CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040857	Lactobacillus plantarum strain 202195 plasmid unnamed, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP040858	Lactobacillus plantarum strain 202195 chromosome, complete genome	2 crisprs	cas3,DEDDh,DinG,csa3,WYL	4	2	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32166 : 43552

Enterococcus_phage(25.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163600791.1\|32166_34314_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.0e-253	60.2
WP_133279749.1\|34420_35347_+	ribonucleoside-diphosphate reductase	A0A2H4P8A9	Corynebacterium_phage	3.4e-37	32.4
WP_133279750.1\|35361_36312_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	1.1e-99	55.0
WP_133279751.1\|36445_37249_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	4.9e-16	29.6
WP_133279752.1\|37362_37995_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	6.2e-14	33.2
WP_020923858.1\|38081_38984_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-52	40.3
WP_133279753.1\|39154_40084_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.8e-22	28.2
WP_027822898.1\|41150_41474_+	hypothetical protein	NA	NA	NA	NA
WP_046041500.1\|41546_41945_-	hypothetical protein	NA	NA	NA	NA
WP_063207381.1\|41937_42258_-	hypothetical protein	NA	NA	NA	NA
WP_133279754.1\|42250_43552_-	Y-family DNA polymerase	M1Q231	Streptococcus_phage	5.8e-83	40.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP040858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040858_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040858_1

1474709-1474935

Orphan

Consensus_repeat	Method
TTCTTGATTGCTTGTACGGGTCG	PILER-CR

4 spacers

The CRISPR arrays of NZ_CP040858_1

>merge|NZ_CP040858|1|1474709-1474935|PILER-CR
TTCTTGATTGCTTGTACGGGTCGCTTGATTAATACTCTTGGCACTGTTAGCTTCTTGATTGCTTGTACTGGTTGTCTGACTAGTATTTTTCGCACTACTGGATTCTTGATTGCTTGTACGGGTCGCTTGATTAATACTCTTGGCACTGTTAGCTTCTTGATTGCTTGTACTGGTTGTCTGACTAGTATTTTTCGTACTACTGGATTCTTGATTGCTTGTACGGGTCG

>NZ_CP040858|1|1|1474709-1474935|PILER-CR
TTCTTGATTGCTTGTACGGGTCG	CTTGATTAATACTCTTGGCACTGTTAGC
TTCTTGATTGCTTGTACTGGTTG	TCTGACTAGTATTTTTCGCACTACTGGA
TTCTTGATTGCTTGTACGGGTCG	CTTGATTAATACTCTTGGCACTGTTAGC
TTCTTGATTGCTTGTACTGGTTG	TCTGACTAGTATTTTTCGTACTACTGGA
TTCTTGATTGCTTGTACGGGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040858.1\|WP_061876121.1\|1469657_1471079_+\|flippase	unknown	unknown	gnl\|CDD\|240533
NZ_CP040858.1\|WP_046947454.1\|1486831_1488370_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227059
NZ_CP040858.1\|WP_003643208.1\|1467040_1467268_+\|DUF2922-domain-containing-protein	unknown	unknown	gnl\|CDD\|378571
NZ_CP040858.1\|WP_024002858.1\|1466489_1466684_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040858.1\|WP_003643211.1\|1465905_1466454_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274357
NZ_CP040858.1\|WP_003644178.1\|1482619_1483753_-\|UDP-galactopyranose-mutase	unknown	unknown	gnl\|CDD\|223636
NZ_CP040858.1\|WP_003643206.1\|1468551_1469220_+\|sugar-transferase	unknown	unknown	gnl\|CDD\|376775
NZ_CP040858.1\|WP_046947456.1\|1484265_1485198_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133028
NZ_CP040858.1\|WP_027822092.1\|1475695_1476442_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197666
NZ_CP040858.1\|WP_003644193.1\|1464912_1465671_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368849
NZ_CP040858.1\|WP_003644190.1\|1466798_1467011_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040858.1\|WP_046947455.1\|1485280_1486192_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133028
NZ_CP040858.1\|WP_027822093.1\|1476566_1477343_-\|DUF4422-domain-containing-protein	unknown	unknown	gnl\|CDD\|379595
NZ_CP040858.1\|WP_046947458.1\|1480841_1481474_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040858.1\|WP_046947459.1\|1478529_1479639_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377101
NZ_CP040858.1\|WP_003643213.1\|1464076_1464886_-\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|237619
NZ_CP040858.1\|WP_003643204.1\|1471208_1471649_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP040858.1\|WP_061876120.1\|1477478_1478546_-\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|226122
NZ_CP040858.1\|WP_060417605.1\|1481470_1482604_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040858.1\|WP_024002857.1\|1467369_1467675_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040858.1\|WP_061876121.1\|1469657_1471079_+\|flippase	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.77454e-41
NZ_CP040858.1\|WP_003643208.1\|1467040_1467268_+\|DUF2922-domain-containing-protein	gnl\|CDD\|378571	pfam11148, DUF2922, Protein of unknown function (DUF2922). This bacterial family of proteins has no known function.	7.46609e-13
NZ_CP040858.1\|WP_003643211.1\|1465905_1466454_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.75371e-08
NZ_CP040858.1\|WP_003644178.1\|1482619_1483753_-\|UDP-galactopyranose-mutase	gnl\|CDD\|223636	COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane].	4.88338e-180
NZ_CP040858.1\|WP_003643206.1\|1468551_1469220_+\|sugar-transferase	gnl\|CDD\|376775	pfam02397, Bac_transf, Bacterial sugar transferase. This Pfam family represents a conserved region from a number of different bacterial sugar transferases, involved in diverse biosynthesis pathways.	1.56324e-95
NZ_CP040858.1\|WP_046947454.1\|1486831_1488370_-\|hypothetical-protein	gnl\|CDD\|227059	COG4715, COG4715, Uncharacterized conserved protein [Function unknown].	8.3379e-07
NZ_CP040858.1\|WP_027822092.1\|1475695_1476442_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.68549e-18
NZ_CP040858.1\|WP_003644193.1\|1464912_1465671_-\|hypothetical-protein	gnl\|CDD\|368849	pfam06338, ComK, ComK protein. This family consists of several bacterial ComK proteins. The ComK protein of Bacillus subtilis positively regulates the transcription of several late competence genes as well as comK itself. It has been found that ClpX plays an important role in the regulation of ComK at the post-transcriptional level.	1.74267e-05
NZ_CP040858.1\|WP_046947455.1\|1485280_1486192_-\|glycosyltransferase	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	6.77895e-77
NZ_CP040858.1\|WP_027822093.1\|1476566_1477343_-\|DUF4422-domain-containing-protein	gnl\|CDD\|379595	pfam14393, DUF4422, Domain of unknown function (DUF4422). This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 255 and 371 amino acids in length.	1.83501e-121
NZ_CP040858.1\|WP_046947459.1\|1478529_1479639_-\|hypothetical-protein	gnl\|CDD\|377101	pfam03699, UPF0182, Uncharacterized protein family (UPF0182). This family contains uncharacterized integral membrane proteins.	0.00253621
NZ_CP040858.1\|WP_003643213.1\|1464076_1464886_-\|recombination-regulator-RecX	gnl\|CDD\|237619	PRK14135, recX, recombination regulator RecX; Provisional.	3.76318e-120
NZ_CP040858.1\|WP_003643204.1\|1471208_1471649_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	3.5268e-13
NZ_CP040858.1\|WP_061876120.1\|1477478_1478546_-\|acyltransferase-family-protein	gnl\|CDD\|226122	COG3594, NolL, Fucose 4-O-acetylase and related acetyltransferases [Carbohydrate transport and metabolism].	1.81871e-14
NZ_CP040858.1\|WP_046947456.1\|1484265_1485198_-\|glycosyltransferase	gnl\|CDD\|133028	cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	1.25828e-82

