NA
WP_008319601.1\|304091_305447_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_003838356.1\|305491_305815_+	YfiM family lipoprotein	NA	NA	NA	NA
WP_016150786.1\|305811_307110_-	MFS transporter	Q6JIH2	Burkholderia_virus	3.1e-44	30.6
WP_003845841.1\|312944_315518_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	1.5e-127	35.2
WP_044699543.1\|315647_316379_-	polyphenol oxidase	NA	NA	NA	NA
WP_003031246.1\|316375_317356_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_003031245.1\|317487_318225_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_003031244.1\|318494_318833_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_100250063.1\|318936_318984_+	hypothetical protein	NA	NA	NA	NA
WP_162648102.1\|319083_320244_+	bifunctional chorismate mutase/prephenate dehydratase	NA	NA	NA	NA
WP_003826456.1\|320340_321462_-	bifunctional chorismate mutase/prephenate dehydrogenase	NA	NA	NA	NA
WP_003031241.1\|321472_322543_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	50.9
WP_003845849.1\|322757_323132_+	DUF2799 domain-containing protein	NA	NA	NA	NA
WP_162648103.1\|323290_323809_+	YfiR family protein	NA	NA	NA	NA
WP_003839838.1\|323801_325028_+	diguanylate cyclase DgcN	A0A2K8I9Y5	Pseudomonas_phage	1.1e-06	37.6
WP_003031234.1\|325040_325523_+	OmpA family protein	NA	NA	NA	NA
WP_002914145.1\|325654_326002_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_003031232.1\|326041_326809_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_003031230.1\|326853_327402_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_003031228.1\|327420_327669_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_003031226.1\|327922_329284_-	signal recognition particle protein	NA	NA	NA	NA
WP_003031224.1\|329449_330241_+	inner membrane protein YpjD	NA	NA	NA	NA
WP_008324538.1\|330259_331549_+	HlyC/CorC family transporter	NA	NA	NA	NA
WP_003031221.1\|331598_332192_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_003031220.1\|332314_333193_+	NAD(+) kinase	NA	NA	NA	NA
WP_162648104.1\|333278_334940_+	DNA repair protein RecN	NA	NA	NA	NA
WP_003826401.1\|335089_335434_+	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_003839823.1\|335484_335781_-	RnfH family protein	NA	NA	NA	NA
WP_071524313.1\|335764_336220_-	type II toxin-antitoxin system toxin RatA	NA	NA	NA	NA
WP_003031211.1\|336362_336845_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	1.2e-28	46.8
WP_162648105.1\|337427_348668_+	BapA prefix-like domain-containing protein	NA	NA	NA	NA
WP_003845860.1\|348768_350178_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_162648106.1\|350174_352361_+	type I secretion system permease/ATPase	F2Y302	Organic_Lake_phycodnavirus	3.2e-17	29.4
WP_085951585.1\|352368_353532_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
353924:353969	attL	NA	NA	NA	NA
WP_162648107.1\|354143_354860_+	hypothetical protein	NA	NA	NA	NA
WP_162648108.1\|354938_355154_-	late control protein B	Q53ZE7	Salmonella_virus	2.1e-22	70.8
WP_162648109.1\|355222_356323_-	phage late control D family protein	E5G6Q3	Salmonella_phage	6.7e-189	94.3
WP_162648110.1\|356319_356805_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	2.7e-70	92.5
WP_162648111.1\|356801_359867_-\|tail	phage tail tape measure protein	A0A1S6L010	Salmonella_phage	0.0e+00	84.4
WP_162648112.1\|359859_359979_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	3.3e-14	94.9
WP_162648113.1\|359993_360296_-\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	3.6e-44	97.0
WP_001397630.1\|360350_360866_-\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	1.3e-89	96.5
WP_162648114.1\|360875_362048_-\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	1.5e-207	92.8
WP_162648115.1\|362156_362720_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.4e-86	84.9
WP_162648116.1\|362772_363864_+	hypothetical protein	NA	NA	NA	NA
WP_162648117.1\|364238_364667_+\|tail	tail fiber assembly protein	A0A0M4S6V4	Salmonella_phage	2.6e-24	71.1
WP_162648118.1\|364638_364989_-\|tail	tail fiber assembly protein	A0A0M4QWM3	Salmonella_phage	4.3e-09	57.6
WP_162648119.1\|366313_366919_-\|tail	phage tail protein I	E5G6N9	Salmonella_phage	1.2e-112	96.0
WP_016150802.1\|366911_367820_-\|plate	baseplate assembly protein	E5G6N8	Salmonella_phage	5.0e-150	94.4
WP_016150803.1\|367806_368166_-	hypothetical protein	E5G6N7	Salmonella_phage	2.3e-58	95.8
WP_162648120.1\|368162_368741_-\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	1.2e-93	85.9
WP_162648121.1\|368835_369402_+	hypothetical protein	NA	NA	NA	NA
WP_063841712.1\|369502_370483_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_162648122.1\|370932_371379_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	1.7e-63	85.0
WP_001039964.1\|371371_371803_-\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	4.0e-73	95.1
WP_001648763.1\|371898_372327_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	2.6e-64	95.0
WP_000871620.1\|372323_372698_-	hypothetical protein	NA	NA	NA	NA
WP_162648123.1\|372702_373212_-	lysozyme	A0A1S6KZY9	Salmonella_phage	1.3e-91	96.4
WP_000171565.1\|373192_373408_-	hypothetical protein	E5G6N0	Salmonella_phage	5.9e-33	100.0
WP_000868184.1\|373411_373615_-\|tail	tail protein X	E5G6M9	Salmonella_phage	3.8e-34	100.0
WP_076009148.1\|373614_374079_-\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	3.9e-82	95.5
WP_000059169.1\|374172_374823_-	hypothetical protein	A0A1S6KZX1	Salmonella_phage	1.6e-113	98.6
WP_162648124.1\|374826_375894_-\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	8.1e-192	97.7
WP_162648125.1\|375910_376744_-\|capsid	GPO family capsid scaffolding protein	E5G6M5	Salmonella_phage	4.3e-124	86.3
WP_001098459.1\|376886_378653_+\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	96.8
WP_162648126.1\|378652_379684_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	8.7e-183	91.0
WP_162648127.1\|379701_380664_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_162648128.1\|380826_381750_-	hypothetical protein	NA	NA	NA	NA
WP_001749760.1\|382051_382240_-	hypothetical protein	E5G6M0	Salmonella_phage	5.7e-24	91.7
WP_162648129.1\|382377_382605_+	hypothetical protein	NA	NA	NA	NA
WP_162648130.1\|382624_385033_-	replication endonuclease	A0A1S6L028	Salmonella_phage	0.0e+00	94.5
WP_162648131.1\|385026_385881_-	DNA adenine methylase	A0A1S6L011	Salmonella_phage	1.6e-129	80.6
WP_001244238.1\|386103_386337_-	DUF2732 family protein	A0A1S6L021	Salmonella_phage	2.9e-33	98.7
WP_060855046.1\|386404_386746_-	DUF5347 domain-containing protein	A0A1S6L019	Salmonella_phage	4.6e-56	99.1
WP_162648132.1\|386709_386910_-	DUF2724 domain-containing protein	A0A1S6L005	Salmonella_phage	2.7e-32	97.0
WP_162648133.1\|386917_387427_-	phage regulatory CII family protein	A0A1S6L008	Salmonella_phage	6.2e-89	98.8
WP_000102106.1\|387459_387702_-	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	2.3e-38	98.8
WP_162648134.1\|387821_388454_+	phage repressor protein	A0A1S6KZZ7	Salmonella_phage	6.3e-67	60.0
WP_162648135.1\|388456_389476_+\|integrase	site-specific integrase	A0A1S6L016	Salmonella_phage	1.3e-191	94.7
390670:390715	attR	NA	NA	NA	NA

DBSCAN-SWA_22

393193 : 393865

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648138.1\|393193_393865_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	4.5e-79	58.6

DBSCAN-SWA_23

400106 : 404462

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648141.1\|400106_404462_+	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.4e-149	38.9

DBSCAN-SWA_24

410507 : 416331

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839789.1\|410507_412055_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.6e-09	25.2
WP_162648143.1\|412106_413036_-	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003845960.1\|413074_414061_-	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_137348052.1\|414405_416331_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	E5EQ70	Micromonas_sp._RCC1109_virus	1.6e-25	23.1

DBSCAN-SWA_25

426526 : 429769

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648147.1\|426526_429769_-	transporter substrate-binding domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-33	30.3

DBSCAN-SWA_26

441130 : 446351

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670409.1\|441130_442147_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	7.2e-81	46.5
WP_046670408.1\|442193_443585_-	DUF4832 domain-containing protein	NA	NA	NA	NA
WP_046670407.1\|443615_444023_-	hypothetical protein	NA	NA	NA	NA
WP_142710184.1\|444025_445138_-	glycosyltransferase	NA	NA	NA	NA
WP_044699634.1\|445139_446351_-	glycosyltransferase family 4 protein	A0A2P0VNG4	Tetraselmis_virus	1.3e-12	31.6

DBSCAN-SWA_27

473721 : 474702

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|473721_474702_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_28

478792 : 482813

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648151.1\|478792_480076_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-28	28.6
WP_003839698.1\|480218_481619_+	GABA permease	NA	NA	NA	NA
WP_003037236.1\|481664_482351_+	DNA-binding transcriptional regulator CsiR	NA	NA	NA	NA
WP_003037241.1\|482363_482813_-	peptidoglycan-binding protein LysM	A0A1V0DZX0	Clostridioides_phage	3.7e-05	38.2

DBSCAN-SWA_29

488574 : 493871

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037270.1\|488574_488820_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.8e-12	42.5
WP_003037273.1\|488816_489227_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.6e-17	41.0
WP_048217215.1\|489199_491344_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	6.9e-198	49.0
WP_016150870.1\|491354_492314_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	5.0e-132	71.5
WP_003037282.1\|492668_493871_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	1.9e-27	38.1

DBSCAN-SWA_30

504051 : 505032

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|504051_505032_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_31

509572 : 514993

Vibrio_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000906486.1\|509572_509758_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
WP_016150875.1\|509995_512623_-\|tRNA	alanine--tRNA ligase	A0A2K9L1X7	Tupanvirus	8.4e-81	38.8
WP_003037326.1\|512751_513252_-	recombination regulator RecX	NA	NA	NA	NA
WP_003037330.1\|513338_514403_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	4.0e-114	63.8
WP_016150876.1\|514495_514993_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	3.4e-31	51.0

DBSCAN-SWA_32

520553 : 521519

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003037353.1\|520553_521519_+	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	1.8e-36	33.9

DBSCAN-SWA_33

557345 : 563683

Pithovirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840297.1\|557345_558161_+	iron/manganese ABC transporter ATP-binding protein SitB	W5SAS9	Pithovirus	1.2e-12	28.1
WP_016150894.1\|558163_559021_+	iron/manganese ABC transporter permease subunit SitC	NA	NA	NA	NA
WP_016150895.1\|559017_559869_+	iron/manganese ABC transporter permease subunit SitD	NA	NA	NA	NA
WP_003037438.1\|560614_560965_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_008322725.1\|560961_561291_+	multidrug efflux SMR transporter	E5EPE2	Acinetobacter_phage	4.2e-06	33.0
WP_003840305.1\|561304_563683_+\|holin	choline trimethylamine-lyase	A0A2C9CWX5	Yersinia_phage	8.1e-06	37.5

DBSCAN-SWA_34

572258 : 574820

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150901.1\|572258_574820_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	4.1e-32	20.9

DBSCAN-SWA_35

578296 : 582000

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000081498.1\|578296_579289_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6
WP_003034174.1\|579351_580479_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	1.4e-05	35.4
WP_003034172.1\|580618_581245_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.4e-36	50.6
WP_003825728.1\|581238_582000_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.5e-57	46.7

DBSCAN-SWA_36

585173 : 587206

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034157.1\|585173_585779_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	6.1e-27	37.9
WP_044713391.1\|585778_587206_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	7.9e-33	25.8

DBSCAN-SWA_37

594548 : 595220

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034139.1\|594548_595220_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	3.9e-14	24.6

DBSCAN-SWA_38

598582 : 601606

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034129.1\|598582_599881_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	1.4e-129	57.9
WP_003034127.1\|599968_601606_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.7e-153	50.6

DBSCAN-SWA_39

605080 : 613162

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846544.1\|605080_606379_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	5.3e-36	27.9
WP_003840349.1\|606436_609193_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.0e-52	29.5
WP_003034114.1\|609236_610379_-	glycerate kinase	W6LM47	Streptococcus_phage	4.8e-49	40.7
WP_003840351.1\|610460_611801_-	glucarate dehydratase	NA	NA	NA	NA
WP_032941178.1\|611821_613162_-	glucarate dehydratase	Q6A202	Oenococcus_phage	1.2e-06	23.9

DBSCAN-SWA_40

617687 : 618536

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034084.1\|617687_618536_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	1.8e-40	37.3

DBSCAN-SWA_41

623451 : 624207

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840372.1\|623451_624207_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	8.8e-07	28.7

DBSCAN-SWA_42

630958 : 632458

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034052.1\|630958_632458_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-20	31.6

DBSCAN-SWA_43

640692 : 643228

environmental_halophage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086529894.1\|640692_641898_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	7.3e-72	36.2
WP_003840390.1\|641897_642344_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
WP_003846496.1\|642421_643228_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.2e-16	32.8

DBSCAN-SWA_44

651825 : 666043

Escherichia_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|651825_652806_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_003840934.1\|653285_653843_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_003840935.1\|653904_654507_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_003840937.1\|654847_656101_-	N-acetylmuramoyl-L-alanine amidase AmiC	E5DV68	Deep-sea_thermophilic_phage	2.7e-13	28.4
WP_003034012.1\|656334_657666_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
WP_003034009.1\|657790_659620_-	exodeoxyribonuclease V subunit alpha	A0A1P8DII4	Virus_Rctr197k	1.9e-18	34.4
WP_162648164.1\|659616_663162_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	2.0e-08	20.1
WP_048218530.1\|663154_666043_-	pitrilysin	A0A1V0SJA4	Klosneuvirus	2.6e-67	24.9

DBSCAN-SWA_45

671523 : 678347

Cronobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033990.1\|671523_672318_-	thymidylate synthase	R4IFY1	Cronobacter_phage	1.9e-116	62.0
WP_003033987.1\|672324_673200_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_003033984.1\|673388_675635_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	5.1e-10	24.6
WP_003033982.1\|675647_676178_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_003840955.1\|676862_677558_+	DNA mismatch repair endonuclease MutH	NA	NA	NA	NA
WP_003033961.1\|677633_678347_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.3e-46	47.3

DBSCAN-SWA_46

684924 : 685935

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054528747.1\|684924_685935_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.5e-33	30.4

DBSCAN-SWA_47

689696 : 693135

Sodalis_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033929.1\|689696_690584_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	1.4e-67	45.8
WP_003840970.1\|690639_692058_-	arabinose-proton symporter AraE	O13311	Aichi_virus	5.1e-24	26.7
WP_046670332.1\|692373_693135_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-19	32.1

DBSCAN-SWA_48

707869 : 708475

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033877.1\|707869_708475_-	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	3.2e-07	26.9

DBSCAN-SWA_49

718301 : 725948

Microcystis_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150941.1\|718301_719060_-	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	3.2e-09	37.3
WP_162648170.1\|719226_719781_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_003026911.1\|719858_721376_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.3e-86	36.9
WP_096878465.1\|721385_722484_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	1.8e-05	39.0
WP_054528765.1\|722575_724309_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-61	28.5
WP_003825520.1\|724314_725028_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
WP_003026928.1\|725051_725948_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.5e-29	27.9

DBSCAN-SWA_50

730647 : 735854

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648171.1\|730647_732081_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	3.1e-29	25.9
WP_032937431.1\|732175_732919_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_044713822.1\|732980_735854_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	3.4e-261	51.0

DBSCAN-SWA_51

744110 : 745343

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003026984.1\|744110_745343_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	4.1e-102	47.6

DBSCAN-SWA_52

762853 : 763537

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670308.1\|762853_763537_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.6e-10	24.5

DBSCAN-SWA_53

776307 : 779256

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027071.1\|776307_777462_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.3e-128	63.2
WP_003027074.1\|777861_779256_+	galactose/proton symporter	O13311	Aichi_virus	1.4e-26	25.5

DBSCAN-SWA_54

792541 : 793627

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049001609.1\|792541_793627_+	membrane-bound lytic murein transglycosylase MltC	A0A0H3V0Q1	Geobacillus_virus	4.5e-12	39.0

DBSCAN-SWA_55

811355 : 812996

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670294.1\|811355_812996_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-11	54.7