>NZ_CP040858.1|WP_003643204.1|1471208_1471649_-|MarR-family-transcriptional-regulator
MLNHQQIKAQFESLETLQSIQKQVHQMSIQGLVTTGISMREWEVLVYLEQHEQASASELAKVFKVTRTLISRNTWHLIQDNLIQPQIDQSDRRIVWLSLTTTGQETIGKVARQIQANLQAFDCNHELATLMKQLRYLKQQLIILNN
>NZ_CP040858.1|WP_061876121.1|1469657_1471079_+|flippase
MRIIRNYFYTAGYNLLILLTPLLTVPYISRVLGPTGVGINATTNSIITYFLLFGTVGITIYGNREIAFIRDNRGQRSQTFWEIEILQLLTISCAYLAFLVFLFFEHQLQIYFFYQSFYIIAGAVDISWYFMGLEDFKKTVLRNMLVKIASVIAIFAFVKTRQDTGIYILILAGSQVLGNLTLWPYLRHSVERPNWRQLNLFRHLRPSLALFVPQLATTVYLALNKTMLWQMDSLTAAGFYDYSDKLIKLVLALVTATGTVMLPHIANLFMKQQLERVKQYLYMSFDFVLAIAIPMALGVAAVATTLAPLFFGRAFWAVDRLLMIEAPVIILIGMSNVLGQQFLLPTKQTKTYTISVTIGALVNIACNIPLIWFWGVAGAMCATLISEVCVTGYQLFITRHVLHAQSLFTGIWKYTLAGGLMFTFVFRLNVTMTASYLNLCLQIGVGVLLYLGLILLLQPPVLRNAIKLRNNLH
>NZ_CP040858.1|WP_003643206.1|1468551_1469220_+|sugar-transferase
MELKEREIRPITIDAGRQHRRYGYRFIKRVFDFVASLLGLIILSPLFLLIAIAIKVEDPKGAVFYSQTRLGRGEVPFKMYKFRSMVSNADELLEKLLKDNEIDGAMFKMQDDPRVTKIGRFIRKYSIDELPQLLNVLQGSMSLVGPRPPLPREVEEYSDYDKQRLAVKPGCTGLWQATVRNSVGFDEMVKLDLTYISKRSVAFDVYILFKTVVIMFKPNGAY
>NZ_CP040858.1|WP_024002857.1|1467369_1467675_-|hypothetical-protein
MNDDWITVFPADYNNSYHLILKRGTAHYAYYYFKVDKLDQRVIFYDDIERSGISIKTQITRTFMRALVKAIDWHPVGNSIIIEIYPVDRQETKAIRLSCDI
>NZ_CP040858.1|WP_003643208.1|1467040_1467268_+|DUF2922-domain-containing-protein
MKTLDLSFKTSTNKVHHLKLHYANDNLSKDVVSKAMADLAATKLFVKDGENLVAEPLAAKYVETIETPIVTAPKA
>NZ_CP040858.1|WP_003644190.1|1466798_1467011_+|hypothetical-protein
MTKTWLKATLTVQTTTELDEQRKQTFNAIAQDATDEQLAAFGKIVEVLTGDQFTAANLANAYRYDPQPIA
>NZ_CP040858.1|WP_024002858.1|1466489_1466684_+|hypothetical-protein
MHIWMHTHVLLTVTDSNQRQFHQHWLAGRELTDSDFTSLITILTPLFAEKIISITVRTITEFAD
>NZ_CP040858.1|WP_003643211.1|1465905_1466454_+|sigma-70-family-RNA-polymerase-sigma-factor
MHADRFDNQMAFDLLARPEHQRLLYGALKAAQVTKYHPQFEDCVTVAHLTWLSAYQNYAPELPANLPDFRKFAFRRIKWRTVDYLRKQTLRTQSQVNLEHALPITIDPMTEQETHWQLTALLTELLVQCRPGERIYLTEFFFEEQTVSSIMRRHQVSRRTVYNWRASLLVKAHKLYQQQTTN
>NZ_CP040858.1|WP_003644193.1|1464912_1465671_-|hypothetical-protein
MLEINTDFEGDLPSMNQNIDVPHHVNTFWQCHAGTWDTRQPQRLLIIAQRSELATIDVLETLFLLDIKHLTCVENTLIFDRQRGLIKTKLTTRQIMMNYAGRLGLSGTQLIKQLAGELGLSKHKLPVIHGDAILMPLSTAKRGTTSWYNRHYLKHIEAQGFMTALVYDGQITIQVDMSERVATRQLAKAGQLQAALQEHHRRRLVPDQSVPSMADTDHEMMQSYTDQVLKHFGILALPGEISCLTRRFFGKL
>NZ_CP040858.1|WP_003643213.1|1464076_1464886_-|recombination-regulator-RecX
MSLTKKVTKIVAQKRAGRYNIYLDEQYAFPISESVMIKFRVFKGMEVDEQLQAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEIDESVIDATMQQLRELRLLNDQQYADAFVRTAKRTSDKGPRVIRQNLRQKGVGEQLIDDALAGQFSAEEQIDNASELARKLAKRYHRQAFKTMQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGAKLWQRNRKYAFRERMMRTKRSLFQKGFMMDDINRFIDEQVADE
>NZ_CP040858.1|WP_027822092.1|1475695_1476442_+|helix-turn-helix-transcriptional-regulator
MNIARFTPLRISSSEQEFILNFSLLEHDLIHFFKIRDFDHAISRINKFKEVHPINWIDAEILNQLLLGLIGSLTAASYTHNLNLNDFLKLRLYFFNFIKKSPCTSSTFWPLSNDIITTYFNLLDNFDFHVSYQNLSKQVALTAYYISAHPQELTNSHGVLHTLNLNNDYTQKLFKKELGFSINAYIQHIKLSEAKRLLLQRQLSVGKIASLLHFYDTPTFSKTFKKAVGLSPLKYRELNYLSLTSQSY
>NZ_CP040858.1|WP_027822093.1|1476566_1477343_-|DUF4422-domain-containing-protein
MKVQIYVAAHKPYQMPQDPTYRPIFVGAAIHGGAPQNYQPDDVGDNISASNPNFNELTAMYWIWKNCHADVKGLNQYRRYLSEAPKRKLAGILSMTEIESLLQQYDVIVPKKRHYYIESNYSHYVHAHHREPLDMMRTVISERHAAYLDDFDQLMHRTSAHMFNMMIMSGPKFDDYAKWVFDILFAVRDRIDIADYDVQEARVFGYLSEFLLDVWINHNQLKYVEVPVMYMEKQQLPAKAYNLLKRKFFPQAAKRTHF
>NZ_CP040858.1|WP_061876120.1|1477478_1478546_-|acyltransferase-family-protein
MRKRIEWIDIAKGIAILAVVVGHTLGPYNGQFFGSLIFAFHMPIFFMLSGYLYHSRPARQECQRGIINLLLPYLATAVVLLVVSAIARLLPNPLLNAYFPSWRQGLIATAYGAGSAVFNPWHWQVQPIGAVWFLLSMFIALQLFNGVMLLTARRHQRWRQAIVRGGVFAIFAILGGWLGQVAYLPWAVNAALLAQLFLYAGYLVKQTALLSRISSAWYLLFTFMWLVSAFQGYFALTVPTSPNLLISVMGGVAGSLCIIRVSDWLSHYPNARPIKWLKRYGQLSLVVLCFHLIDLNVIGMTNHLITHMGPLVTTIIAISYRIGFVTVAMLAIPHLPGIRACFLPRQYLFRRLQRR
>NZ_CP040858.1|WP_046947459.1|1478529_1479639_-|hypothetical-protein
MNHQQAYRVQRLILIIALMLILFGDTGMNAVFSFSHQPQSIWFYPQLVVALITAAGPNLLLMALGAYQLRRTALTVPQLIRRVLWIMGGITLFSLAFYLEDLVTQGSLTSFNIAGFFTALAQAPVGFYDILYELLGFFVTLPLLRVIAHHASVAIQQYLFWAELVFIGMVPILAYFTGLTTISVNPPLAITAGCFFALMGYWLSQTEVLHRITREHLLVAWLLTCGCYAVMVSVTMYQVNLEKNFDLISSQPFAQTFQAIPCLTLWVTIATWMMNRPRSKAVRRHNFVQTVYGDMLVAGLLITPFMVINRLLTPIIGAWWPGWLWSIAVLIVSVELVWLLRHVRWLQRILPDLFGGSQLIGGSVNAQKN
>NZ_CP040858.1|WP_046947458.1|1480841_1481474_-|hypothetical-protein
MRHMKVQPKERFSLAWRWLPLELLIIMLSVGLGWAGNRWLPKPVYQASVDIQIAQTPRSELSTARLKRQRRQDIKAITQFNVMPHQSAVLTQASTYAYAHYGIWQPIQELSESVQAAPVARRPVLRVTATSSSRQVAQQNAQAFNVAIKANLTGLKNYRVKTVKRTVTRETNVIRGALWKLILVVGGGLALLSPYLVKYGQGWGRHDDET
>NZ_CP040858.1|WP_060417605.1|1481470_1482604_-|hypothetical-protein
MKMRKRLAIVWGSLALLALLLGYACYALSIQRGQDTVTRIYQTDQNGTPIISPGPITLVGKVNHRNLFQSGINGYVLTNRDPLSTLLPRRNQTVHLKYRSAQTTAELRKTLRQARYLQAGTQNTATPVFQNRQQRGDATTYGRISTSQDGRIWTKLPISYPHVQLSRPSVWYANGRLTLIDGQDRYWTTNFKDWQHQRLNFNGADFKQGRVQAVFPGTTRSAVVMVRGIDRQSSRAKLYYGQLTKTGRVKAWHALQLGKLPARQIAGMSLIDQHLYLFRQRGTQLAVYRANRLTRPVRLVGRVKLNHAQSQRVTAVNLIPTTKHRYRLIFDLTTAEKVQKQPRYRLLDRRFKAVGQQHLLVTDYLWSQFQISLRGSE
>NZ_CP040858.1|WP_003644178.1|1482619_1483753_-|UDP-galactopyranose-mutase
MNEQYDYLVVGAGLFGAVFAHEAALRGKRVKVIEKRDHIAGNIYTKEVAGIQVHQYGAHIFHTSDREIWDYVNQFAEFNRYTNSPVANYKGHMYNLPFNMNTFSELWGVRTPAEAAAKIAEQRAAANLGDHQPRNLEEQAIALIGTDIYEKLIKGYTEKQWGQKATDLPAFIIRRLPVRYTYDNNYFNDTYQGIPIGGYTQIVEKMLAHPEITVETNTDFFAHKAEYLAQYPKVVFTGMIDQFFDYQLGELAYRSLRFETETVPVDNYQGNAVVNYTDAETPYTRVIEHKHFEFGKGDADQTVITREFPANWQRGDEPYYPVNNQTNNTLYKQYAKLAAAEPQVIFGGRLGQYRYYDMHQVIHAALVTVASEFATTK
>NZ_CP040858.1|WP_046947456.1|1484265_1485198_-|glycosyltransferase
MQYGAIVVTFNRKQLLIESITALLNQTVPPAKIIIIDNHSTDGTKAELQTADILANPSVDYRYLTKNIGGAGGFARGMQIVAADPNLDWVSMSDDDAIFEPDYFEKLIAYQQDHPNRQILTGSVYIEDGRLQADQRNRFTNWSTFQAQAVPEREYRGNFEFDQYTFCGVFMSVAVIKQVGVADAGYFIWWDDCEYAVRTAKLSRPVNVSAAKLIHKTALPSLDFKSKFVPDWRLYYGQRNRLITIKRWRANSLVSLGWLLGFYARLAIQLCGPFYRGYRKMVIRVYLEALRDASREREGLNPNFMPGQKF
>NZ_CP040858.1|WP_046947455.1|1485280_1486192_-|glycosyltransferase
MAKIACVIVTYNRKQLLEEALNSVSIQAEAPEYVFVIDNASTDGTEKYINDKFNFDNRHWHYVRCSQNLGGSAGFAQGMRLALQTDCSWISISDDDALFEPGYFAALREGIKQYPEQSVFSGSVLLPDGKHDMMHREVITNSATLTVKPVTEETYKHDFSYDIFSFVGILLSRQVIEAIGLPEQDYFIRFDDFEYAVRALKFGRFMNLSAAKVLHKTTYTRSAIAPWKEYYVMRNRIALLIKHRGNNHTVRWYCRRFLLRKLLAILLFSNRRRQARSLVNAYVKGYQDGWHARLGRQLAFLPS
>NZ_CP040858.1|WP_046947454.1|1486831_1488370_-|hypothetical-protein
MQWQTLFQQQVLTRAFNYYQEGHVKKFSKEHHKLMAIVQGVQDYQVTIFESIGDVTTMICNCPYALSGLHCKHMAAVLYYVENTVSVGSQLKMNSPKNCQGKLFKKSDDRVGNEWNSDLIQDIRSFTLSQSKLLAHEDMLAVNPCPLFTPLADLPMLFKSCEWLVSTELPRMLAANQQQMVFDILTYAYLKLCYTGVDQTNLIDECARLFRKLLTHANGHIRQSIFRWLFIYSLALPIKYSSQFELLLFYSDAFSNPWFLNQKLILVDHKISKLQASHHEMQFQVETTVIEWQRYRIHVMKELKLSPNTVQEFCQLNRDDLVVSDYFVENCREHNDIERAIMYCRTGIQQAAQDDNSTVMYHCYDQLVSLYRDCGLVNEYRHALFEAITKCDALNSNWYIQLREQYSSADWSNVRRQISASIIPQTDFEWDSFQNVSVRPYVLALQRDVKEATTPESQLSIIKQLDYLQKYHGSTGLEVADWLWQDWYRHYPERKVLIDAFDEWIAQIIEKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040858_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040858_2