DBSCAN-SWA_56

822695 : 827940

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024520.1\|822695_823523_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.1e-63	46.0
WP_162648176.1\|823711_825166_+	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_003024529.1\|825209_825665_+	HIT family protein	Q5YEY9	Rock_bream_iridovirus	2.1e-19	34.7
WP_003024532.1\|825768_827940_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	1.3e-103	70.4

DBSCAN-SWA_57

832048 : 834824

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024543.1\|832048_834307_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.4e-86	35.5
WP_003024544.1\|834425_834824_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	9.9e-18	43.9

DBSCAN-SWA_58

843458 : 851555

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024571.1\|843458_845351_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	2.0e-92	34.8
WP_003024575.1\|845379_845961_-	esterase YqiA	NA	NA	NA	NA
WP_003838143.1\|845960_846788_-	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
WP_003024582.1\|846812_847235_-	DUF1249 family protein	NA	NA	NA	NA
WP_003024585.1\|847231_847864_-	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.2e-20	34.7
WP_032937374.1\|848069_849554_+	outer membrane channel protein TolC	NA	NA	NA	NA
WP_003024591.1\|849711_850389_+	DUF1190 family protein	A0A173GEW8	Erwinia_phage	2.6e-34	45.0
WP_032937372.1\|850394_851555_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	6.5e-86	42.9

DBSCAN-SWA_59

857247 : 857901

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838130.1\|857247_857901_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.1e-45	44.3

DBSCAN-SWA_60

861498 : 862932

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838125.1\|861498_862932_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	2.2e-38	28.8

DBSCAN-SWA_61

868182 : 869424

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150993.1\|868182_869424_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.8e-94	49.3

DBSCAN-SWA_62

880816 : 886356

Moraxella_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648178.1\|880816_881830_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.7e-110	59.8
WP_001144069.1\|882066_882282_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_162648179.1\|882519_884265_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-76	38.8
WP_003024699.1\|884508_886356_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7

DBSCAN-SWA_63

893840 : 898264

Erwinia_phage(66.67%)

transposase,integrase

attL 892741:892788|attR 898560:898607

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
892741:892788	attL	NA	NA	NA	NA
WP_162648180.1\|893840_894422_+	phage repressor protein	F1BUS8	Erwinia_phage	1.6e-29	37.6
WP_162648181.1\|894423_895458_+\|integrase	tyrosine-type recombinase/integrase	F1BUS9	Erwinia_phage	6.6e-122	64.4
WP_162648182.1\|895457_897245_+	hypothetical protein	NA	NA	NA	NA
WP_063841712.1\|897283_898264_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
898560:898607	attR	NA	NA	NA	NA

DBSCAN-SWA_64

912086 : 924133

Tupanvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846231.1\|912086_913241_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.6e-84	45.8
WP_003024755.1\|913308_914157_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016151014.1\|914153_914936_-	siderophore-interacting protein	NA	NA	NA	NA
WP_161799266.1\|915172_915850_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_003024763.1\|915903_917424_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	2.9e-33	49.3
WP_048998748.1\|917791_919234_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.7e-33	28.7
WP_003024768.1\|919307_919640_-\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_003024771.1\|919849_920833_+	transcriptional regulator EbgR	NA	NA	NA	NA
WP_048232833.1\|921040_924133_+	beta-galactosidase subunit alpha	L0N6M2	Herpes_simplex_virus	7.7e-158	34.0

DBSCAN-SWA_65

935154 : 936123

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003828551.1\|935154_936123_+	TerC family protein	A0A291LBC5	Escherichia_phage	3.5e-32	31.8

DBSCAN-SWA_66

956646 : 958941

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024871.1\|956646_958941_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	5.3e-156	40.4

DBSCAN-SWA_67

965183 : 966329

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670227.1\|965183_966329_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	1.2e-47	39.9

DBSCAN-SWA_68

974895 : 976002

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069219469.1\|974895_976002_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	W8CYL7	Bacillus_phage	9.2e-13	29.6

DBSCAN-SWA_69

987855 : 993944

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024942.1\|987855_988719_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	5.6e-50	43.6
WP_046670219.1\|988782_990834_+	penicillin-binding protein activator	NA	NA	NA	NA
WP_003024946.1\|990791_991187_+	YraN family protein	NA	NA	NA	NA
WP_003024948.1\|991221_991812_+	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	3.2e-12	31.8
WP_044701311.1\|991821_992397_+	divisome-associated lipoprotein YraP	NA	NA	NA	NA
WP_003024957.1\|992490_993126_-	NAD(P)H-binding protein	NA	NA	NA	NA
WP_044714511.1\|993163_993592_-	YhbP family protein	NA	NA	NA	NA
WP_003844855.1\|993644_993944_+	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	4.2e-13	53.2

DBSCAN-SWA_70

999610 : 1001539

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048218712.1\|999610_1001539_-	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	30.8

DBSCAN-SWA_71

1007129 : 1013774

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844847.1\|1007129_1009820_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	2.5e-24	26.4
WP_003024992.1\|1009844_1011332_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003024996.1\|1011360_1011813_-	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003024998.1\|1012430_1013774_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	4.8e-64	93.7

DBSCAN-SWA_72

1019579 : 1022461

Pandoravirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025010.1\|1019579_1020428_-	dihydropteroate synthase	S4VNV0	Pandoravirus	1.3e-19	31.2
WP_003025013.1\|1020526_1022461_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	4.1e-117	43.6

DBSCAN-SWA_73

1029141 : 1030620

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025033.1\|1029141_1030113_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	1.6e-08	26.2
WP_003839952.1\|1030335_1030620_+	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	6.0e-17	65.7

DBSCAN-SWA_74

1034724 : 1048851

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025057.1\|1034724_1035525_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	9.6e-20	30.6
WP_003839941.1\|1035740_1036718_+	calcium/sodium antiporter	NA	NA	NA	NA
WP_003025063.1\|1036731_1037718_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.9e-38	31.5
WP_003025065.1\|1037738_1038305_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	4.2e-54	76.3
WP_003025068.1\|1038301_1038877_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_003025070.1\|1038845_1039394_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
WP_003025073.1\|1039400_1040126_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.2e-22	28.4
WP_003025074.1\|1040172_1041606_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_003025078.1\|1041628_1041916_+	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	4.2e-10	43.2
WP_003025083.1\|1041999_1042491_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_003025085.1\|1042536_1043391_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
WP_003025086.1\|1043387_1043660_+	PTS phosphocarrier protein NPr	NA	NA	NA	NA
WP_003839927.1\|1043790_1044510_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_003839926.1\|1044506_1045160_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_003025089.1\|1045389_1047726_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	4.9e-40	30.8
WP_003025090.1\|1047921_1048851_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	6.7e-17	32.8

DBSCAN-SWA_75

1055626 : 1056709

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648197.1\|1055626_1056709_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	9.8e-76	90.7

DBSCAN-SWA_76

1060871 : 1062362

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025119.1\|1060871_1062362_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.4e-08	23.9

DBSCAN-SWA_77

1066200 : 1066704

Pseudomonas_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025130.1\|1066200_1066704_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	7.3e-26	54.8

DBSCAN-SWA_78

1070606 : 1071974

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648199.1\|1070606_1071974_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.6e-20	25.4

DBSCAN-SWA_79

1089617 : 1090661

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000913396.1\|1089617_1090661_-	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3

DBSCAN-SWA_80

1103317 : 1104202

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670188.1\|1103317_1104202_+	adenine-specific DNA-methyltransferase	M4QNN5	Ostreococcus_lucimarinus_virus	2.8e-28	32.8

DBSCAN-SWA_81

1110808 : 1114964

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025295.1\|1110808_1111834_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	9.0e-71	39.5
WP_046670184.1\|1111903_1113085_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003025299.1\|1113094_1114198_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003025300.1\|1114205_1114964_+	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.1e-20	31.7

DBSCAN-SWA_82

1125415 : 1126887

Synechococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031159.1\|1125415_1125925_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.6e-18	40.3
WP_162648204.1\|1125939_1126887_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-08	39.8

DBSCAN-SWA_83

1146786 : 1152358

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031109.1\|1146786_1147971_-	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003023659.1\|1148040_1150155_-	elongation factor G	E4ZFJ7	Streptococcus_phage	6.2e-58	27.1
WP_003023657.1\|1150251_1150722_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003023654.1\|1150817_1151192_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_162648205.1\|1151317_1151605_-	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	3.1e-05	39.2
WP_003837966.1\|1151612_1151972_-	sulfurtransferase complex subunit TusC	NA	NA	NA	NA
WP_003023646.1\|1151971_1152358_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.7e-19	40.6

DBSCAN-SWA_84

1158114 : 1163402

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023627.1\|1158114_1160016_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.5e-74	33.9
WP_162648206.1\|1160125_1161616_-	nicotinate phosphoribosyltransferase	A0A218KC49	Bacillus_phage	2.2e-142	52.2
WP_003023622.1\|1161630_1162491_-	ribose-phosphate pyrophosphokinase	G0X553	Salmonella_phage	5.6e-50	40.6
WP_162648207.1\|1162682_1163402_+	NUDIX hydrolase	G3MA14	Bacillus_virus	9.5e-19	27.5

DBSCAN-SWA_85

1167137 : 1171187

environmental_Halophage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648813.1\|1167137_1169225_+	hypothetical protein	H9YQA8	environmental_Halophage	4.2e-67	89.9
WP_136397263.1\|1169320_1170538_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	5.7e-32	28.2
WP_003847954.1\|1170623_1171187_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	6.0e-61	56.5

DBSCAN-SWA_86

1190192 : 1191029

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023558.1\|1190192_1191029_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	8.4e-67	49.1

DBSCAN-SWA_87

1207921 : 1212464

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023529.1\|1207921_1209544_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	8.1e-143	52.5
WP_003847996.1\|1209666_1209984_+	hypothetical protein	NA	NA	NA	NA
WP_003837894.1\|1210036_1210333_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003837891.1\|1210389_1211742_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	4.3e-12	23.6
WP_135953044.1\|1211738_1212464_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	3.5e-29	34.7

DBSCAN-SWA_88

1218971 : 1219934

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671280.1\|1218971_1219934_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	7.6e-72	56.8

DBSCAN-SWA_89

1225930 : 1228324

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648213.1\|1225930_1228324_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	7.3e-15	41.4

DBSCAN-SWA_90

1235668 : 1238116

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023492.1\|1235668_1238116_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	3.6e-33	82.1

DBSCAN-SWA_91

1262319 : 1264130

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648215.1\|1262319_1263063_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	6.4e-10	25.3
WP_003837845.1\|1263059_1264130_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	4.4e-20	32.0

DBSCAN-SWA_92

1267909 : 1269408

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003827581.1\|1267909_1268623_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	3.7e-15	30.1
WP_003023438.1\|1268640_1269408_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	W6JKT0	Anomala_cuprea_entomopoxvirus	3.7e-13	25.1

DBSCAN-SWA_93

1275151 : 1277981

Salicola_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003023425.1\|1275151_1276006_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	7.0e-45	41.9
WP_003023423.1\|1276261_1277320_-	cell division protein FtsX	NA	NA	NA	NA
WP_003023420.1\|1277312_1277981_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	27.6

DBSCAN-SWA_94

1283319 : 1287392

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151123.1\|1283319_1283946_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.3e-29	60.2
WP_134214918.1\|1284020_1286219_+	Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA	E4ZFI9	Streptococcus_phage	8.0e-117	37.6
WP_003023404.1\|1286312_1286558_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	4.7e-10	83.3
WP_003837818.1\|1286726_1287392_+	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	3.3e-58	54.9

DBSCAN-SWA_95

1291986 : 1296211

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671263.1\|1291986_1292262_-	type II toxin-antitoxin system HicA family toxin	R4JMD3	Burkholderia_phage	3.2e-15	47.6
WP_061547457.1\|1292339_1293464_-	ABC transporter permease	NA	NA	NA	NA
WP_162648218.1\|1293463_1296211_-	ribosome-associated ATPase/putative transporter RbbA	W6JKT0	Anomala_cuprea_entomopoxvirus	8.7e-20	32.6

DBSCAN-SWA_96

1307846 : 1309889

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670978.1\|1307846_1309889_-	oligopeptidase A	A0A1V0SD92	Indivirus	8.9e-46	23.3

DBSCAN-SWA_97

1341668 : 1343653

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846120.1\|1341668_1342673_-	dipeptide ABC transporter ATP binding subunit DppF	G3M9Y6	Bacillus_virus	1.1e-17	29.9
WP_003846117.1\|1342669_1343653_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-14	31.2

DBSCAN-SWA_98

1350907 : 1351888

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|1350907_1351888_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_99

1355155 : 1357489

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_106107703.1\|1355155_1357489_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	1.2e-73	30.7

DBSCAN-SWA_100

1362899 : 1365806

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151146.1\|1362899_1363874_+	glyoxylate/hydroxypyruvate reductase GhrB	M1HST2	Paramecium_bursaria_Chlorella_virus	6.4e-18	27.0
WP_162648222.1\|1363932_1364643_-	DUF3053 domain-containing protein	NA	NA	NA	NA
WP_003024273.1\|1365023_1365314_+	HTH-type transcriptional regulator	NA	NA	NA	NA
WP_000014594.1\|1365593_1365806_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	2.7e-22	72.9

DBSCAN-SWA_101

1370164 : 1371160

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671082.1\|1370164_1371160_+	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	3.5e-11	24.8

DBSCAN-SWA_102

1396762 : 1397851

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844556.1\|1396762_1397851_+	hypothetical protein	A0A1S5SAB0	Streptococcus_phage	9.8e-68	43.0

DBSCAN-SWA_103

1400863 : 1402708

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937191.1\|1400863_1402708_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	5.3e-13	25.5

DBSCAN-SWA_104

1420106 : 1429478

Rhizobium_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844542.1\|1420106_1420358_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.2e-15	53.4
WP_003024148.1\|1420410_1420842_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_046671018.1\|1421091_1422636_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_003837638.1\|1422645_1423929_+	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	1.8e-07	34.3
WP_003024138.1\|1423932_1424868_+	divergent polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_003024135.1\|1424868_1425906_-	glycosyltransferase	NA	NA	NA	NA
WP_003024132.1\|1426098_1427124_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8
WP_003024131.1\|1427133_1428330_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	9.2e-35	29.1
WP_003827312.1\|1428545_1429478_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.0e-36	37.1

DBSCAN-SWA_105

1441483 : 1446046

uncultured_Mediterranean_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024099.1\|1441483_1441963_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.3e-27	43.2
WP_003024097.1\|1442001_1442811_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	3.1e-26	31.6
WP_003024094.1\|1442909_1443077_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_003024071.1\|1443097_1443334_-	50S ribosomal protein L28	NA	NA	NA	NA
WP_003837605.1\|1443552_1444218_-	JAB domain-containing protein	NA	NA	NA	NA
WP_086538736.1\|1444389_1445610_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.2e-43	34.8
WP_006687626.1\|1445587_1446046_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.6e-48	60.1

DBSCAN-SWA_106

1450127 : 1455155

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048217415.1\|1450127_1451807_-	NAD-dependent DNA ligase LigB	F8SJM3	Pseudomonas_phage	7.1e-25	22.5
WP_003024042.1\|1452068_1452692_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	2.2e-19	35.6
WP_000135058.1\|1452746_1453022_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003024038.1\|1453040_1455155_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5

DBSCAN-SWA_107

1459415 : 1460807

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003024026.1\|1459415_1460807_+	xanthine/proton symporter XanP	H9YQ34	environmental_Halophage	2.5e-68	95.9

DBSCAN-SWA_108

1473260 : 1474289

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648227.1\|1473260_1474289_+	virulence RhuM family protein	Q9JMN3	Wolbachia_phage	6.4e-77	45.8

DBSCAN-SWA_109

1480210 : 1483021

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648231.1\|1480210_1483021_-	intestinal colonization autotransporter adhesin MisL	A0A2L1IV18	Escherichia_phage	9.3e-102	49.0

DBSCAN-SWA_110

1491713 : 1492628

Sodalis_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_119174668.1\|1491713_1492628_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	3.4e-69	47.2

DBSCAN-SWA_111

1515155 : 1519996

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840646.1\|1515155_1516844_-	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.9e-58	30.4
WP_003827118.1\|1516951_1517050_-	ilvB operon leader peptide IvbL	NA	NA	NA	NA
WP_003840643.1\|1517571_1517661_+	type I toxin-antitoxin system toxin TisB	NA	NA	NA	NA
WP_003840641.1\|1517784_1518618_+	EamA family transporter	NA	NA	NA	NA
WP_003023905.1\|1518811_1519996_+	multidrug efflux MFS transporter EmrD	S4TR35	Salmonella_phage	5.0e-17	25.1

DBSCAN-SWA_112

1528128 : 1529063

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840609.1\|1528128_1528557_-	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	2.7e-13	36.4
WP_003023882.1\|1528649_1529063_-	heat shock chaperone IbpA	A0A1D8KSJ6	Synechococcus_phage	4.6e-18	35.2