3103671-3103756

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040858_2

>merge|NZ_CP040858|2|3103671-3103756|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP040858|2|1|3103671-3103756|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040858.1\|WP_003642356.1\|3095842_3096298_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP040858.1\|WP_003643393.1\|3108417_3108984_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP040858.1\|WP_046947556.1\|3109142_3109871_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP040858.1\|WP_003642340.1\|3110652_3110937_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP040858.1\|WP_003643397.1\|3103770_3105249_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP040858.1\|WP_003643400.1\|3099977_3100976_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP040858.1\|WP_003642350.1\|3100972_3101767_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP040858.1\|WP_003642352.1\|3098985_3099981_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP040858.1\|WP_003643392.1\|3110003_3110369_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP040858.1\|WP_003643401.1\|3098228_3098741_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100
NZ_CP040858.1\|WP_003643402.1\|3097354_3098248_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP040858.1\|WP_003643395.1\|3106538_3107105_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP040858.1\|WP_003643391.1\|3111222_3113805_+\|glycoside-hydrolase-family-25	unknown	unknown	gnl\|CDD\|119382
NZ_CP040858.1\|WP_003643394.1\|3107253_3108291_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP040858.1\|WP_046947557.1\|3103053_3103653_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP040858.1\|WP_003642338.1\|3114075_3115488_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143418
NZ_CP040858.1\|WP_003642355.1\|3096314_3097061_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP040858.1\|WP_003642357.1\|3094696_3095533_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212492
NZ_CP040858.1\|WP_003643399.1\|3101991_3102933_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP040858.1\|WP_003643396.1\|3105365_3106319_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318