DBSCAN-SWA_113

1533169 : 1540678

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844435.1\|1533169_1535584_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.4e-114	34.1
WP_048217029.1\|1535612_1536686_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003023863.1\|1536824_1537925_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.1e-53	35.0
WP_003023861.1\|1537929_1539333_-	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
WP_003023858.1\|1539939_1540080_+	50S ribosomal protein L34	NA	NA	NA	NA
WP_003844432.1\|1540097_1540457_+	ribonuclease P protein component	NA	NA	NA	NA
WP_003023846.1\|1540420_1540678_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7

DBSCAN-SWA_114

1547653 : 1558262

Moraxella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671073.1\|1547653_1548991_-	adenine permease AdeP	A0A0R6PHV4	Moraxella_phage	1.6e-64	37.8
WP_032950596.1\|1549158_1549824_+	6-phosphogluconate phosphatase	NA	NA	NA	NA
WP_003023824.1\|1549908_1550634_-	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_003023821.1\|1550648_1551422_-	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
WP_003023819.1\|1551468_1552359_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_003023817.1\|1552358_1553318_-	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_003023814.1\|1553462_1554503_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.0e-46	35.8
WP_003023813.1\|1554837_1556667_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.1e-122	41.4
WP_003023811.1\|1556891_1558262_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	2.1e-35	37.6

DBSCAN-SWA_115

1570546 : 1571539

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151221.1\|1570546_1571539_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	2.9e-50	37.7

DBSCAN-SWA_116

1574813 : 1578807

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671079.1\|1574813_1576682_+	low affinity potassium transporter Kup	M1I6H8	Paramecium_bursaria_Chlorella_virus	4.2e-66	30.5
WP_003023766.1\|1576874_1577294_+	D-ribose pyranase	NA	NA	NA	NA
WP_003023764.1\|1577301_1578807_+	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	1.7e-17	21.9

DBSCAN-SWA_117

1594159 : 1595806

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032938437.1\|1594159_1595806_+	acetolactate synthase 2 catalytic subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	6.9e-65	31.8

DBSCAN-SWA_118

1604927 : 1610356

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003829018.1\|1604927_1606949_+	DNA helicase Rep	A7KV33	Bacillus_phage	2.2e-113	37.8
WP_003017996.1\|1606996_1608478_-	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
WP_003017994.1\|1608614_1609883_-	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	8.3e-42	31.2
WP_001280776.1\|1610026_1610356_+	thioredoxin TrxA	A0A1V0SD63	Indivirus	4.2e-14	38.5

DBSCAN-SWA_119

1614409 : 1618608

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032950621.1\|1614409_1615540_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	7.4e-26	26.5
WP_032950623.1\|1615536_1616799_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HNJ7	Paramecium_bursaria_Chlorella_virus	2.7e-24	27.2
WP_046671402.1\|1616795_1617473_+	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
WP_032938462.1\|1617477_1618608_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	1.1e-18	41.7

DBSCAN-SWA_120

1635027 : 1638873

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841210.1\|1635027_1635930_+	tyrosine recombinase XerC	A0A142F1N9	Bacillus_phage	1.9e-24	29.5
WP_003017925.1\|1635929_1636646_+	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
WP_046671398.1\|1636710_1638873_+	DNA helicase II	A7KV33	Bacillus_phage	1.0e-116	37.6

DBSCAN-SWA_121

1642791 : 1646228

Catovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844630.1\|1642791_1644621_+	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	2.5e-84	38.5
WP_046671397.1\|1644684_1645305_+	threonine export protein RhtC	NA	NA	NA	NA
WP_032950636.1\|1645343_1646228_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	5.7e-66	52.0

DBSCAN-SWA_122

1658191 : 1661511

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003017891.1\|1658191_1659832_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.3e-42	29.5
WP_003017888.1\|1659910_1660165_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
WP_003017886.1\|1660168_1660717_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_046671394.1\|1660719_1661511_+	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.0e-26	32.0

DBSCAN-SWA_123

1672460 : 1673075

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671388.1\|1672460_1673075_+	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	1.4e-18	45.7

DBSCAN-SWA_124

1685257 : 1688044

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840413.1\|1685257_1688044_+	DNA polymerase I	A8E2B3	Enterococcus_phage	4.9e-47	30.3

DBSCAN-SWA_125

1691957 : 1694427

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028633.1\|1691957_1693367_-	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	9.0e-05	28.7
WP_003028636.1\|1693377_1694427_-	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	2.6e-09	26.6

DBSCAN-SWA_126

1707135 : 1709932

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671353.1\|1707135_1708032_-	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	4.6e-63	93.8
WP_003847909.1\|1708198_1709095_+	sugar kinase	NA	NA	NA	NA
WP_003847907.1\|1709128_1709932_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	4.9e-24	29.6

DBSCAN-SWA_127

1713073 : 1713982

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671350.1\|1713073_1713982_-	alpha/beta hydrolase	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	4.6e-26	30.8

DBSCAN-SWA_128

1717313 : 1720364

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152659866.1\|1717313_1720364_-	formate dehydrogenase-N subunit alpha	A0A077SK27	Escherichia_phage	2.2e-08	23.9

DBSCAN-SWA_129

1738041 : 1738662

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840480.1\|1738041_1738662_+	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	1.0e-61	57.4

DBSCAN-SWA_130

1741705 : 1743774

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840485.1\|1741705_1743079_-	envelope stress sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	1.1e-15	25.9
WP_003028763.1\|1743075_1743774_-	envelope stress response regulator transcription factor CpxR	Q6XM27	Feldmannia_irregularis_virus	1.5e-05	29.5

DBSCAN-SWA_131

1757251 : 1758097

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028793.1\|1757251_1758097_-	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.8e-16	29.5

DBSCAN-SWA_132

1761452 : 1762784

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028803.1\|1761452_1762784_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	2.6e-46	29.2

DBSCAN-SWA_133

1783949 : 1784612

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016151282.1\|1783949_1784612_-	fructose-6-phosphate aldolase	A0A0E3F0E2	Synechococcus_phage	1.1e-29	33.2

DBSCAN-SWA_134

1800619 : 1802476

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028868.1\|1800619_1802476_+	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	1.0e-08	29.3

DBSCAN-SWA_135

1811255 : 1831792

uncultured_Mediterranean_phage(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031107.1\|1811255_1812206_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	8.7e-28	32.0
WP_003031109.1\|1813153_1814338_+	elongation factor Tu	A0A2K9L516	Tupanvirus	7.5e-13	26.1
WP_003033128.1\|1814568_1814952_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003033125.1\|1814953_1815499_+	transcription termination/antitermination protein NusG	A0A291AUS6	Sinorhizobium_phage	1.1e-14	29.6
WP_003033122.1\|1815653_1816082_+	50S ribosomal protein L11	NA	NA	NA	NA
WP_162648242.1\|1816085_1816793_+	50S ribosomal protein L1	NA	NA	NA	NA
WP_001207203.1\|1817207_1817705_+	50S ribosomal protein L10	NA	NA	NA	NA
WP_003033114.1\|1817771_1818137_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_003033111.1\|1818457_1822486_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.6e-22	29.4
WP_003033107.1\|1822562_1826786_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	1.0e-67	27.4
WP_003033104.1\|1826897_1827215_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_003033102.1\|1827219_1827525_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003033098.1\|1828618_1828831_+	cold shock protein CspG	A0A1W6JNX5	Morganella_phage	2.2e-24	78.6
WP_046671422.1\|1828962_1830084_-	2-iminoacetate synthase ThiH	NA	NA	NA	NA
WP_161958354.1\|1830080_1830944_-	thiazole synthase	NA	NA	NA	NA
WP_003033088.1\|1830852_1831053_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_046671421.1\|1831033_1831792_-	HesA/MoeB/ThiF family protein	A0A1V0SCZ9	Indivirus	2.0e-11	32.1

DBSCAN-SWA_136

1837055 : 1838819

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003033072.1\|1837055_1837736_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	3.3e-21	30.1
WP_003842015.1\|1837769_1838360_+	YjaG family protein	NA	NA	NA	NA
WP_001044509.1\|1838546_1838819_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	5.5e-20	57.8

DBSCAN-SWA_137

1844273 : 1845863

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671416.1\|1844273_1845863_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.2e-66	47.4

DBSCAN-SWA_138

1859098 : 1862782

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031615.1\|1859098_1862782_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.7e-26	90.2

DBSCAN-SWA_139

1866194 : 1866473

Brucella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671412.1\|1866194_1866473_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.9e-12	51.2

DBSCAN-SWA_140

1880589 : 1881375

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844703.1\|1880589_1881375_+	nucleotidyltransferase domain-containing protein	A0A2D1GQQ2	Pseudomonas_phage	7.4e-49	45.9

DBSCAN-SWA_141

1897213 : 1898323

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031682.1\|1897213_1898323_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_142

1905506 : 1906115

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031703.1\|1905506_1906115_+	repressor LexA	Q9G0C2	Lactococcus_phage	1.0e-13	38.0

DBSCAN-SWA_143

1911853 : 1920847

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003826610.1\|1911853_1913269_+	replicative DNA helicase	O80281	Escherichia_phage	1.8e-199	77.9
WP_003844721.1\|1913285_1914365_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.2e-30	28.5
WP_032938184.1\|1914493_1915687_+	aromatic amino acid transaminase	NA	NA	NA	NA
WP_003826615.1\|1915935_1916649_+	acid phosphatase AphA	NA	NA	NA	NA
WP_003031719.1\|1916776_1917133_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_003031720.1\|1917248_1920071_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.6
WP_003826621.1\|1920322_1920847_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	1.1e-53	94.5

DBSCAN-SWA_144

1927738 : 1929088

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134216406.1\|1927738_1929088_+	guanine/hypoxanthine transporter GhxP	A0A0R6PHV4	Moraxella_phage	4.0e-159	71.4

DBSCAN-SWA_145

1935308 : 1937267

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648247.1\|1935308_1937267_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.3e-91	41.1

DBSCAN-SWA_146

1954170 : 1956156

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648323.1\|1954170_1956156_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	1.8e-147	44.3

DBSCAN-SWA_147

1961965 : 1971552

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844755.1\|1961965_1963489_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-16	27.9
WP_044702173.1\|1963603_1965868_+	response regulator	NA	NA	NA	NA
WP_003031807.1\|1965937_1966267_+	hypothetical protein	NA	NA	NA	NA
WP_046671374.1\|1966422_1966725_+	hypothetical protein	A0A222YWE2	Escherichia_phage	4.1e-40	76.0
WP_046671375.1\|1966751_1967093_+	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	1.4e-44	83.6
WP_046671376.1\|1967145_1967904_-	phosphonate metabolism protein PhnP	NA	NA	NA	NA
WP_003031809.1\|1967912_1968347_-	aminoalkylphosphonate N-acetyltransferase	NA	NA	NA	NA
WP_003844764.1\|1968333_1968888_-	ribose 1,5-bisphosphokinase	NA	NA	NA	NA
WP_003031811.1\|1968890_1970027_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_046671387.1\|1970023_1970704_-	phosphonate C-P lyase system protein PhnL	F2Y2R6	Organic_Lake_phycodnavirus	1.1e-08	29.7
WP_003844769.1\|1970793_1971552_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	1.8e-15	28.2

DBSCAN-SWA_148

1977289 : 1978078

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841124.1\|1977289_1978078_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.5e-12	29.0

DBSCAN-SWA_149

1984650 : 1987459

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841133.1\|1984650_1986153_+	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	2.4e-56	31.5
WP_008321468.1\|1986302_1986392_+	LpxT activity modulator PmrR	NA	NA	NA	NA
WP_161799280.1\|1986385_1987459_-	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	4.4e-12	27.2

DBSCAN-SWA_150

2014282 : 2015944

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648325.1\|2014282_2015944_-	fatty acid--CoA ligase	Q75ZG1	Hepacivirus	2.3e-31	24.6

DBSCAN-SWA_151

2024647 : 2029020

Cronobacter_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000027827.1\|2024647_2024941_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	1.2e-12	43.3
WP_003025464.1\|2024984_2026631_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	2.9e-188	68.1
WP_003025468.1\|2026765_2027119_+	DUF4156 domain-containing protein	NA	NA	NA	NA
WP_063841712.1\|2028039_2029020_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_152

2032684 : 2033218

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025522.1\|2032684_2033218_-	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.6e-47	54.8

DBSCAN-SWA_153

2039120 : 2040098

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003830517.1\|2039120_2040098_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	8.1e-29	29.1

DBSCAN-SWA_154

2047431 : 2047977

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839477.1\|2047431_2047977_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-28	41.0

DBSCAN-SWA_155

2051985 : 2055192

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937771.1\|2051985_2053317_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	1.1e-17	30.1
WP_046670812.1\|2053326_2055192_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.6e-60	42.1

DBSCAN-SWA_156

2060715 : 2065275

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025606.1\|2060715_2062014_+	adenylosuccinate synthase	W5S5V7	Pithovirus	2.9e-66	35.6
WP_003025609.1\|2062230_2062656_+	nitric oxide-sensing transcriptional repressor NsrR	NA	NA	NA	NA
WP_046670813.1\|2062812_2065275_+	ribonuclease R	Q0GXV6	Lactococcus_phage	9.4e-66	32.5

DBSCAN-SWA_157

2084664 : 2086218

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844953.1\|2084664_2086218_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.3e-08	31.0

DBSCAN-SWA_158

2102091 : 2109843

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025726.1\|2102091_2102619_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	9.3e-56	63.3
WP_003025728.1\|2102928_2103885_+	galactofuranose ABC transporter substrate-binding protein YtfQ	NA	NA	NA	NA
WP_016149467.1\|2103987_2105490_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	3.6e-12	30.4
WP_008323019.1\|2105503_2106526_+	ABC transporter permease	NA	NA	NA	NA
WP_003025736.1\|2106512_2107514_+	sugar ABC transporter permease YjfF	NA	NA	NA	NA
WP_003839560.1\|2107617_2108730_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-14	34.0
WP_003025742.1\|2108844_2109843_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.1e-68	42.1

DBSCAN-SWA_159

2121751 : 2124981

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839576.1\|2121751_2121994_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	A0A2H4JBG1	uncultured_Caudovirales_phage	4.3e-16	52.5
WP_016149473.1\|2121983_2122268_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.3e-32	71.3
WP_032937736.1\|2122271_2122736_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	1.1e-52	57.7
WP_003025782.1\|2122842_2124981_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	2.0e-266	64.4

DBSCAN-SWA_160

2128666 : 2132712

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003025788.1\|2128666_2129614_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	3.5e-13	21.8
WP_044699140.1\|2130003_2132712_+	magnesium-translocating P-type ATPase	M1HM40	Paramecium_bursaria_Chlorella_virus	5.9e-45	27.5

DBSCAN-SWA_161

2137110 : 2138046

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670831.1\|2137110_2138046_-	aspartate carbamoyltransferase	A7RB08	Paramecium_bursaria_Chlorella_virus	1.9e-51	40.2

DBSCAN-SWA_162

2146466 : 2187744

Moraxella_phage(20.0%)

transposase,tRNA,integrase

attL 2159399:2159416|attR 2182467:2182484

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648328.1\|2146466_2147225_+\|tRNA	tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE	NA	NA	NA	NA
WP_003839625.1\|2147389_2148220_+	hypothetical protein	NA	NA	NA	NA
WP_003025856.1\|2148246_2148750_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_162648329.1\|2148968_2151824_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.9e-140	36.5
WP_003025862.1\|2151823_2152267_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_003025870.1\|2152385_2153897_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	7.1e-48	38.4
WP_003839630.1\|2154163_2155264_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_003025875.1\|2155263_2156346_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_054528665.1\|2156447_2157950_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.5e-82	44.0
WP_054528004.1\|2158097_2159117_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	1.9e-44	31.7
2159399:2159416	attL	NA	NA	NA	NA
WP_162648330.1\|2159611_2160862_+\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	4.3e-83	39.1
WP_059236049.1\|2160949_2162089_+	DNA cytosine methyltransferase	A0A1P8CX13	Bacillus_phage	2.1e-28	27.9
WP_000019445.1\|2162693_2163674_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_162648331.1\|2163731_2164301_+	hypothetical protein	NA	NA	NA	NA
WP_162648332.1\|2164442_2165252_+	hypothetical protein	NA	NA	NA	NA
WP_059236045.1\|2165417_2165624_+	AlpA family transcriptional regulator	A0A0R6PGY4	Moraxella_phage	8.5e-05	41.1
WP_162648333.1\|2165644_2165959_+	hypothetical protein	NA	NA	NA	NA
WP_162648334.1\|2166241_2167444_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_162648335.1\|2167436_2168741_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_162648336.1\|2168737_2170612_+	DNA-binding protein	NA	NA	NA	NA
WP_162648337.1\|2170626_2171013_+	hypothetical protein	NA	NA	NA	NA
WP_162648338.1\|2171109_2171538_+	hypothetical protein	NA	NA	NA	NA
WP_003845909.1\|2171587_2171902_-	hypothetical protein	NA	NA	NA	NA
WP_003845907.1\|2171919_2172306_-	hypothetical protein	NA	NA	NA	NA
WP_162648339.1\|2172843_2174046_-	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_048272234.1\|2174014_2174413_-	hypothetical protein	NA	NA	NA	NA
WP_048271966.1\|2175257_2176481_+	hypothetical protein	NA	NA	NA	NA
WP_001106245.1\|2176966_2177896_-	hypothetical protein	NA	NA	NA	NA
WP_059236906.1\|2178289_2179186_-	hypothetical protein	NA	NA	NA	NA
WP_000936774.1\|2179195_2180347_-	DUF3696 domain-containing protein	NA	NA	NA	NA
WP_047075945.1\|2180349_2182266_-	DUF262 domain-containing protein	A0A0R6PKN1	Moraxella_phage	3.1e-16	31.0
WP_001254932.1\|2184078_2185230_-\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
2182467:2182484	attR	NA	NA	NA	NA
WP_162648340.1\|2185647_2186340_+	endonuclease	NA	NA	NA	NA
WP_162648341.1\|2186632_2187744_-\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_163