Protein	Function_ID	Function_description	E-value
NZ_CP040858.1\|WP_003642356.1\|3095842_3096298_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.94104e-53
NZ_CP040858.1\|WP_003643393.1\|3108417_3108984_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.97622e-05
NZ_CP040858.1\|WP_046947556.1\|3109142_3109871_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.25391e-90
NZ_CP040858.1\|WP_003642340.1\|3110652_3110937_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP040858.1\|WP_003643397.1\|3103770_3105249_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72
NZ_CP040858.1\|WP_003643400.1\|3099977_3100976_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.31826e-81
NZ_CP040858.1\|WP_003642350.1\|3100972_3101767_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
NZ_CP040858.1\|WP_003642352.1\|3098985_3099981_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.82997e-79
NZ_CP040858.1\|WP_003643392.1\|3110003_3110369_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NZ_CP040858.1\|WP_003643401.1\|3098228_3098741_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08
NZ_CP040858.1\|WP_003643402.1\|3097354_3098248_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.82369e-130
NZ_CP040858.1\|WP_003643395.1\|3106538_3107105_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	1.18048e-27
NZ_CP040858.1\|WP_003643391.1\|3111222_3113805_+\|glycoside-hydrolase-family-25	gnl\|CDD\|119382	cd06522, GH25_AtlA-like, AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.	1.48653e-70
NZ_CP040858.1\|WP_003643394.1\|3107253_3108291_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.78417e-95
NZ_CP040858.1\|WP_046947557.1\|3103053_3103653_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.56784e-08
NZ_CP040858.1\|WP_003642338.1\|3114075_3115488_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143418	cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like. Succinate-semialdehyde dehydrogenase 1 (SSADH1, GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde (SSA) to succinate. SSADH activity in Mycobacterium tuberculosis (Mtb) is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731). The Mtb GabD1 SSADH1 reportedly is an enzyme of the gamma-aminobutyrate shunt, which forms a functional link between two TCA half-cycles by converting alpha-ketoglutarate to succinate.	0
NZ_CP040858.1\|WP_003642355.1\|3096314_3097061_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP040858.1\|WP_003642357.1\|3094696_3095533_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
NZ_CP040858.1\|WP_003643399.1\|3101991_3102933_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	1.85633e-56
NZ_CP040858.1\|WP_003643396.1\|3105365_3106319_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.34652e-129

>NZ_CP040858.1|WP_046947557.1|3103053_3103653_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAVRDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP040858.1|WP_003643399.1|3101991_3102933_+|ABC-transporter-substrate-binding-protein
METVVTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSTVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP040858.1|WP_003642350.1|3100972_3101767_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP040858.1|WP_003643400.1|3099977_3100976_-|iron-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLVGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>NZ_CP040858.1|WP_003642352.1|3098985_3099981_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRR
>NZ_CP040858.1|WP_003643401.1|3098228_3098741_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP040858.1|WP_003643402.1|3097354_3098248_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDKGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP040858.1|WP_003642355.1|3096314_3097061_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP040858.1|WP_003642356.1|3095842_3096298_+|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP040858.1|WP_003642357.1|3094696_3095533_-|SDR-family-NAD(P)-dependent-oxidoreductase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY
>NZ_CP040858.1|WP_003643397.1|3103770_3105249_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP040858.1|WP_003643396.1|3105365_3106319_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATIDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAISQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDMTLTRQEWYDVYFAAGNDLP
>NZ_CP040858.1|WP_003643395.1|3106538_3107105_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFGANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>NZ_CP040858.1|WP_003643394.1|3107253_3108291_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTISNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP040858.1|WP_003643393.1|3108417_3108984_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTMIHELLATLQTATMQALTQAQK
>NZ_CP040858.1|WP_046947556.1|3109142_3109871_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKPFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP040858.1|WP_003643392.1|3110003_3110369_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP040858.1|WP_003642340.1|3110652_3110937_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>NZ_CP040858.1|WP_003643391.1|3111222_3113805_+|glycoside-hydrolase-family-25
MNFKSQNPIDASQSERFKLYKSGKLWLVAGLTFFSFLGGSVLNNTNVHADVTTATTTSSSAASTASSASVATSSAASDATTKATSVSSSATTQVTSAATTKTTSQAATASSSAATSQSTSTASSSTSQATKTASSAAASTSATATSQATSVASSTATTTQVSRTASSTAASAASSTATVKAVTPASSTVSSAATTAIKATAKVAAVAYTAATTSSTDVWTIGDTTRPRVDVVDVASYQSTMTQSDFNKLKAAGVKTVIVKSTEGTDYTNPAALNQAKMANKAGLNVDFYHYATFSTADAAKSEATNMAGFLVKNNVSTKVLLFADMEDSSSYSVNATANLNAFWSTLDSFGYKNHGVYTSNSYLYRDAVVKTVGQSRVWRAQYPYTPSANNLWNTNDGAWQFSDTALLPSGSDYTGYIDVSIDYNGLTEDSAGTNTFVTTTSSNDTTTSEVTTDTSATTNTSTSSTTKKASGWYTFTKNTAIKSAASDSAKTVGTYSKGNRVYYNAEVTTNGETWLRYLSYSGSEHFVKIAAAKTTTTKPAASTSKTVTKNETGTYKFTKTTAIKGSVSDSAKTLGTYYKGDTVYYNAKVTKNGETWLRYLSYSGAQHYVKISGAATSTTTTKPATSSSKTVTKAETGTYKFTGTTAIKGSVNDSAKTLGTYYKGDTVYYNAKVTKNGQTWLRYLSYSGAQHYVKISGAATTTTTSSKSTATASAKTVAQSGTYKFAKTTAIKSSASDAASTVGTYYKGNTVNYNAKVTTNGQTWLRYTSYSGAQHYVKVSGGAATTTSSSASKTTAAAGTYTFKTTTNIRTAASLNASVVGQYSAGESVYYIGTVSADGYQWLKYLSNSGAYHYVAKIG
>NZ_CP040858.1|WP_003642338.1|3114075_3115488_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MAYQTINPYTNEVVKTYDNATTDQIEQALTTGDALYHQWRHEPVSSRAASLHKIAALLREHKDELAKIATIDMGKLLSESQGEVELCAMIADYYADHGAELLAPTPISTQATGDAEIEKQATGVLMLVEPWNFPYYQIMRVFAPNYMVGNPMILKHASNTPGSAAAFAKIVEEAGAPAGSLTNLFLNYDQVSDIIADPRIQGVALTGSKRGGQAVAKAAGANLKKSSMELGGSDAFVVLADADIDEAVNLAWRVRLYNAGQVCTSSKRFIVAADVYDDFLAKLKERFAKLVPGDPMDPQTTLAPMNSKRAKEKLQDQVDRAIAGGATVAYGNEPIDLPGQFFQPTILTDIDQDNPLFYEEMFGPVAQVFKVDSEQAAIDLANNSELGLGGIVFAGTAAHGKAVAQQIETGMVFVNTFLSSLPELPFGGVKGSGYGRELSSLGLMAFVNEKLVVTAQKPDYDNGAGGLVVL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040858_1	1.1\|1474732\|28\|NZ_CP040858\|PILER-CR	1474732-1474759	28	NZ_CP040858.1	1474936-1474963	0	1.0
NZ_CP040858_1	1.2\|1474783\|28\|NZ_CP040858\|PILER-CR	1474783-1474810	28	NZ_CP040858.1	1474681-1474708	0	1.0
NZ_CP040858_1	1.3\|1474834\|28\|NZ_CP040858\|PILER-CR	1474834-1474861	28	NZ_CP040858.1	1474936-1474963	0	1.0
NZ_CP040858_1	1.4\|1474885\|28\|NZ_CP040858\|PILER-CR	1474885-1474912	28	NZ_CP040858.1	1474681-1474708	1	0.964