2202762 : 2207183

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837172.1\|2202762_2204238_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	5.8e-47	31.6
WP_003033268.1\|2204459_2205233_+	Uxu operon transcriptional regulator	NA	NA	NA	NA
WP_008322159.1\|2205881_2206085_+	hypothetical protein	NA	NA	NA	NA
WP_046670863.1\|2206205_2207183_+	porin	Q1MVN1	Enterobacteria_phage	1.8e-81	49.9

DBSCAN-SWA_164

2227189 : 2228851

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837223.1\|2227189_2228851_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.0e-08	72.3

DBSCAN-SWA_165

2232178 : 2234660

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837229.1\|2232178_2233201_+	zinc-binding alcohol dehydrogenase family protein	A0A2K9L7I1	Tupanvirus	3.9e-10	26.0
WP_162648350.1\|2233214_2234660_+	tagaturonate reductase	G8DCZ3	Micromonas_pusilla_virus	5.0e-19	26.0

DBSCAN-SWA_166

2237789 : 2239069

Shigella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019133.1\|2237789_2238527_-	DNA replication protein DnaC	V5UQI5	Shigella_phage	2.9e-63	51.2
WP_003019130.1\|2238529_2239069_-	primosomal protein DnaT	T1SA92	Salmonella_phage	4.9e-28	61.7

DBSCAN-SWA_167

2245411 : 2246488

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837249.1\|2245411_2246488_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-20	39.2

DBSCAN-SWA_168

2250310 : 2253115

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019086.1\|2250310_2251900_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	2.7e-29	24.8
WP_003837258.1\|2252208_2252826_+	molecular chaperone OsmY	NA	NA	NA	NA
WP_003019081.1\|2252953_2253115_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	2.8e-11	66.0

DBSCAN-SWA_169

2258658 : 2259981

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845626.1\|2258658_2259981_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	3.4e-78	39.3

DBSCAN-SWA_170

2266491 : 2271757

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019021.1\|2266491_2267721_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.5e-85	44.0
WP_003845630.1\|2267820_2269488_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	2.4e-41	26.4
WP_003019016.1\|2269819_2271757_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	1.6e-12	36.2

DBSCAN-SWA_171

2275715 : 2277140

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032937487.1\|2275715_2277140_+	two-component system sensor histidine kinase CreC	Q8QKV7	Ectocarpus_siliculosus_virus	1.8e-08	21.8

DBSCAN-SWA_172

2288337 : 2289291

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018974.1\|2288337_2289291_+	transaldolase	A0A0E3G6C9	Synechococcus_phage	1.3e-10	34.4

DBSCAN-SWA_173

2293705 : 2298220

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018959.1\|2293705_2295628_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.4e-146	50.3
WP_003837322.1\|2295713_2296847_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.5e-29	34.6
WP_003018952.1\|2297053_2298220_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.6e-90	51.5

DBSCAN-SWA_174

2304692 : 2307509

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149528.1\|2304692_2307509_+\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	3.0e-76	25.5

DBSCAN-SWA_175

2311956 : 2313105

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018918.1\|2311956_2313105_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.2e-49	32.4

DBSCAN-SWA_176

2318537 : 2324170

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845685.1\|2318537_2320091_-	crotonobetaine/carnitine-CoA ligase	A0A2K9KZV5	Tupanvirus	7.1e-19	22.3
WP_003837364.1\|2320152_2321370_-	L-carnitine CoA-transferase	NA	NA	NA	NA
WP_003018898.1\|2321475_2322618_-	crotonobetainyl-CoA dehydrogenase	NA	NA	NA	NA
WP_003018896.1\|2322652_2324170_-	L-carnitine/gamma-butyrobetaine antiport BCCT transporter	A0A2I7QNT1	Vibrio_phage	2.5e-08	22.1

DBSCAN-SWA_177

2332500 : 2333925

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018873.1\|2332500_2332980_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	3.0e-29	47.1
WP_003845697.1\|2333076_2333925_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	4.9e-06	45.3

DBSCAN-SWA_178

2341656 : 2347046

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837386.1\|2341656_2344563_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	1.7e-21	37.9
WP_060855462.1\|2344694_2347046_-	DNA polymerase II	A0A1B2RW58	Lymphocystis_disease_virus	6.5e-16	24.9

DBSCAN-SWA_179

2354198 : 2354897

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648364.1\|2354198_2354897_-	thiamine ABC transporter ATP-binding protein ThiQ	G3M9Y6	Bacillus_virus	4.4e-21	38.2

DBSCAN-SWA_180

2371365 : 2373090

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845729.1\|2371365_2373090_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	3.0e-34	26.1

DBSCAN-SWA_181

2399109 : 2400153

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018732.1\|2399109_2400153_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	3.4e-102	55.0

DBSCAN-SWA_182

2404455 : 2405019

Thiobacimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018719.1\|2404455_2405019_+	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1B0T6G1	Thiobacimonas_phage	2.1e-13	33.1

DBSCAN-SWA_183

2416085 : 2417510

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018686.1\|2416085_2417510_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.6e-41	26.9

DBSCAN-SWA_184

2424999 : 2431047

Mamastrovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648371.1\|2424999_2426628_+	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	4.3e-19	55.3
WP_162648372.1\|2426812_2428468_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.3e-14	31.8
WP_003018658.1\|2428719_2429256_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	3.9e-17	33.1
WP_003018654.1\|2429349_2430012_-	carbonate dehydratase	NA	NA	NA	NA
WP_149911358.1\|2430120_2431047_+	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.9e-22	34.0

DBSCAN-SWA_185

2436495 : 2443318

Bacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071524282.1\|2436495_2437914_-	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	5.5e-26	35.9
WP_003837490.1\|2437964_2438861_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
WP_003018625.1\|2438931_2439387_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
WP_046670954.1\|2439564_2440269_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_003018620.1\|2440284_2440815_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
WP_080953253.1\|2440843_2443318_+	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	1.7e-38	29.3

DBSCAN-SWA_186

2453962 : 2454760

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845793.1\|2453962_2454760_+	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	3.5e-14	27.4

DBSCAN-SWA_187

2460695 : 2461040

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018581.1\|2460695_2461040_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	5.9e-27	50.5

DBSCAN-SWA_188

2465042 : 2466476

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018567.1\|2465042_2466476_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.1e-25	29.8

DBSCAN-SWA_189

2477901 : 2478660

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018543.1\|2477901_2478660_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	7.2e-25	41.5

DBSCAN-SWA_190

2487479 : 2491583

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018518.1\|2487479_2488076_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.3e-26	39.8
WP_003845818.1\|2488100_2491583_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.7e-207	37.0

DBSCAN-SWA_191

2503602 : 2504634

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003018468.1\|2503602_2504634_-	methionine ABC transporter ATP-binding protein MetN	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_192

2511089 : 2511893

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149586.1\|2511089_2511893_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	3.9e-37	35.0

DBSCAN-SWA_193

2515937 : 2520136

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031421.1\|2515937_2517296_-	murein transglycosylase D	A0A0A7NU10	Lactobacillus_phage	8.9e-10	28.6
WP_003031418.1\|2517367_2518123_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_003031413.1\|2518156_2518879_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003838896.1\|2518875_2519343_-	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-53	60.1
WP_032941271.1\|2519398_2520136_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	4.1e-41	40.7

DBSCAN-SWA_194

2535729 : 2539012

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031390.1\|2535729_2536311_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	5.7e-14	30.8
WP_003031388.1\|2536422_2537190_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_003031387.1\|2537160_2537901_-	murein L,D-transpeptidase	NA	NA	NA	NA
WP_003838866.1\|2538250_2539012_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	2.0e-19	38.5

DBSCAN-SWA_195

2553218 : 2558692

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149604.1\|2553218_2553611_+	adenylyltransferase/cytidyltransferase family protein	A0A1V0SGE7	Hokovirus	4.7e-28	47.0
WP_162648377.1\|2553683_2554853_-	hypothetical protein	NA	NA	NA	NA
WP_016149606.1\|2554905_2556102_-	hypothetical protein	NA	NA	NA	NA
WP_046669750.1\|2556130_2558692_-	glycosyltransferase	A0A1V0SAN7	Catovirus	1.6e-31	39.6

DBSCAN-SWA_196

2586936 : 2590650

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003031375.1\|2586936_2587992_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.5e-116	59.5
WP_003031373.1\|2588281_2589385_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.6e-60	39.6
WP_003031370.1\|2589396_2590650_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.9e-99	47.5

DBSCAN-SWA_197

2613236 : 2614142

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648380.1\|2613236_2614142_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.0e-14	25.3

DBSCAN-SWA_198

2620875 : 2621703

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669788.1\|2620875_2621703_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	29.0

DBSCAN-SWA_199

2635352 : 2643301

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669792.1\|2635352_2637239_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.1e-53	29.8
WP_003838662.1\|2637283_2637556_-	YceK/YidQ family lipoprotein	NA	NA	NA	NA
WP_003847667.1\|2637708_2638962_-	MFS transporter	NA	NA	NA	NA
WP_046669793.1\|2639013_2642097_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	81.3
WP_046669794.1\|2642218_2643301_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.4e-159	81.7

DBSCAN-SWA_200

2654060 : 2656021

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003838629.1\|2654060_2655011_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	6.2e-34	36.3
WP_003021379.1\|2655007_2656021_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	3.2e-44	31.1

DBSCAN-SWA_201

2660012 : 2661059

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669801.1\|2660012_2661059_-	ferric ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-34	38.2

DBSCAN-SWA_202

2669119 : 2669887

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048233151.1\|2669119_2669887_+	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	1.1e-25	39.1

DBSCAN-SWA_203

2676697 : 2677666

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279773.1\|2676697_2677666_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-180	96.6

DBSCAN-SWA_204

2688392 : 2689508

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085954043.1\|2688392_2689508_+	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	5.3e-16	34.6

DBSCAN-SWA_205

2693259 : 2703112

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021479.1\|2693259_2694171_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.7e-103	64.3
WP_162648388.1\|2694157_2695171_+	fructokinase	NA	NA	NA	NA
WP_032950792.1\|2695178_2696351_-	MFS transporter AraJ	NA	NA	NA	NA
WP_032948677.1\|2696543_2699687_-	exonuclease subunit SbcC	G3MAB6	Bacillus_virus	1.7e-11	26.4
WP_032936985.1\|2699683_2700886_-	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	2.0e-08	25.6
WP_003021496.1\|2701076_2701766_+	phosphate response regulator transcription factor PhoB	W8CYM9	Bacillus_phage	2.0e-37	38.9
WP_016149692.1\|2701816_2703112_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.4e-28	30.3

DBSCAN-SWA_206

2715358 : 2724966

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835982.1\|2715358_2716486_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-89	46.3
WP_003021544.1\|2716508_2716841_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
WP_003021547.1\|2716868_2718716_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_003021550.1\|2718726_2719698_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.4e-44	37.8
WP_044699354.1\|2719866_2720232_+	VOC family protein	NA	NA	NA	NA
WP_003835974.1\|2720255_2720948_+	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	4.5e-18	30.1
WP_003021561.1\|2720993_2721857_-	nucleoside-specific channel-forming protein Tsx	NA	NA	NA	NA
WP_054528674.1\|2722155_2722695_-	DUF3251 domain-containing protein	NA	NA	NA	NA
WP_003021571.1\|2722848_2723298_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_003021573.1\|2723301_2724405_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.4e-52	35.5
WP_003021575.1\|2724495_2724966_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	7.8e-30	47.4

DBSCAN-SWA_207

2747605 : 2752650

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021624.1\|2747605_2748229_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.9e-64	63.9
WP_003831013.1\|2748355_2749630_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-131	56.4
WP_003021627.1\|2749814_2752169_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.6
WP_003021629.1\|2752377_2752650_+	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	1.5e-20	58.4

DBSCAN-SWA_208

2755931 : 2756627

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835948.1\|2755931_2756627_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	6.5e-89	68.4

DBSCAN-SWA_209

2761037 : 2764581

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149705.1\|2761037_2762810_+	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-47	29.7
WP_046669814.1\|2762802_2764581_+	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	8.9e-42	27.8

DBSCAN-SWA_210

2770169 : 2773729

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021675.1\|2770169_2771123_+	hypothetical protein	A0A1B1ITH5	uncultured_Mediterranean_phage	1.9e-27	29.3
WP_061547913.1\|2771372_2772500_-	hypothetical protein	NA	NA	NA	NA
WP_040236485.1\|2772520_2773729_-	ImmA/IrrE family metallo-endopeptidase	A0A0P0ZCT8	Stx2-converting_phage	1.2e-21	45.6

DBSCAN-SWA_211

2787623 : 2790773

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021736.1\|2787623_2790773_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	9.5e-55	23.7

DBSCAN-SWA_212

2797692 : 2806322

Klosneuvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021759.1\|2797692_2798244_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	7.0e-30	46.6
WP_162648393.1\|2798454_2800386_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	2.3e-43	41.5
WP_003021764.1\|2800443_2800773_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003021767.1\|2800772_2801378_+	recombination protein RecR	NA	NA	NA	NA
WP_003021770.1\|2801488_2803363_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	2.0e-113	36.4
WP_003021773.1\|2803595_2804240_+	adenylate kinase	NA	NA	NA	NA
WP_003021775.1\|2804403_2805366_+	ferrochelatase	NA	NA	NA	NA
WP_046669819.1\|2805362_2806322_-	acetyl esterase	A0A167RJ59	Powai_lake_megavirus	1.9e-14	29.0

DBSCAN-SWA_213

2814507 : 2817927

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648394.1\|2814507_2817009_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	3.4e-116	38.2
WP_003021801.1\|2817156_2817927_-	heme ABC transporter ATP-binding protein	W5SAS9	Pithovirus	8.9e-15	27.9

DBSCAN-SWA_214

2829478 : 2830156

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835797.1\|2829478_2830156_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	3.1e-27	35.2

DBSCAN-SWA_215

2833306 : 2833993

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044699413.1\|2833306_2833993_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-31	34.2

DBSCAN-SWA_216

2838889 : 2839906

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847503.1\|2838889_2839906_+	virulence-associated ABC transporter ATP-binding protein SfbB	G9BWD6	Planktothrix_phage	1.5e-33	38.6

DBSCAN-SWA_217

2844945 : 2846331

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003831109.1\|2844945_2846331_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.6e-46	35.4

DBSCAN-SWA_218

2850264 : 2851131

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003021887.1\|2850264_2851131_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.2e-28	36.5

DBSCAN-SWA_219

2857980 : 2871205

Escherichia_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|2857980_2858961_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_003021904.1\|2859243_2859966_-	hypothetical protein	NA	NA	NA	NA
WP_044699458.1\|2860351_2860945_-	fimbria biosynthesis transcriptional regulator FimW	NA	NA	NA	NA
WP_072053661.1\|2861312_2864078_-	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	4.0e-33	31.3
WP_046669832.1\|2864160_2865192_+	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_003021912.1\|2865164_2865857_-	two-component system response regulator TorR	W8CYM9	Bacillus_phage	4.9e-20	28.9
WP_046669833.1\|2867146_2869687_+	trimethylamine-N-oxide reductase TorA	A0A077SK27	Escherichia_phage	1.1e-72	30.2
WP_046669834.1\|2869683_2870298_+	molecular chaperone TorD	NA	NA	NA	NA
WP_003835732.1\|2870776_2871205_-	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	7.4e-27	49.3

DBSCAN-SWA_220

2877583 : 2879708

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003847479.1\|2877583_2879035_-	Cu(+)/Ag(+) sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.5e-10	26.8
WP_003021940.1\|2879024_2879708_-	copper response regulator transcription factor CusR	W8CYM9	Bacillus_phage	6.0e-31	35.6

DBSCAN-SWA_221

2883046 : 2889681

Leptospira_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835712.1\|2883046_2886190_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	2.7e-57	22.0
WP_003021953.1\|2886241_2887096_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162648403.1\|2887332_2888655_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	9.4e-105	45.6
WP_063841712.1\|2888700_2889681_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_222

2893727 : 2903066

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648405.1\|2893727_2903066_-	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	3.5e-12	24.7

DBSCAN-SWA_223

2919005 : 2927095

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648407.1\|2919005_2922896_+	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	2.1e-64	29.8
WP_162648408.1\|2923124_2924258_+	LPS O-antigen length regulator	NA	NA	NA	NA
WP_003022023.1\|2924304_2925102_-	iron-enterobactin ABC transporter ATP-binding protein	A0A1V0SJ29	Klosneuvirus	6.4e-08	23.0
WP_003022026.1\|2925098_2926091_-	iron-enterobactin ABC transporter permease	NA	NA	NA	NA
WP_003835646.1\|2926087_2927095_-	Fe(3+)-siderophore ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.2e-13	26.0

DBSCAN-SWA_224

2939552 : 2941378

uncultured_marine_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669852.1\|2939552_2940170_-	ParB-like nuclease domain-containing protein	A0A0F7L444	uncultured_marine_virus	6.0e-54	51.3
WP_003835626.1\|2940154_2941378_-	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	5.9e-61	33.1

DBSCAN-SWA_225

2944490 : 2952620

Escherichia_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835619.1\|2944490_2946056_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	1.1e-43	34.0
WP_069219714.1\|2946279_2946834_+	dehydrogenase	NA	NA	NA	NA
WP_003835615.1\|2946830_2949101_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	4.9e-45	25.0
WP_003022094.1\|2949097_2949655_+	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	6.2e-26	37.7
WP_046669855.1\|2949654_2950422_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003022101.1\|2950491_2950920_-	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	1.1e-17	38.5
WP_003022104.1\|2951103_2951514_-	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_046669856.1\|2951789_2952620_+	alpha/beta hydrolase	A0A291AV30	Mycobacterium_phage	4.2e-18	30.8

DBSCAN-SWA_226

2966453 : 2967099

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000034825.1\|2966453_2966663_+	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	2.7e-22	78.1
WP_016149775.1\|2966715_2967099_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.8e-23	52.6

DBSCAN-SWA_227

2970706 : 2973170

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003022711.1\|2970706_2971918_-	D-alanyl-D-alanine carboxypeptidase DacA	B6DZZ7	Stx2-converting_phage	9.8e-101	47.9
WP_046669860.1\|2972060_2973170_-	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	6.2e-09	54.8

DBSCAN-SWA_228

2981335 : 2986510

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152659845.1\|2981335_2983918_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.6e-185	42.6
WP_003022748.1\|2984153_2984636_+	zinc ribbon-containing protein	NA	NA	NA	NA
WP_003847389.1\|2984732_2985668_-	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
WP_003022754.1\|2985784_2986510_-	glutamate/aspartate ABC transporter ATP binding protein GltL	G9BWD6	Planktothrix_phage	1.1e-30	38.1

DBSCAN-SWA_229

2992470 : 2993556

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008784096.1\|2992470_2993556_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	3.3e-47	46.6

DBSCAN-SWA_230

2998106 : 2999771

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835552.1\|2998106_2999771_-	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	2.1e-85	39.5

DBSCAN-SWA_231

3004570 : 3021473

Vibrio_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835548.1\|3004570_3006520_+	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.1e-08	48.6
WP_003022809.1\|3006706_3008374_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.2
WP_003835544.1\|3008809_3010216_+	chitoporin	NA	NA	NA	NA
WP_003022817.1\|3010265_3010598_+	hypothetical protein	NA	NA	NA	NA
WP_136397779.1\|3010649_3011945_-	MFS transporter	Q6JIH2	Burkholderia_virus	6.9e-60	34.7
WP_162648410.1\|3011998_3013138_-	tricarballylate utilization 4Fe-4S protein TcuB	NA	NA	NA	NA
WP_096889492.1\|3013124_3014528_-	FAD-dependent tricarballylate dehydrogenase TcuA	A0A2P0ZL82	Lactobacillus_phage	1.0e-08	25.9
WP_049014685.1\|3014625_3015552_-	tricarballylate utilization LysR family transcriptional regulator TcuR	NA	NA	NA	NA
WP_003022836.1\|3015681_3016128_-	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_049259739.1\|3016120_3016207_-	ryhB-regulated fur leader peptide	NA	NA	NA	NA
WP_071593189.1\|3016417_3017047_-	flavodoxin FldA	NA	NA	NA	NA
WP_003022842.1\|3017103_3017391_-	LexA regulated protein	NA	NA	NA	NA
WP_003847362.1\|3017519_3018293_-	esterase	A0A1J0GVH7	Mycobacterium_phage	1.2e-06	37.2
WP_003022848.1\|3018487_3019030_+	replication initiation negative regulator SeqA	NA	NA	NA	NA
WP_162648411.1\|3019054_3020695_+	alpha-D-glucose phosphate-specific phosphoglucomutase	NA	NA	NA	NA
WP_003022856.1\|3020795_3021473_-	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.6e-26	32.0

DBSCAN-SWA_232

3024739 : 3026788

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003835530.1\|3024739_3026788_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.6e-31	24.7

DBSCAN-SWA_233

3030155 : 3034181

Hokovirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669872.1\|3030155_3031574_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	3.9e-64	33.8
WP_016149795.1\|3031734_3032649_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	Q2A0A7	Sodalis_phage	4.1e-67	48.0
WP_003847348.1\|3032699_3034181_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	1.3e-43	27.5

DBSCAN-SWA_234

3039972 : 3040764

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669875.1\|3039972_3040764_+	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	1.7e-08	29.8

DBSCAN-SWA_235

3083478 : 3086994

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046669884.1\|3083478_3084198_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	2.9e-23	33.2
WP_003022992.1\|3084194_3085136_-	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	3.7e-23	27.5
WP_003022994.1\|3085249_3085624_-	hypothetical protein	NA	NA	NA	NA
WP_003837108.1\|3085941_3086994_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4VUY9	Pandoravirus	1.7e-80	47.3

DBSCAN-SWA_236

3091289 : 3097855

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003837100.1\|3091289_3092306_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.3e-77	45.1
WP_032938578.1\|3092523_3093996_-	molybdate ABC transporter ATP-binding protein ModF	W5SAS9	Pithovirus	1.0e-11	27.1
WP_003023018.1\|3094063_3094852_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
WP_003023026.1\|3094982_3095132_+	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
WP_162648415.1\|3095331_3096105_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003023032.1\|3096104_3096794_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
WP_003837092.1\|3096796_3097855_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	2.6e-20	33.8

DBSCAN-SWA_237

3112205 : 3115723

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648416.1\|3112205_3113726_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	6.4e-81	39.6
WP_003845384.1\|3113821_3114298_-	kinase inhibitor	NA	NA	NA	NA
WP_162648822.1\|3114355_3115723_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.3e-20	28.8

DBSCAN-SWA_238

3119311 : 3123856

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035181.1\|3119311_3120034_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-09	25.5
WP_135702046.1\|3120051_3120393_-	hypothetical protein	NA	NA	NA	NA
WP_003837055.1\|3120803_3122825_+	excinuclease ABC subunit B	NA	NA	NA	NA
WP_046669894.1\|3122947_3123856_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	3.5e-26	31.1

DBSCAN-SWA_239

3133574 : 3138538

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003845404.1\|3133574_3135311_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.1e-17	31.5
WP_071696426.1\|3135303_3136299_-	secretion protein HlyD	NA	NA	NA	NA
WP_003035216.1\|3136295_3136973_-	transcriptional regulator CecR	NA	NA	NA	NA
WP_162648417.1\|3137194_3138538_+	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.5e-53	33.5

DBSCAN-SWA_240

3142504 : 3148583

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648418.1\|3142504_3144655_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	2.2e-42	27.5
WP_162648419.1\|3144684_3145653_+	DNA-binding protein YbiB	NA	NA	NA	NA
WP_103848331.1\|3145815_3146901_+	malate/lactate/ureidoglycolate dehydrogenase	NA	NA	NA	NA
WP_003035231.1\|3146999_3147260_-	DUF1471 domain-containing protein	NA	NA	NA	NA
WP_003035233.1\|3147563_3147830_-	DksA/TraR family C4-type zinc finger protein	A0A2C9CZU7	Yersinia_phage	3.6e-16	51.1
WP_162648420.1\|3147905_3148583_-	PKHD-type hydroxylase YbiX	Q5GQB0	Synechococcus_phage	2.6e-18	30.6

DBSCAN-SWA_241

3154955 : 3160146

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035246.1\|3154955_3155678_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	2.8e-34	41.1
WP_003035248.1\|3155674_3156334_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
WP_003837002.1\|3156471_3157218_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
WP_003035253.1\|3157583_3158087_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	5.5e-05	28.1
WP_003035255.1\|3158389_3159277_-	threonine/homoserine exporter RhtA	NA	NA	NA	NA
WP_003035257.1\|3159630_3160146_+	outer membrane protein OmpX	A5LH44	Enterobacteria_phage	1.9e-16	33.7

DBSCAN-SWA_242

3165184 : 3174291

Tupanvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035269.1\|3165184_3166780_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	8.5e-60	28.5
WP_048219222.1\|3166923_3168186_-	DUF1479 domain-containing protein	NA	NA	NA	NA
WP_044701108.1\|3168339_3169155_-	HAD family hydrolase	NA	NA	NA	NA
WP_032936392.1\|3169322_3171755_-	glycyl radical protein	A0A076YHZ7	Citrobacter_phage	2.3e-08	50.9
WP_003035278.1\|3171760_3172660_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
WP_162648424.1\|3172792_3173455_+	fructose-6-phosphate aldolase	A0A1D8KKK9	Synechococcus_phage	2.9e-22	31.8
WP_071687912.1\|3173541_3174291_-	molybdopterin-synthase adenylyltransferase MoeB	A0A1V0SCZ9	Indivirus	1.8e-12	29.3

DBSCAN-SWA_243

3177633 : 3179505

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836972.1\|3177633_3179505_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	3.7e-14	27.2

DBSCAN-SWA_244

3187107 : 3189113

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035316.1\|3187107_3188310_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.9e-97	47.1
WP_003836960.1\|3188354_3189113_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	3.9e-15	28.8

DBSCAN-SWA_245

3197303 : 3210695

Salmonella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648429.1\|3197303_3198515_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	8.1e-188	89.2
WP_003035354.1\|3199023_3200709_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_003035356.1\|3200978_3201359_+	membrane protein	NA	NA	NA	NA
WP_003035358.1\|3201393_3201657_-	glutaredoxin, GrxA family	A0A2I7SAE2	Vibrio_phage	3.8e-26	67.9
WP_003845523.1\|3201829_3202120_+	YbjC family protein	NA	NA	NA	NA
WP_003836934.1\|3202103_3202826_+	nitroreductase NfsA	NA	NA	NA	NA
WP_003836932.1\|3202885_3203788_+	30S ribosomal protein S6--L-glutamate ligase	I3ULC9	Synechococcus_phage	2.0e-37	34.0
WP_003035368.1\|3203878_3204355_+	YbjN domain-containing protein	NA	NA	NA	NA
WP_003035370.1\|3204788_3205901_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
WP_003035373.1\|3206039_3207173_+	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	1.1e-29	34.9
WP_103848614.1\|3207182_3208136_+	putrescine ABC transporter permease PotH	NA	NA	NA	NA
WP_003035376.1\|3208132_3208978_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
WP_003035378.1\|3209037_3209526_+	YbjO family protein	NA	NA	NA	NA
WP_044701666.1\|3209567_3210695_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	1.6e-28	27.4

DBSCAN-SWA_246

3215342 : 3231923

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648430.1\|3215342_3217064_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	W8CYL7	Bacillus_phage	1.1e-15	23.6
WP_046669942.1\|3217064_3218831_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	1.4e-23	25.6
WP_003035727.1\|3218945_3219914_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.9e-62	44.3
WP_002439523.1\|3220461_3220956_+	leucine-responsive transcriptional regulator Lrp	NA	NA	NA	NA
WP_162648431.1\|3221090_3225152_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.9e-88	49.2
WP_003831898.1\|3225263_3225875_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_003836910.1\|3225885_3227229_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.3e-81	40.8
WP_003836908.1\|3227321_3228614_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.5e-94	46.1
WP_069219705.1\|3228850_3231295_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	7.8e-222	50.6
WP_003836904.1\|3231305_3231923_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	9.5e-76	59.6

DBSCAN-SWA_247

3236736 : 3239945

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035751.1\|3236736_3237477_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.0e-20	26.5
WP_003035753.1\|3237662_3239945_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.8e-162	42.0

DBSCAN-SWA_248

3244069 : 3245158

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016149863.1\|3244069_3245158_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	2.3e-80	45.3

DBSCAN-SWA_249

3250212 : 3254753

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035780.1\|3250212_3250497_+	integration host factor subunit beta	A7KV42	Bacillus_phage	9.2e-10	39.1
WP_162648436.1\|3250703_3252968_+	ComEC family protein	NA	NA	NA	NA
WP_003035784.1\|3253004_3254753_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	2.4e-60	30.7

DBSCAN-SWA_250

3260053 : 3355328

100

Enterobacteria_phage(27.27%)