1. spacer 1.1|1474732|28|NZ_CP040858|PILER-CR matches to position: 1474936-1474963, mismatch: 0, identity: 1.0

cttgattaatactcttggcactgttagc	CRISPR spacer
cttgattaatactcttggcactgttagc	Protospacer
****************************

2. spacer 1.2|1474783|28|NZ_CP040858|PILER-CR matches to position: 1474681-1474708, mismatch: 0, identity: 1.0

tctgactagtatttttcgcactactgga	CRISPR spacer
tctgactagtatttttcgcactactgga	Protospacer
****************************

3. spacer 1.3|1474834|28|NZ_CP040858|PILER-CR matches to position: 1474936-1474963, mismatch: 0, identity: 1.0

cttgattaatactcttggcactgttagc	CRISPR spacer
cttgattaatactcttggcactgttagc	Protospacer
****************************

4. spacer 1.4|1474885|28|NZ_CP040858|PILER-CR matches to position: 1474681-1474708, mismatch: 1, identity: 0.964

tctgactagtatttttcgtactactgga	CRISPR spacer
tctgactagtatttttcgcactactgga	Protospacer
******************.*********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040858_1	1.1\|1474732\|28\|NZ_CP040858\|PILER-CR	1474732-1474759	28	MK613343	Roseobacter phage CRP-1, complete genome	28521-28548	7	0.75
NZ_CP040858_1	1.3\|1474834\|28\|NZ_CP040858\|PILER-CR	1474834-1474861	28	MK613343	Roseobacter phage CRP-1, complete genome	28521-28548	7	0.75

1. spacer 1.1|1474732|28|NZ_CP040858|PILER-CR matches to MK613343 (Roseobacter phage CRP-1, complete genome) position: , mismatch: 7, identity: 0.75

cttgattaatactcttggcactgttagc	CRISPR spacer
agaacttaatactcttagaactgttagc	Protospacer
   . ***********.* *********

2. spacer 1.3|1474834|28|NZ_CP040858|PILER-CR matches to MK613343 (Roseobacter phage CRP-1, complete genome) position: , mismatch: 7, identity: 0.75

cttgattaatactcttggcactgttagc	CRISPR spacer
agaacttaatactcttagaactgttagc	Protospacer
   . ***********.* *********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

146772 : 155286

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642585.1\|146772_147258_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_003644727.1\|147241_148372_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|148374_149106_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_061876238.1\|149107_149362_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_033615420.1\|149364_150042_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003642590.1\|150034_152254_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	7.7e-144	39.3
WP_003642591.1\|152238_153693_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
WP_003642592.1\|153689_154715_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.4e-61	41.7
WP_003642593.1\|154707_155286_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.9e-22	35.0

DBSCAN-SWA_2

347083 : 407488

Lactobacillus_phage(54.55%)