holin,terminase,transposase,integrase,tail,portal,protease,tRNA,head,capsid

attL 3253904:3253921|attR 3318006:3318023

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3253904:3253921	attL	NA	NA	NA	NA
WP_003035803.1\|3260053_3260857_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
WP_003836877.1\|3260849_3262172_+	chromosome partition protein MukF	NA	NA	NA	NA
WP_003035809.1\|3262152_3262857_+	chromosome partition protein MukE	NA	NA	NA	NA
WP_003846984.1\|3262856_3267317_+	chromosome partition protein MukB	NA	NA	NA	NA
WP_048241322.1\|3267562_3269314_+	L,D-transpeptidase	NA	NA	NA	NA
WP_003035820.1\|3269491_3270040_+	YcbK family protein	A0A0K1LKR7	Rhodobacter_phage	3.5e-05	32.6
WP_003035823.1\|3270068_3270716_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_003035825.1\|3270769_3271960_-	aspartate transaminase	NA	NA	NA	NA
WP_016149871.1\|3272143_3273220_-	porin OmpF	Q1MVN1	Enterobacteria_phage	8.7e-101	53.9
WP_003035832.1\|3273820_3275221_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	5.0e-80	35.9
WP_003836860.1\|3275388_3276591_-	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
WP_162648437.1\|3276785_3278078_-\|integrase	site-specific integrase	S4TSP2	Salmonella_phage	2.2e-239	94.0
WP_057064505.1\|3278122_3278371_-	excisionase family protein	S4TND0	Salmonella_phage	1.5e-35	85.0
WP_108361454.1\|3278524_3278836_-	hypothetical protein	NA	NA	NA	NA
WP_162648438.1\|3278835_3279423_-	hypothetical protein	A0A1B5FPC7	Escherichia_phage	3.8e-82	71.8
WP_162648823.1\|3279419_3279533_-	hypothetical protein	A0A286S2B6	Klebsiella_phage	1.4e-09	81.1
WP_032652477.1\|3279628_3279853_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	6.1e-17	55.4
WP_162648439.1\|3279971_3280550_-	hypothetical protein	A0A088C4R7	Shewanella_sp._phage	3.7e-13	27.4
WP_162648440.1\|3280560_3281139_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.2e-61	58.9
WP_162648441.1\|3281135_3281558_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.7e-45	64.3
WP_162648070.1\|3281550_3281712_-	hypothetical protein	A0A286SGR4	Klebsiella_phage	3.5e-14	73.5
WP_162648442.1\|3281779_3282136_-	hypothetical protein	A0A1B5FPB3	Escherichia_phage	4.1e-23	49.6
WP_162648443.1\|3282254_3282527_-	hypothetical protein	NA	NA	NA	NA
WP_057064497.1\|3282604_3282898_-	hypothetical protein	NA	NA	NA	NA
WP_057064498.1\|3283086_3283746_-	LexA family transcriptional regulator	I6R0S2	Salmonella_phage	2.5e-90	70.7
WP_071886902.1\|3283856_3284072_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_162648444.1\|3284376_3285261_+	KilA-N domain-containing protein	Q8W644	Enterobacteria_phage	3.8e-62	70.7
WP_057064499.1\|3286168_3287050_+	ATP-binding protein	Q8W641	Enterobacteria_phage	2.0e-79	61.6
WP_108361635.1\|3287046_3288405_+	replicative DNA helicase	Q8W640	Enterobacteria_phage	1.4e-175	69.1
WP_005127643.1\|3288415_3289231_+	antitermination protein	A0A1B5FPA5	Escherichia_phage	1.3e-112	72.3
WP_032652457.1\|3289546_3289759_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_162648445.1\|3290295_3290508_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.2e-22	79.4
WP_143113773.1\|3291982_3292369_+	hypothetical protein	A0A192Y8P2	Salmonella_phage	1.4e-56	92.2
WP_072161075.1\|3292355_3292637_+\|holin	phage holin family protein	A0A0U2SHD1	Escherichia_phage	7.0e-18	47.1
WP_162648446.1\|3292636_3293254_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	4.0e-82	74.1
WP_162648447.1\|3293261_3293531_+	hypothetical protein	G8C7W1	Escherichia_phage	5.8e-22	70.1
WP_162648448.1\|3293952_3294516_+	hypothetical protein	A0A0H4IQ87	Shigella_phage	3.6e-82	76.9
WP_162648449.1\|3294717_3295269_+	HNH endonuclease	A0A2I7RZ08	Vibrio_phage	4.4e-32	46.1
WP_162648450.1\|3295282_3296011_+	Fur-regulated protein	M9NZE9	Enterobacteria_phage	6.1e-90	78.1
WP_162648451.1\|3296025_3296253_+	hypothetical protein	NA	NA	NA	NA
WP_162648452.1\|3296289_3296580_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	1.2e-49	89.6
WP_162648453.1\|3296677_3297112_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	1.9e-67	90.3
WP_162648454.1\|3297121_3298654_+\|terminase	terminase	A0A286S1M9	Klebsiella_phage	3.3e-287	96.7
WP_162648455.1\|3298657_3299935_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	6.0e-234	95.3
WP_134216386.1\|3299940_3300621_+\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.2e-111	89.7
WP_162648456.1\|3300632_3301796_+\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	1.4e-205	95.9
WP_134216388.1\|3301832_3302075_+	hypothetical protein	NA	NA	NA	NA
WP_134216389.1\|3302043_3302349_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	4.9e-41	77.2
WP_162648457.1\|3302409_3302595_+	hypothetical protein	NA	NA	NA	NA
WP_134216390.1\|3302597_3302930_+\|head	phage head closure protein	K7PH08	Enterobacteria_phage	5.9e-32	61.8
WP_134216391.1\|3302922_3303462_+	HK97 gp10 family phage protein	A0A286S249	Klebsiella_phage	4.6e-58	63.5
WP_134216392.1\|3303458_3303824_+	DUF3168 domain-containing protein	K7PHI9	Enterobacteria_phage	1.7e-56	86.0
WP_134216393.1\|3303876_3304374_+\|tail	phage tail protein	K7PJH5	Enterobacteria_phage	5.6e-79	89.7
WP_134216394.1\|3304411_3304897_+\|tail	phage tail protein	K7PJU9	Enterobacteria_phage	1.5e-60	95.1
WP_134216395.1\|3305092_3307513_+\|tail	phage tail tape measure protein	K7PGX8	Enterobacteria_phage	0.0e+00	93.4
WP_134216396.1\|3307512_3307851_+\|tail	phage tail protein	K7PHJ6	Enterobacteria_phage	7.5e-59	92.0
WP_134216397.1\|3307847_3308603_+\|tail	phage minor tail protein L	K7PKU0	Enterobacteria_phage	5.7e-139	94.8
WP_162648458.1\|3308604_3309315_+	peptidase P60	K7PGR2	Enterobacteria_phage	1.3e-137	92.8
WP_162648459.1\|3309344_3309686_+	hypothetical protein	K7PLP0	Enterobacteria_phage	8.1e-53	91.2
WP_162648460.1\|3309730_3310336_+\|tail	tail assembly protein	K7PGY0	Enterobacteria_phage	2.2e-101	98.0
WP_001254932.1\|3311497_3312649_-\|transposase	IS30-like element IS30 family transposase	W5R8L2	Staphylococcus_phage	2.0e-42	35.6
WP_162648461.1\|3313690_3316894_+	host specificity protein J	O64335	Escherichia_phage	0.0e+00	87.1
WP_162648462.1\|3316895_3317840_+	hypothetical protein	H6WRW5	Salmonella_phage	4.5e-117	65.5
WP_049003685.1\|3318638_3319007_+\|tail	tail fiber domain-containing protein	W6ASK4	Escherichia_phage	7.5e-28	50.4
3318006:3318023	attR	NA	NA	NA	NA
WP_162648463.1\|3319344_3319539_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_162648464.1\|3319565_3319877_+	helix-turn-helix domain-containing protein	B6SCW9	Bacteriophage	9.8e-05	50.0
WP_049815105.1\|3320221_3320413_-	hypothetical protein	NA	NA	NA	NA
WP_162648465.1\|3320902_3321142_-	DinI family protein	K7PKM2	Enterobacterial_phage	1.2e-34	94.9
WP_096878894.1\|3321567_3324180_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	7.0e-19	21.6
WP_003035840.1\|3324251_3325019_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-29	37.1
WP_003035843.1\|3325015_3325807_-	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
WP_032936307.1\|3325817_3326963_-	FMNH2-dependent alkanesulfonate monooxygenase	NA	NA	NA	NA
WP_086529148.1\|3326959_3327934_-	sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_016149876.1\|3327926_3328502_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
WP_003831973.1\|3328869_3329880_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_003035852.1\|3330045_3330588_+	cell division protein ZapC	NA	NA	NA	NA
WP_162648466.1\|3330584_3331691_-	MOSC domain-containing protein	NA	NA	NA	NA
WP_003836848.1\|3331789_3333898_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
WP_162648467.1\|3333910_3335818_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	4.3e-50	28.5
WP_003035862.1\|3335832_3337086_+	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
WP_003836843.1\|3337090_3338731_+	intermembrane transport protein PqiB	NA	NA	NA	NA
WP_032936292.1\|3338727_3339291_+	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
WP_003035871.1\|3339547_3339715_+	ribosome modulation factor	NA	NA	NA	NA
WP_003035875.1\|3339822_3340341_-	bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase	NA	NA	NA	NA
WP_162648468.1\|3340409_3342170_-\|protease	Lon protease family protein	NA	NA	NA	NA
WP_003035881.1\|3342355_3342808_+	macrodomain Ter protein MatP	NA	NA	NA	NA
WP_003035883.1\|3342897_3343944_-	porin OmpA	NA	NA	NA	NA
WP_032936288.1\|3344301_3344811_-	cell division inhibitor SulA	NA	NA	NA	NA
WP_162648469.1\|3345027_3345642_+	TfoX/Sxy family DNA transformation protein	NA	NA	NA	NA
WP_032939270.1\|3345619_3347773_-	TIGR01666 family membrane protein	NA	NA	NA	NA
WP_003035892.1\|3347791_3348238_-	YccF domain-containing protein	NA	NA	NA	NA
WP_046671317.1\|3348363_3350418_+	DNA helicase IV	A7KV33	Bacillus_phage	1.0e-20	27.9
WP_003035897.1\|3350450_3350909_-	methylglyoxal synthase	NA	NA	NA	NA
WP_016149882.1\|3351002_3351665_-	DUF2057 family protein	NA	NA	NA	NA
WP_003035903.1\|3351837_3352251_+	CoA-binding protein	NA	NA	NA	NA
WP_003035905.1\|3352312_3352630_-	heat shock protein HspQ	NA	NA	NA	NA
WP_032936284.1\|3352687_3353878_-	23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI	NA	NA	NA	NA
WP_003035911.1\|3353972_3354254_+	acylphosphatase	NA	NA	NA	NA
WP_003035914.1\|3354250_3354580_-	sulfurtransferase TusE	NA	NA	NA	NA
WP_162648470.1\|3354668_3355328_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-47	54.9

DBSCAN-SWA_251

3360610 : 3361426

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049015964.1\|3360610_3361426_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.8e-13	27.3

DBSCAN-SWA_252

3365063 : 3366032

Salmonella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023279773.1\|3365063_3366032_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-180	96.6

DBSCAN-SWA_253

3370164 : 3371085

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003035957.1\|3370164_3371085_-	curved DNA-binding protein	A0A1V0SIM1	Klosneuvirus	3.6e-10	39.0

DBSCAN-SWA_254

3383898 : 3384594

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836817.1\|3383898_3384594_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.9e-17	33.2

DBSCAN-SWA_255

3389796 : 3389970

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036022.1\|3389796_3389970_+	general stress protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6

DBSCAN-SWA_256

3396737 : 3397718

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|3396737_3397718_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1

DBSCAN-SWA_257

3403949 : 3404858

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086529159.1\|3403949_3404858_+	phosphate starvation-inducible protein PhoH	R4II13	Cronobacter_phage	6.9e-91	77.1

DBSCAN-SWA_258

3410103 : 3413908

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134215860.1\|3410103_3411042_+	glyoxylate/hydroxypyruvate reductase GhrA	A0A1B1IVB5	uncultured_Mediterranean_phage	3.2e-06	28.5
WP_003836800.1\|3411128_3411866_+	phosphatase	NA	NA	NA	NA
WP_003836798.1\|3411889_3412444_+	molecular chaperone	NA	NA	NA	NA
WP_044700707.1\|3412545_3413028_+	DUF1097 domain-containing protein	NA	NA	NA	NA
WP_003036082.1\|3413074_3413908_-	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	3.0e-40	39.7

DBSCAN-SWA_259

3418097 : 3418640

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670455.1\|3418097_3418640_+	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	1.9e-27	49.3

DBSCAN-SWA_260

3426856 : 3430638

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670459.1\|3426856_3428278_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.2e-19	36.7
WP_046670460.1\|3428341_3429562_-	multidrug efflux MFS transporter MdtG	NA	NA	NA	NA
WP_003036136.1\|3429717_3430638_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferasee	A0A1W6JP29	Morganella_phage	1.0e-57	41.6

DBSCAN-SWA_261

3435356 : 3435602

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036157.1\|3435356_3435602_-	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	1.1e-14	50.0

DBSCAN-SWA_262

3450838 : 3451789

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836755.1\|3450838_3451789_+	flagellar assembly peptidoglycan hydrolase FlgJ	S5M633	Brevibacillus_phage	1.6e-10	30.9

DBSCAN-SWA_263

3466526 : 3467653

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036255.1\|3466526_3467261_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	7.7e-16	34.1
WP_000103754.1\|3467416_3467653_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.5e-10	45.2

DBSCAN-SWA_264

3470939 : 3476951

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003036268.1\|3470939_3471581_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.3e-27	38.2
WP_162648479.1\|3471577_3472582_+	DNA polymerase III subunit delta'	A0A1V0DYC6	Dinoroseobacter_phage	8.1e-08	34.8
WP_003036276.1\|3472592_3473390_+	metal-dependent hydrolase	NA	NA	NA	NA
WP_003036277.1\|3473683_3475117_+	PTS glucose transporter subunit IIBC	NA	NA	NA	NA
WP_162648480.1\|3475172_3476951_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	2.4e-79	33.3

DBSCAN-SWA_265

3481991 : 3483716

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648482.1\|3481991_3482759_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-12	27.5
WP_162648483.1\|3482759_3483716_-	Fe(3+) dicitrate ABC transporter permease subunit FecD	A0A2H4IY97	uncultured_Caudovirales_phage	5.3e-17	27.3

DBSCAN-SWA_266

3521775 : 3522033

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030810.1\|3521775_3522033_+	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	2.8e-05	35.7

DBSCAN-SWA_267

3529316 : 3537027

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030805.1\|3529316_3530018_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.9e-36	40.3
WP_003030804.1\|3530017_3531262_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_003030802.1\|3531351_3532263_+	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_003030799.1\|3532278_3533100_+	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	3.3e-23	36.1
WP_003030797.1\|3533199_3534246_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
WP_003030794.1\|3534273_3535053_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
WP_046670510.1\|3535049_3535907_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	4.3e-10	25.8
WP_003030791.1\|3535890_3537027_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	7.2e-29	40.3

DBSCAN-SWA_268

3542119 : 3596990

Enterobacteria_phage(37.5%)

holin,terminase,integrase,tail,portal,tRNA,head,capsid

attL 3548923:3548940|attR 3595629:3595646

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003841884.1\|3542119_3543490_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-107	44.6
WP_003841885.1\|3543493_3544135_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_003832402.1\|3544169_3545276_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_003841887.1\|3545329_3545791_-	NUDIX hydrolase	NA	NA	NA	NA
WP_052946586.1\|3545800_3546733_-	hypothetical protein	NA	NA	NA	NA
WP_162648487.1\|3546767_3547385_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_003030769.1\|3547587_3548838_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	9.4e-22	94.4
3548923:3548940	attL	NA	NA	NA	NA
WP_162648488.1\|3548950_3550093_-\|integrase	tyrosine-type recombinase/integrase	Q77Z04	Phage_21	2.2e-174	81.1
WP_047497692.1\|3550082_3550319_-	excisionase	NA	NA	NA	NA
WP_162648825.1\|3550622_3551702_-	RelA/SpoT domain-containing protein	A0A1B0VBT5	Salmonella_phage	6.6e-56	39.2
WP_162648489.1\|3552437_3552650_+	hypothetical protein	NA	NA	NA	NA
WP_162648490.1\|3552833_3553328_+	hypothetical protein	K7P861	Enterobacteria_phage	2.8e-78	91.5
WP_162648491.1\|3553678_3554305_-	LexA family transcriptional regulator	K7PM82	Enterobacteria_phage	3.2e-47	49.3
WP_003826141.1\|3554407_3554635_+	cell division protein	NA	NA	NA	NA
WP_003826142.1\|3554645_3555197_+	hypothetical protein	A0A1C9II13	Salmonella_phage	6.1e-66	68.4
WP_003034732.1\|3555369_3555549_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.0e-14	73.1
WP_008784459.1\|3555538_3556396_+	GntR family transcriptional regulator	A0A1C9IHW0	Salmonella_phage	3.7e-62	96.7
WP_162648492.1\|3556392_3557274_+	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	4.7e-129	75.3
WP_162648493.1\|3557266_3559273_+	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	2.9e-198	52.6
WP_162648494.1\|3559269_3559656_+	RusA family crossover junction endodeoxyribonuclease	A0A192Y8N5	Salmonella_phage	1.6e-60	88.4
WP_003034743.1\|3559669_3560356_+	phage regulatory protein/antirepressor Ant	G0ZND1	Cronobacter_phage	9.9e-58	53.8
WP_162648495.1\|3560352_3561348_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.1e-142	69.3
WP_162648496.1\|3561369_3562059_+	antitermination protein	NA	NA	NA	NA
WP_162648497.1\|3562203_3562752_+	hypothetical protein	NA	NA	NA	NA
WP_162648498.1\|3562862_3563072_+	hypothetical protein	NA	NA	NA	NA
WP_162648499.1\|3563142_3563529_+	hypothetical protein	A0A192Y8P2	Salmonella_phage	6.2e-57	93.0
WP_162648500.1\|3563515_3563797_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	2.6e-20	48.4
WP_162648501.1\|3563796_3564411_+	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	1.0e-90	80.4
WP_162648502.1\|3564418_3564688_+	hypothetical protein	G8C7W1	Escherichia_phage	4.5e-22	71.3
WP_162648503.1\|3565066_3565633_-	hypothetical protein	NA	NA	NA	NA
WP_000453624.1\|3566239_3566785_+\|terminase	terminase small subunit	E4WL18	Enterobacteria_phage	1.2e-95	100.0
WP_162648504.1\|3566759_3568682_+\|terminase	phage terminase large subunit family protein	E4WL19	Enterobacteria_phage	0.0e+00	97.8
WP_003034782.1\|3568681_3568888_+\|head,tail	head-tail joining protein	K7PM10	Enterobacteria_phage	3.2e-28	95.5
WP_047497651.1\|3568884_3570477_+\|portal	phage portal protein	E4WL21	Enterobacteria_phage	1.7e-289	92.1
WP_162648505.1\|3570457_3571795_+	S49 family peptidase	O64320	Escherichia_phage	3.1e-188	83.4
WP_003034794.1\|3571804_3572137_+\|head	head decoration protein	E4WL24	Enterobacteria_phage	8.5e-47	81.8
WP_003034798.1\|3572204_3573230_+\|capsid	major capsid protein	K7PGW9	Enterobacteria_phage	1.9e-182	92.7
WP_049001735.1\|3573274_3573679_+	DNA-packaging protein	K7P7M3	Enterobacteria_phage	1.2e-23	53.5
WP_162648506.1\|3573690_3574044_+\|tail	phage tail protein	K7P6U9	Enterobacteria_phage	5.8e-46	74.4
WP_162648507.1\|3574053_3574608_+\|tail	phage tail protein	K7P7A8	Enterobacteria_phage	1.0e-73	91.4
WP_032938647.1\|3574604_3575003_+\|tail	tail protein	K7P7G5	Enterobacteria_phage	6.1e-60	81.8
WP_162648508.1\|3575010_3575748_+\|tail	phage tail protein	O64327	Escherichia_phage	3.1e-89	66.5
WP_162648509.1\|3575784_3576192_+\|tail	phage minor tail protein G	K7PM17	Enterobacteria_phage	2.7e-26	60.7
WP_071524448.1\|3576200_3576521_+\|tail	phage tail assembly protein T	K7PHE1	Enterobacteria_phage	2.7e-34	69.8
WP_162648510.1\|3576498_3579027_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	7.4e-292	66.9
WP_162648511.1\|3579027_3579243_+	hypothetical protein	NA	NA	NA	NA
WP_162648512.1\|3579326_3579674_+\|tail	phage tail protein	K7PJT2	Enterobacteria_phage	3.6e-40	71.3
WP_162648513.1\|3579670_3580426_+\|tail	phage minor tail protein L	K7PGX3	Enterobacteria_phage	6.3e-130	86.1
WP_162648514.1\|3580427_3581138_+	peptidase P60	K7PGR2	Enterobacteria_phage	4.4e-133	90.2
WP_162648515.1\|3581358_3582090_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_162648071.1\|3582188_3582365_+	hypothetical protein	NA	NA	NA	NA
WP_162648516.1\|3582438_3583020_+	Bro-N domain-containing protein	H6WRU8	Salmonella_phage	1.8e-28	41.2
WP_162648517.1\|3583098_3583830_+	transcriptional regulator	A0A0H5AUF7	Pseudomonas_phage	6.0e-37	39.9
WP_162648518.1\|3583939_3584275_+	hypothetical protein	Q6UAW3	Klebsiella_phage	3.2e-17	40.5
WP_048216425.1\|3584328_3584931_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	7.8e-75	72.3
WP_162648519.1\|3588164_3588479_+	hypothetical protein	O64336	Escherichia_phage	2.7e-26	58.7
WP_162648533.1\|3588479_3589154_+	hypothetical protein	O64337	Escherichia_phage	1.3e-54	52.0
WP_162648534.1\|3589560_3591117_+\|tail	tail fiber domain-containing protein	O64338	Escherichia_phage	9.4e-88	44.0
WP_088731923.1\|3591245_3591488_-	DinI family protein	Q6UAW0	Klebsiella_phage	2.6e-29	76.6
WP_162648614.1\|3591807_3592197_+	LexA family transcriptional regulator	Q71TH8	Escherichia_phage	7.3e-50	71.3
WP_162648616.1\|3592197_3592866_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	5.8e-79	59.0
WP_162648618.1\|3593421_3594324_-	hypothetical protein	NA	NA	NA	NA
WP_162648620.1\|3594323_3595319_-	DGQHR domain-containing protein	NA	NA	NA	NA
WP_162648622.1\|3595715_3595928_+	isocitrate dehydrogenase	Q77Z09	Phage_21	9.3e-23	94.4
3595629:3595646	attR	NA	NA	NA	NA
WP_003030767.1\|3596063_3596573_-	hypothetical protein	NA	NA	NA	NA
WP_162648624.1\|3596747_3596990_-	DinI family protein	Q6UAW0	Klebsiella_phage	1.3e-28	76.6

DBSCAN-SWA_269

3600635 : 3603184

uncultured_Caudovirales_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030762.1\|3600635_3600956_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	3.2e-19	44.8
WP_162648626.1\|3601000_3602290_+	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	2.1e-165	70.0
WP_003030760.1\|3602302_3602728_+	glutaredoxin-dependent arsenate reductase	A0A2H4J8T1	uncultured_Caudovirales_phage	7.3e-51	70.7
WP_075206724.1\|3602971_3603184_+	isocitrate dehydrogenase	Q77Z09	Phage_21	4.6e-22	90.7

DBSCAN-SWA_270

3622974 : 3624000

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648634.1\|3622974_3624000_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.8e-10	26.3

DBSCAN-SWA_271

3628905 : 3632679

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846667.1\|3628905_3630396_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.4e-11	28.8
WP_046670557.1\|3630559_3631330_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003030708.1\|3631395_3632679_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	1.9e-09	26.6

DBSCAN-SWA_272

3640644 : 3641898

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648636.1\|3640644_3641898_-	glycoside hydrolase family 18 protein	A0A2K9L3D4	Tupanvirus	1.5e-24	29.8

DBSCAN-SWA_273

3645462 : 3646446

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003846646.1\|3645462_3646446_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.3e-06	23.4

DBSCAN-SWA_274

3649654 : 3650299

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155267879.1\|3649654_3650299_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	9.4e-18	37.2

DBSCAN-SWA_275

3655127 : 3657074

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044700023.1\|3655127_3657074_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.3e-40	29.7

DBSCAN-SWA_276

3662153 : 3662786

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670561.1\|3662153_3662786_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.6e-12	32.3

DBSCAN-SWA_277

3668320 : 3669541

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003840894.1\|3668320_3669541_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.2e-27	28.6

DBSCAN-SWA_278

3677087 : 3677918

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936096.1\|3677087_3677918_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.0e-73	54.9

DBSCAN-SWA_279

3684066 : 3689816

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670572.1\|3684066_3686325_-	catalase HPII	A0A2K9L572	Tupanvirus	1.7e-138	47.6
WP_080602219.1\|3686526_3686781_+	cell division activator CedA	NA	NA	NA	NA
WP_162648694.1\|3686844_3688236_-	L-cystine transporter	NA	NA	NA	NA
WP_085951595.1\|3688371_3688971_-	metal-dependent hydrolase	A0A127AVX7	Bacillus_phage	7.7e-06	34.3
WP_046670573.1\|3689054_3689816_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	3.1e-20	32.1

DBSCAN-SWA_280

3695083 : 3708671

Tupanvirus(22.22%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003832572.1\|3695083_3697012_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.4e-127	36.8
WP_048997935.1\|3697015_3697558_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	8.2e-15	32.9
WP_003030583.1\|3697654_3697852_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_003030578.1\|3697907_3698264_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_152659856.1\|3698302_3698434_+	pheST operon leader peptide PheM	NA	NA	NA	NA
WP_003832580.1\|3698633_3699617_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.4e-33	38.5
WP_003030574.1\|3699632_3702020_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_003030571.1\|3702024_3702324_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
WP_003832584.1\|3702477_3703458_+	vitamin B12 ABC transporter permease BtuC	A0A2H4IY97	uncultured_Caudovirales_phage	6.7e-15	24.8
WP_003030569.1\|3703518_3704070_+	glutathione peroxidase	NA	NA	NA	NA
WP_003030567.1\|3704069_3704819_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	9.3e-09	30.3
WP_003836644.1\|3704896_3705361_+	lipoprotein nlpC	A0A1V0DZX6	Clostridioides_phage	3.5e-14	38.2
WP_003836643.1\|3705677_3706391_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003843460.1\|3706452_3707895_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	7.7e-52	35.3
WP_046670579.1\|3707891_3708671_-	heme ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.3e-10	26.8

DBSCAN-SWA_281

3713969 : 3720387

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030555.1\|3713969_3715016_-	3-deoxy-7-phosphoheptulonate synthase AroH	A0A0B5IW14	Pandoravirus	8.8e-82	47.1
WP_003030553.1\|3715142_3715976_-	posphoenolpyruvate synthetase regulatory kinase/phosphorylase PpsR	NA	NA	NA	NA
WP_032935925.1\|3716303_3718682_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.9e-170	36.3
WP_096890456.1\|3718749_3720387_-	medium-chain fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.2e-32	29.9

DBSCAN-SWA_282

3740860 : 3745951

Lake_Baikal_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029385.1\|3740860_3741229_+	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	5.6e-15	39.4
WP_003029384.1\|3741237_3742725_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_003029383.1\|3742741_3743488_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	3.0e-07	25.0
WP_003836582.1\|3743462_3744734_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_046670591.1\|3744730_3745951_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	5.6e-96	42.6

DBSCAN-SWA_283

3754739 : 3764973

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670595.1\|3754739_3755762_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.1e-27	34.2
WP_003029361.1\|3755754_3756423_+	ABC transporter permease	NA	NA	NA	NA
WP_003029358.1\|3756444_3757257_+	methionine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_046670596.1\|3757465_3757882_-	hypothetical protein	NA	NA	NA	NA
WP_003843488.1\|3757850_3758819_-	hypothetical protein	A0A2H4J6N0	uncultured_Caudovirales_phage	2.7e-16	25.2
WP_162648707.1\|3760157_3763223_-	tetrathionate reductase subunit TtrA	A0A077SK27	Escherichia_phage	9.4e-07	26.4
WP_086529208.1\|3763215_3764238_-	tetrathionate reductase subunit TtrC	NA	NA	NA	NA
WP_003029352.1\|3764238_3764973_-	tetrathionate reductase subunit TtrB	A0A077SL61	Escherichia_phage	8.5e-23	40.0

DBSCAN-SWA_284

3771865 : 3776412

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670786.1\|3771865_3772534_+	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	4.1e-24	37.8
WP_162648709.1\|3772530_3773316_+	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_032947969.1\|3773319_3774132_+	hypothetical protein	A0A077K9W7	Edwardsiella_phage	6.8e-05	32.5
WP_162648711.1\|3774141_3774819_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_048216513.1\|3774808_3775594_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003029322.1\|3775593_3776412_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-37	43.6

DBSCAN-SWA_285

3786346 : 3792167

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648714.1\|3786346_3787822_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.5e-15	27.8
WP_162648715.1\|3787928_3789191_+	4-aminobutyrate transaminase	A0A1V0SKB7	Klosneuvirus	2.3e-20	25.4
WP_003029285.1\|3789371_3790427_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_162648716.1\|3790413_3791418_+	iron ABC transporter permease	NA	NA	NA	NA
WP_162648717.1\|3791414_3792167_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.3e-07	29.7

DBSCAN-SWA_286

3800808 : 3807847

Escherichia_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063841712.1\|3800808_3801789_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	5.2e-185	99.1
WP_032935863.1\|3802979_3803984_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003029251.1\|3804185_3805970_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.8e-19	35.0
WP_044712332.1\|3806089_3807199_-	AI-2E family transporter	NA	NA	NA	NA
WP_003843523.1\|3807364_3807847_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	1.9e-23	41.4

DBSCAN-SWA_287

3814466 : 3825508

Bodo_saltans_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836466.1\|3814466_3815165_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.7e-09	29.4
WP_048216502.1\|3815204_3816578_-	multidrug efflux MATE transporter MdtK	NA	NA	NA	NA
WP_003832752.1\|3816795_3817443_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.2e-23	37.3
WP_044699909.1\|3817484_3818633_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	1.6e-84	44.9
WP_003836456.1\|3818923_3820129_-	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003029215.1\|3820242_3821175_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003029211.1\|3821171_3822197_-	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	8.2e-32	31.3
WP_003029209.1\|3822494_3822584_+	stress response protein YnhF	NA	NA	NA	NA
WP_003029207.1\|3822759_3823929_+	MFS transporter	NA	NA	NA	NA
WP_003029205.1\|3823968_3824550_-	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	3.4e-43	46.0
WP_003029203.1\|3824677_3825508_-	C40 family peptidase	A0A2H5BM69	Streptomyces_phage	2.4e-18	41.6

DBSCAN-SWA_288

3830610 : 3831135

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029187.1\|3830610_3831135_+	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	1.7e-46	55.7

DBSCAN-SWA_289

3838053 : 3839328

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003029168.1\|3838053_3839328_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	6.5e-87	42.6

DBSCAN-SWA_290

3864346 : 3865648

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670790.1\|3864346_3865648_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	6.8e-15	23.8

DBSCAN-SWA_291

3886776 : 3888986

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028928.1\|3886776_3887499_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-35	36.6
WP_162648729.1\|3887495_3888986_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.1e-24	30.3

DBSCAN-SWA_292

3895643 : 3907544

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003028918.1\|3895643_3896258_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	4.0e-26	36.0
WP_046670656.1\|3896300_3897155_-	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_003843596.1\|3897156_3897774_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	2.1e-75	59.1
WP_162648730.1\|3897784_3900223_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	2.0e-214	48.3
WP_085954018.1\|3900371_3900680_-	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_016150222.1\|3900746_3901493_+	YnfC family lipoprotein	NA	NA	NA	NA
WP_003032379.1\|3901500_3902061_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_003032382.1\|3902096_3902438_-	DUF1283 family protein	NA	NA	NA	NA
WP_003032384.1\|3902591_3902918_+	YnfA family protein	A0A218MNG8	uncultured_virus	2.2e-23	54.9
WP_003032386.1\|3903025_3904240_+	starvation-sensing protein RspA	Q6A202	Oenococcus_phage	2.5e-48	29.9
WP_003836325.1\|3904300_3905635_+	MHS family MFS transporter	NA	NA	NA	NA
WP_162648731.1\|3905798_3907265_+	fructuronate reductase	H8ZJP8	Ostreococcus_tauri_virus	1.9e-45	32.4
WP_003032393.1\|3907340_3907544_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	2.9e-13	55.2

DBSCAN-SWA_293

3912142 : 3913069

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836309.1\|3912142_3913069_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.2e-19	36.0

DBSCAN-SWA_294

3917896 : 3922394

Cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061548256.1\|3917896_3918694_+	urea ABC transporter ATP-binding protein UrtD	A0A285PWH2	Cedratvirus	3.6e-11	27.0
WP_106107357.1\|3918703_3919402_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	3.4e-13	25.6
WP_162648733.1\|3919445_3920633_-	efflux MFS transporter YdeE	NA	NA	NA	NA
WP_162648734.1\|3920831_3921731_+	O-acetylserine/cysteine exporter	NA	NA	NA	NA
WP_003032422.1\|3921761_3921980_-	multiple antibiotic resistance protein MarB	NA	NA	NA	NA
WP_003032424.1\|3922010_3922394_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	3.6e-09	32.3

DBSCAN-SWA_295

3927696 : 3929274

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670672.1\|3927696_3929274_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-10	21.1

DBSCAN-SWA_296

3949466 : 3951206

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110248477.1\|3949466_3951206_+	type I secretion system permease/ATPase	F2Y1V6	Organic_Lake_phycodnavirus	7.7e-14	29.8

DBSCAN-SWA_297

3956663 : 3958607

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003019994.1\|3956663_3958607_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-11	32.8

DBSCAN-SWA_298

3964496 : 3966411

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020012.1\|3964496_3965483_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.2e-17	31.5
WP_048216466.1\|3965475_3966411_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-14	29.2

DBSCAN-SWA_299

3977285 : 3979683

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648741.1\|3977285_3979001_+	ABC-F family ATP-binding cassette domain-containing protein	A0A1B0RXA0	Streptococcus_phage	3.2e-36	26.1
WP_054528391.1\|3979080_3979683_-	inorganic diphosphatase	A0A1B1ISK6	uncultured_Mediterranean_phage	4.5e-22	39.1

DBSCAN-SWA_300

3986037 : 3987120

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836220.1\|3986037_3987120_+	porin OmpD	Q1MVN1	Enterobacteria_phage	4.2e-143	70.4

DBSCAN-SWA_301

3995210 : 3996755

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020103.1\|3995210_3996755_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_302

4006836 : 4007610

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003836184.1\|4006836_4007610_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-18	31.0

DBSCAN-SWA_303

4011510 : 4016702

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000019445.1\|4011510_4012491_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
WP_162648745.1\|4012536_4013655_-	amidohydrolase	NA	NA	NA	NA
WP_003836173.1\|4013654_4014653_-	MsnO8 family LLM class oxidoreductase	NA	NA	NA	NA
WP_046670710.1\|4015160_4016702_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	8.3e-36	52.6

DBSCAN-SWA_304

4037465 : 4041891

Mycoplasma_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058842662.1\|4037465_4038482_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.5e-25	37.4
WP_003020212.1\|4038498_4039644_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003843728.1\|4039972_4041382_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_123924900.1\|4041474_4041891_-	type II toxin-antitoxin system HicB family antitoxin	F1C593	Cronobacter_phage	6.9e-30	55.6

DBSCAN-SWA_305

4045339 : 4047301

Phage_TP(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048217777.1\|4045339_4047301_-	U32 family peptidase	Q6DW11	Phage_TP	2.1e-23	27.8

DBSCAN-SWA_306

4069159 : 4072136

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670731.1\|4069159_4070848_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-15	28.2
WP_003020293.1\|4071017_4072136_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	3.6e-33	29.6

DBSCAN-SWA_307

4078890 : 4081284

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670733.1\|4078890_4080159_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	2.9e-196	77.9
WP_003020321.1\|4080161_4080581_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	3.9e-33	58.5
WP_044700084.1\|4080753_4081284_-	cytochrome b561	A0A0U2QLA7	Escherichia_phage	1.4e-19	44.9

DBSCAN-SWA_308

4086086 : 4089989

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046670738.1\|4086086_4089989_-	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	7.6e-54	29.7