terminase,head,integrase,capsid,holin,tail,portal

attL 346886:346907|attR 407725:407741

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
346886:346907	attL	NA	NA	NA	NA
WP_061876226.1\|347083_348241_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	8.6e-54	35.1
346886:346907	attL	NA	NA	NA	NA
WP_061876225.1\|348302_348992_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_061876223.1\|349659_349878_+	hypothetical protein	NA	NA	NA	NA
WP_061876222.1\|349874_350675_+	DNA replication protein	NA	NA	NA	NA
WP_061876221.1\|350674_352069_+	virulence protein	A0A1W6JQD6	Staphylococcus_phage	3.3e-68	41.6
WP_061876220.1\|352331_352514_+	sporulation protein Cse60	NA	NA	NA	NA
WP_061876219.1\|352523_352862_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.6e-08	33.7
WP_061876218.1\|352854_353265_+	HNH endonuclease	A0A1Q1PW15	Staphylococcus_phage	2.9e-20	47.1
WP_061876217.1\|353826_354300_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_061876216.1\|354296_356000_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.3
WP_061876215.1\|356154_357261_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	4.7e-49	33.3
WP_061876214.1\|357250_358831_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	4.8e-39	26.1
WP_061876213.1\|359240_359510_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_061876212.1\|359664_360024_+	hypothetical protein	NA	NA	NA	NA
WP_061876211.1\|360088_360724_-	hypothetical protein	NA	NA	NA	NA
WP_003642774.1\|361175_361382_+	hypothetical protein	NA	NA	NA	NA
360848:360869	attR	NA	NA	NA	NA
WP_133279661.1\|361733_362855_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	1.3e-46	32.4
360848:360869	attR	NA	NA	NA	NA
WP_133279660.1\|362941_363856_-	DNA adenine methylase	NA	NA	NA	NA
WP_133279659.1\|363911_365684_-	AAA family ATPase	NA	NA	NA	NA
WP_021732649.1\|366303_367023_-	hypothetical protein	NA	NA	NA	NA
WP_003642781.1\|367628_367997_-	hypothetical protein	NA	NA	NA	NA
WP_041153536.1\|368069_368486_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	9.1e-06	29.8
WP_003644967.1\|368497_368866_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
WP_063096781.1\|369015_369252_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_015380634.1\|369450_369756_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_133279658.1\|369822_370335_+	transcriptional regulator	D6PST4	Lactobacillus_phage	1.6e-28	44.1
WP_133279657.1\|370714_372673_+	AAA family ATPase	A0A0A0RNI0	Bacillus_phage	2.0e-71	33.0
WP_133279656.1\|372674_373763_+	hypothetical protein	NA	NA	NA	NA
WP_133279655.1\|373762_374488_+	MBL fold metallo-hydrolase	A0A0H4TGC9	Bacillus_phage	1.3e-52	41.5
WP_163600794.1\|374570_375524_+	DUF4373 domain-containing protein	NA	NA	NA	NA
WP_133279653.1\|375520_375808_+	hypothetical protein	NA	NA	NA	NA
WP_133279652.1\|375804_376323_+	hypothetical protein	O03915	Lactobacillus_phage	1.2e-39	54.6
WP_003642802.1\|376319_376694_+	hypothetical protein	NA	NA	NA	NA
WP_133279651.1\|376696_377008_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.7e-52	97.1
WP_041153378.1\|377181_377433_+	hypothetical protein	NA	NA	NA	NA
WP_133279649.1\|377445_377775_+	hypothetical protein	NA	NA	NA	NA
WP_133279676.1\|377787_378168_+	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	4.0e-32	53.3
WP_053267730.1\|378164_378611_+	DUF1642 domain-containing protein	A0A2P0ZKT5	Lactobacillus_phage	1.8e-20	41.4
WP_033609727.1\|378917_379388_+	hypothetical protein	B4XYT9	Lactobacillus_phage	1.9e-15	40.0
WP_016511184.1\|379625_379793_+	BC1881 family protein	NA	NA	NA	NA
WP_087842062.1\|379789_379999_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_163600795.1\|380308_380455_+	hypothetical protein	NA	NA	NA	NA
WP_133279648.1\|380984_381176_+	hypothetical protein	E9LUP6	Lactobacillus_phage	7.5e-16	85.1
WP_163600796.1\|381308_381608_+	ImmA/IrrE family metallo-endopeptidase	A0A1Q1PVT7	Staphylococcus_phage	5.7e-10	36.7
WP_133279646.1\|381668_382271_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.6e-14	34.3
WP_105316088.1\|382263_383577_+\|terminase	PBSX family phage terminase large subunit	D2IYW1	Enterococcus_phage	1.9e-126	54.6
WP_133279645.1\|383591_385328_+\|portal	phage portal protein	A7J292	Streptococcus_phage	5.4e-68	34.7
WP_133279644.1\|385327_386239_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_133279643.1\|386349_387009_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_060418034.1\|387022_387394_+	hypothetical protein	A0A0K2CNR0	Brevibacillus_phage	1.3e-08	34.4
WP_133279642.1\|387409_388519_+\|capsid	major capsid protein E	A0A2H4J022	uncultured_Caudovirales_phage	1.2e-60	39.8
WP_105316082.1\|388536_388905_+	hypothetical protein	NA	NA	NA	NA
WP_133279641.1\|388901_389234_+	hypothetical protein	NA	NA	NA	NA
WP_133279640.1\|389234_389726_+	hypothetical protein	NA	NA	NA	NA
WP_027821924.1\|389728_390124_+	hypothetical protein	NA	NA	NA	NA
WP_133279639.1\|390172_390826_+	hypothetical protein	NA	NA	NA	NA
WP_133279638.1\|390855_391374_+	hypothetical protein	NA	NA	NA	NA
WP_143143016.1\|391463_391706_+	hypothetical protein	NA	NA	NA	NA
WP_133279675.1\|391930_395719_+	tape measure protein	A0A0A7DMV4	Lactobacillus_phage	1.0e-39	58.6
WP_068874366.1\|395744_396011_-	hypothetical protein	NA	NA	NA	NA
WP_105316075.1\|396084_396996_+\|tail	phage tail family protein	A6M962	Geobacillus_virus	8.4e-20	28.5
WP_105316074.1\|396988_398176_+	hypothetical protein	NA	NA	NA	NA
WP_105316073.1\|398150_398516_+	hypothetical protein	NA	NA	NA	NA
WP_133279637.1\|398508_398784_+	hypothetical protein	NA	NA	NA	NA
WP_133279636.1\|401177_401447_+	hypothetical protein	NA	NA	NA	NA
WP_074028698.1\|401439_401574_+	XkdX family protein	NA	NA	NA	NA
WP_133279635.1\|401591_402605_+	collagen-like protein	A0A1I9KKB6	Lactobacillus_phage	5.6e-33	53.0
WP_133279634.1\|402601_402814_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	6.2e-19	83.6
WP_133279633.1\|402825_403998_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	4.3e-194	86.7
WP_027821934.1\|403998_404295_+	hypothetical protein	A0A2K9VCD4	Lactobacillus_phage	2.4e-37	73.5
WP_133279632.1\|404281_404665_+\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	3.7e-14	78.0
WP_077727028.1\|405254_405557_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_027821936.1\|405666_406338_+	hypothetical protein	NA	NA	NA	NA
WP_133279631.1\|406345_407488_+	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	2.7e-39	28.5
407725:407741	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1039224 : 1082828

Lactobacillus_phage(51.85%)

terminase,transposase,integrase,head,holin,capsid,tail,plate,portal

attL 1033490:1033504|attR 1083604:1083617

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1033490:1033504	attL	NA	NA	NA	NA
WP_022638004.1\|1039224_1039650_+\|integrase	phage integrase family site-specific recombinase	NA	NA	NA	NA
1033490:1033504	attL	NA	NA	NA	NA
WP_126043865.1\|1039659_1040271_+\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	1.1e-31	38.0
WP_053566705.1\|1041003_1041504_+	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	8.3e-22	36.7
1040844:1040858	attR	NA	NA	NA	NA
WP_133279719.1\|1041669_1042275_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.6e-14	29.2
1040844:1040858	attR	NA	NA	NA	NA
WP_053566703.1\|1042470_1042695_+	hypothetical protein	NA	NA	NA	NA
WP_058011761.1\|1042946_1043153_+	hypothetical protein	NA	NA	NA	NA
WP_053566701.1\|1043485_1043848_-	hypothetical protein	A0A2H4PBB2	Lactobacillus_phage	2.8e-19	69.6
WP_133279720.1\|1043861_1044125_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.5e-25	71.3
WP_133279721.1\|1044124_1045279_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V5A4	Lactobacillus_phage	2.5e-45	69.5
WP_080373208.1\|1045256_1045433_-	XkdX family protein	NA	NA	NA	NA
WP_053566698.1\|1045432_1045753_-	DUF2977 domain-containing protein	NA	NA	NA	NA
WP_133279722.1\|1045753_1046494_-	hypothetical protein	Q4ZE15	Staphylococcus_virus	1.3e-07	21.7
WP_053566696.1\|1046499_1047114_-\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	6.6e-45	48.3
WP_011101126.1\|1047128_1048121_-	SGNH/GDSL hydrolase family protein	A0A1J0MFI8	Staphylococcus_phage	4.1e-36	41.0
WP_133279723.1\|1048125_1050000_-	endolysin	A0A1X9IGI5	Lactococcus_phage	4.6e-49	33.4
WP_053566693.1\|1049999_1050737_-	hypothetical protein	A0A1S5SA63	Streptococcus_phage	8.2e-42	37.1
WP_133279724.1\|1050730_1054735_-	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
WP_053566691.1\|1054734_1054971_-	hypothetical protein	NA	NA	NA	NA
WP_053566690.1\|1055039_1055552_-	hypothetical protein	NA	NA	NA	NA
WP_053566689.1\|1055569_1056157_-\|tail	phage tail protein	NA	NA	NA	NA
WP_133279725.1\|1056168_1056555_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_133279726.1\|1056555_1057110_-\|tail	phage tail protein	NA	NA	NA	NA
WP_069710549.1\|1057099_1057423_-	hypothetical protein	NA	NA	NA	NA
WP_061871711.1\|1057427_1057793_-\|head,tail	phage head-tail connector protein	H9A0V3	Staphylococcus_phage	8.8e-05	35.6
WP_061871712.1\|1057807_1058878_-	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	7.7e-33	30.3
WP_133279727.1\|1058891_1059539_-	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_133279728.1\|1059647_1060592_-\|capsid	minor capsid protein	NA	NA	NA	NA
WP_133279729.1\|1060591_1062250_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	8.2e-66	32.6
WP_133279730.1\|1062239_1063526_-\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	1.5e-115	50.6
WP_053566680.1\|1063509_1063974_-	hypothetical protein	Q597W0	Lactobacillus_virus	8.2e-32	56.4
WP_003644595.1\|1064319_1065582_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163600798.1\|1065435_1066050_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_053566678.1\|1066619_1067048_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.9e-59	78.0
WP_133279700.1\|1067430_1069194_+	hypothetical protein	NA	NA	NA	NA
WP_133279699.1\|1069560_1069863_-	hypothetical protein	E9LUN7	Lactobacillus_phage	2.2e-41	82.0
WP_062688445.1\|1069995_1070838_-	ATP-binding protein	O03914	Lactobacillus_phage	4.6e-158	99.3
WP_069710545.1\|1070818_1071607_-	DNA replication protein DnaD	NA	NA	NA	NA
WP_133279698.1\|1071687_1072233_-	DUF669 domain-containing protein	D2KRE3	Lactobacillus_phage	2.5e-27	45.4
WP_058011814.1\|1072229_1072898_-	AAA family ATPase	E9LUU1	Lactobacillus_phage	9.2e-93	75.6
WP_053566668.1\|1072904_1073414_-	hypothetical protein	NA	NA	NA	NA
WP_061871426.1\|1073946_1074210_-	hypothetical protein	NA	NA	NA	NA
WP_072536110.1\|1074224_1074773_-	hypothetical protein	NA	NA	NA	NA
WP_058011817.1\|1074837_1075020_-	hypothetical protein	NA	NA	NA	NA
WP_024971535.1\|1075245_1075446_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024971534.1\|1075593_1075830_+	helix-turn-helix transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	2.2e-09	36.0
WP_053566663.1\|1075867_1076182_+	hypothetical protein	NA	NA	NA	NA
WP_058011821.1\|1076279_1076546_-	helix-turn-helix transcriptional regulator	O03906	Lactobacillus_phage	3.0e-39	96.6
WP_053566661.1\|1076714_1077113_+	helix-turn-helix transcriptional regulator	O03970	Lactobacillus_phage	3.6e-68	97.0
WP_058011822.1\|1077121_1077553_+	hypothetical protein	O03904	Lactobacillus_phage	2.8e-66	83.6
WP_133279696.1\|1078853_1080