DBSCAN-SWA_309

4094930 : 4095920

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020354.1\|4094930_4095920_+	2-hydroxyacid dehydrogenase	M1HMI7	Paramecium_bursaria_Chlorella_virus	3.3e-70	42.8

DBSCAN-SWA_310

4100898 : 4113389

Enterobacteria_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032935630.1\|4100898_4102053_+	porin OmpC	Q1MVN1	Enterobacteria_phage	1.5e-114	56.7
WP_003020366.1\|4102198_4102411_+	KTSC domain-containing protein	NA	NA	NA	NA
WP_003020369.1\|4102492_4102927_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	9.4e-30	52.1
WP_046670740.1\|4103125_4104061_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	1.4e-139	93.8
WP_046670742.1\|4104154_4105528_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.1e-53	32.0
WP_003020379.1\|4106000_4106984_-	zinc transporter ZntB	NA	NA	NA	NA
WP_016150306.1\|4107136_4108246_-	hypothetical protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-09	23.0
WP_003843936.1\|4108657_4110772_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	3.4e-16	31.0
WP_003843938.1\|4110839_4112072_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.0e-17	34.4
WP_003843940.1\|4112084_4112648_-	DNA endonuclease SmrA	NA	NA	NA	NA
WP_003840811.1\|4112873_4113389_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	1.2e-23	54.5

DBSCAN-SWA_311

4117059 : 4119016

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003843945.1\|4117059_4117569_-	zinc-binding dehydrogenase	A0A2K9L7I1	Tupanvirus	2.1e-28	42.9
WP_046670747.1\|4117741_4118125_-	hypothetical protein	NA	NA	NA	NA
WP_003843948.1\|4118245_4119016_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.6e-18	29.1

DBSCAN-SWA_312

4131303 : 4132386

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648752.1\|4131303_4132386_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-23	34.7

DBSCAN-SWA_313

4151121 : 4152922

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020556.1\|4151121_4152114_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	4.7e-08	24.7
WP_003020558.1\|4152115_4152922_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	1.3e-13	27.4

DBSCAN-SWA_314

4156312 : 4158247

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150330.1\|4156312_4158247_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	4.5e-07	24.5

DBSCAN-SWA_315

4166148 : 4166739

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020601.1\|4166148_4166739_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.7e-43	48.4

DBSCAN-SWA_316

4171583 : 4176971

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648757.1\|4171583_4174181_-	type I DNA topoisomerase	A0A2K9L1Q2	Tupanvirus	2.5e-85	34.7
WP_003020616.1\|4174579_4174831_+	YciN family protein	NA	NA	NA	NA
WP_003843986.1\|4174941_4175988_-\|protease	protease SohB	NA	NA	NA	NA
WP_003843987.1\|4176209_4176971_+	YciK family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	3.0e-07	23.7

DBSCAN-SWA_317

4181949 : 4188422

Acinetobacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020639.1\|4181949_4183545_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	3.2e-51	38.6
WP_136397635.1\|4183548_4184907_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	7.8e-38	40.7
WP_003020645.1\|4184917_4186111_+	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_162648758.1\|4186110_4186917_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_003841287.1\|4186949_4188422_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.2e-17	30.4

DBSCAN-SWA_318

4197413 : 4200310

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020693.1\|4197413_4198250_-	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.4e-08	40.0
WP_003020696.1\|4198295_4199300_-	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppF	G3M9Y6	Bacillus_virus	6.8e-15	30.2
WP_003833364.1\|4199296_4200310_-	murein tripeptide/oligopeptide ABC transporter ATP binding protein OppD	G9BWD6	Planktothrix_phage	4.5e-14	29.4

DBSCAN-SWA_319

4208741 : 4219162

Citrobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020720.1\|4208741_4209359_-	thymidine kinase	A0A0A0YP64	Citrobacter_phage	8.6e-53	54.3
WP_003020723.1\|4209969_4210383_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
WP_003020727.1\|4210519_4211428_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.7e-60	47.5
WP_003020729.1\|4211632_4212646_-	two-component system response regulator RssB	NA	NA	NA	NA
WP_003020732.1\|4212736_4213648_-	patatin-like phospholipase RssA	NA	NA	NA	NA
WP_003020734.1\|4213759_4214215_+	YchJ family protein	NA	NA	NA	NA
WP_003020737.1\|4214270_4215113_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	9.8e-15	48.8
WP_003020743.1\|4216239_4216917_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_003020745.1\|4216916_4217627_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_003020747.1\|4217623_4219162_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.8e-19	40.5

DBSCAN-SWA_320

4232384 : 4236391

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020772.1\|4232384_4233239_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	2.4e-45	38.8
WP_003020775.1\|4233274_4234084_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
WP_003020779.1\|4234086_4234479_-	SirB family protein	NA	NA	NA	NA
WP_162648760.1\|4234475_4235309_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_106108095.1\|4235308_4236391_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	38.8

DBSCAN-SWA_321

4239638 : 4245378

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001518537.1\|4239638_4240586_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	8.6e-44	37.8
WP_003020797.1\|4240710_4242393_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	1.3e-21	22.5
WP_096878375.1\|4242513_4243977_-	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_096878374.1\|4243992_4245378_-	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	3.0e-29	26.6

DBSCAN-SWA_322

4258286 : 4259018

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020862.1\|4258286_4259018_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.4e-54	50.3

DBSCAN-SWA_323

4273091 : 4273853

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046671111.1\|4273091_4273853_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	7.5e-14	31.1

DBSCAN-SWA_324

4297211 : 4304561

Staphylococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003020970.1\|4297211_4298897_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	3.4e-35	25.3
WP_003020975.1\|4299101_4299686_-	Slp family lipoprotein	NA	NA	NA	NA
WP_046671124.1\|4299780_4300476_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	A0A0R6PI74	Moraxella_phage	5.8e-05	35.4
WP_003020980.1\|4300534_4302445_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	9.1e-93	33.1
WP_003020984.1\|4302585_4302930_+	RidA family protein	NA	NA	NA	NA
WP_003020986.1\|4302936_4303116_-	YoaH family protein	NA	NA	NA	NA
WP_046671126.1\|4303199_4304561_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	8.3e-40	40.2

DBSCAN-SWA_325

4308429 : 4309989

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844070.1\|4308429_4309989_-	CNNM family cation transport protein YoaE	A0A0R6PEZ3	Moraxella_phage	5.1e-41	45.4

DBSCAN-SWA_326

4317486 : 4317696

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062678.1\|4317486_4317696_-	transcription antiterminator/RNA stability regulator CspE	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_327

4322969 : 4325018

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034960.1\|4322969_4325018_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-87	33.7

DBSCAN-SWA_328

4332464 : 4336951

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034937.1\|4332464_4333106_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	8.7e-56	50.5
WP_003034934.1\|4333518_4333857_-	YebY family protein	NA	NA	NA	NA
WP_032935389.1\|4333877_4334750_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003034928.1\|4334753_4335128_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_003034925.1\|4335271_4335502_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.0e-14	60.3
WP_003841657.1\|4335608_4336265_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_003833802.1\|4336288_4336951_+	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	9.1e-08	31.1

DBSCAN-SWA_329

4344700 : 4346176

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034896.1\|4344700_4346176_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.3e-78	37.1

DBSCAN-SWA_330

4350108 : 4356315

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034883.1\|4350108_4351428_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	36.8
WP_003844151.1\|4351443_4352388_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_046671223.1\|4352466_4353222_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	5.0e-18	28.3
WP_003034874.1\|4353218_4354004_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_003034872.1\|4354082_4355093_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.6e-08	25.4
WP_003844153.1\|4355101_4355713_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_003034867.1\|4355793_4356315_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1

DBSCAN-SWA_331

4360168 : 4366715

Escherichia_coli_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069219593.1\|4360168_4360987_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.0e-56	79.5
WP_003034689.1\|4361039_4361435_+	membrane protein	NA	NA	NA	NA
WP_003034686.1\|4361475_4362219_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	3.2e-25	31.3
WP_003839177.1\|4362215_4363184_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_032936856.1\|4363427_4364174_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_003034677.1\|4364176_4364743_-	VOC family protein	NA	NA	NA	NA
WP_162648773.1\|4364981_4366715_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	7.5e-86	34.1

DBSCAN-SWA_332

4374727 : 4385788

Bacillus_thuringiensis_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003034656.1\|4374727_4375117_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3
WP_003839158.1\|4375134_4376184_-	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	1.8e-05	32.0
WP_003034649.1\|4376180_4377053_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_003844172.1\|4377072_4378674_-	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9
WP_032936849.1\|4378717_4380373_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-08	24.8
WP_003839151.1\|4380779_4382051_+	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_162648774.1\|4382161_4385788_-	autotransporter outer membrane beta-barrel domain-containing protein	A0A2L1IV18	Escherichia_phage	1.3e-28	24.7

DBSCAN-SWA_333

4396181 : 4397696

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936845.1\|4396181_4397696_-	arabinose ABC transporter ATP binding protein AraG	A0A2H4PQG7	Staphylococcus_phage	6.2e-12	26.6

DBSCAN-SWA_334

4416304 : 4417057

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030477.1\|4416304_4417057_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	6.4e-26	34.4

DBSCAN-SWA_335

4443775 : 4448040

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936825.1\|4443775_4444243_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	3.7e-32	46.9
WP_162648780.1\|4444223_4445654_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.6e-102	55.2
WP_003839062.1\|4445730_4446423_-	phosphohydrolase	S4W232	Pandoravirus	8.0e-07	27.1
WP_069219584.1\|4446864_4448040_+	porin	Q1MVN1	Enterobacteria_phage	2.9e-105	55.3

DBSCAN-SWA_336

4453113 : 4453797

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030299.1\|4453113_4453797_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-27	32.7

DBSCAN-SWA_337

4458766 : 4459582

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003839037.1\|4458766_4459582_-	energy-coupling factor ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.5e-07	24.2

DBSCAN-SWA_338

4473076 : 4473886

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030258.1\|4473076_4473886_-	propanediol diffusion facilitator PduF	M1HWZ0	Paramecium_bursaria_Chlorella_virus	1.7e-11	27.8

DBSCAN-SWA_339

4493542 : 4496197

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032936755.1\|4493542_4494715_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	1.1e-197	86.7
WP_003844268.1\|4494854_4495622_-	thiosulfate reductase cytochrome B subunit	NA	NA	NA	NA
WP_003844270.1\|4495618_4496197_-	thiosulfate reductase electron transport protein PhsB	A0A077SL61	Escherichia_phage	2.1e-21	38.0

DBSCAN-SWA_340

4504161 : 4505061

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003030161.1\|4504161_4505061_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_341

4512644 : 4516480

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648784.1\|4512644_4513649_+	NAD-dependent epimerase	A0A0K0KW07	Prochlorococcus_phage	3.3e-17	31.7
WP_151219744.1\|4513708_4514875_-	UDP-glucose 6-dehydrogenase	M1I798	Paramecium_bursaria_Chlorella_virus	1.5e-114	55.3
WP_162648785.1\|4515073_4516480_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	1.8e-37	28.5

DBSCAN-SWA_342

4520808 : 4529520

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648789.1\|4520808_4521930_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	3.2e-29	28.3
WP_162648790.1\|4521943_4523182_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_162648791.1\|4523229_4523778_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.2e-50	57.2
WP_162648792.1\|4523779_4524658_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.1e-107	64.1
WP_162648793.1\|4524708_4525608_-	dTDP-4-dehydrorhamnose reductase	A0A140G5S3	Enterobacteria_phage	1.8e-30	35.3
WP_162648794.1\|4525607_4526693_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.4e-98	53.1
WP_162648795.1\|4527066_4527960_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	1.6e-44	41.0
WP_139935542.1\|4528125_4529520_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.0e-21	34.6

DBSCAN-SWA_343

4534981 : 4541718

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648796.1\|4534981_4536352_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	8.4e-32	26.7
WP_162648797.1\|4536487_4537924_-	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	1.3e-54	32.1
WP_049002527.1\|4537926_4539150_-	colanic acid biosynthesis fucosyltransferase WcaI	NA	NA	NA	NA
WP_046670042.1\|4539146_4539626_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
WP_003841801.1\|4539628_4540594_-	GDP-L-fucose synthase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	6.9e-89	51.6
WP_088903297.1\|4540596_4541718_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	65.5

DBSCAN-SWA_344

4545464 : 4556103

Streptococcus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844327.1\|4545464_4545953_-	colanic acid biosynthesis acetyltransferase WcaB	A0A191KBJ5	Streptococcus_virus	1.2e-09	41.0
WP_044711337.1\|4545955_4546798_-	colanic acid biosynthesis glycosyltransferase WcaA	NA	NA	NA	NA
WP_003841788.1\|4546870_4549033_-	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	2.9e-18	30.8
WP_139935551.1\|4549029_4549479_-	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
WP_044711342.1\|4549484_4550624_-	polysaccharide export protein	NA	NA	NA	NA
WP_003841782.1\|4551280_4552864_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.5e-37	44.9
WP_130714521.1\|4552908_4554762_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
WP_003036774.1\|4554788_4555370_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	3.2e-33	43.2
WP_003036776.1\|4555461_4556103_-	uridine kinase	A0A1V0SAA3	Catovirus	2.2e-35	38.3

DBSCAN-SWA_345

4566881 : 4580948

Bacillus_phage(25.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648802.1\|4566881_4569962_+	multidrug efflux RND transporter permease subunit MdtC	S5VTK5	Leptospira_phage	7.6e-65	22.7
WP_049014337.1\|4569958_4571371_+	MFS transporter	NA	NA	NA	NA
WP_003844344.1\|4571370_4572774_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	5.0e-32	29.2
WP_003036797.1\|4572770_4573493_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	9.2e-30	32.7
WP_003841759.1\|4573628_4573961_+	YegP family protein	NA	NA	NA	NA
WP_003844346.1\|4574120_4575482_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.1e-204	92.9
WP_003036804.1\|4575751_4578028_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.1
WP_003036810.1\|4578058_4578379_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.5e-13	45.7
WP_003036813.1\|4578702_4578927_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
WP_003840216.1\|4579001_4580948_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.4e-40	41.8

DBSCAN-SWA_346

4592197 : 4593916

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027264.1\|4592197_4593916_+	ubiquinone-dependent pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	8.9e-31	23.8

DBSCAN-SWA_347

4599629 : 4600358

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027295.1\|4599629_4600358_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.1e-27	36.0

DBSCAN-SWA_348

4603622 : 4608128

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027310.1\|4603622_4604522_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	2.8e-12	28.6
WP_003027312.1\|4604544_4605597_-	class I fructose-bisphosphate aldolase	NA	NA	NA	NA
WP_162648805.1\|4605849_4607127_+	MFS transporter	NA	NA	NA	NA
WP_162648806.1\|4607123_4608128_+	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	3.2e-12	27.7

DBSCAN-SWA_349

4619087 : 4627506

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003844377.1\|4619087_4621121_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	4.0e-54	27.6
WP_046670055.1\|4621327_4621786_+	YehR family lipoprotein	Q9EYF5	Enterobacteria_phage	1.5e-49	67.3
WP_003027346.1\|4621828_4622299_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.9e-64	76.9
WP_003840155.1\|4622345_4623065_-	two-component system response regulator BtsR	NA	NA	NA	NA
WP_003027348.1\|4623061_4624747_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-281	91.6
WP_003844381.1\|4624972_4625704_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	1.8e-105	93.5
WP_003027354.1\|4625755_4625863_+	protein YohO	NA	NA	NA	NA
WP_162648807.1\|4625843_4626575_-	ABC transporter permease	NA	NA	NA	NA
WP_071685240.1\|4626558_4627506_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.1e-22	29.2

DBSCAN-SWA_350

4638271 : 4639006

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_162648809.1\|4638271_4639006_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	9.3e-54	44.4

DBSCAN-SWA_351

4653387 : 4654908

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027396.1\|4653387_4654908_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-10	32.8

DBSCAN-SWA_352

4658612 : 4662705

Cellulophaga_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003027410.1\|4658612_4659281_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	4.1e-56	56.8
WP_046670072.1\|4659603_4660440_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_003840102.1\|4660719_4662705_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	4.5e-10	32.6

DBSCAN-SWA_353

4666615 : 4667473

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016150659.1\|4666615_4667473_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	4.4e-23	32.8

DBSCAN-SWA_354

4681159 : 4683076

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004864803.1\|4681159_4683076_+	recombinase family protein	Q6V7T7	Burkholderia_virus	9.0e-32	29.9

DBSCAN-SWA_355

4687666 : 4694107

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099144804.1\|4687666_4689805_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.4e-71	33.0
WP_023279773.1\|4690547_4691516_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	2.9e-180	96.6
WP_001198019.1\|4691858_4692797_-	cation transporter	NA	NA	NA	NA
WP_007890845.1\|4693492_4694107_+	recombinase family protein	A0A0S2SXR4	Bacillus_phage	2.3e-05	38.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048384

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP048383

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP048382

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection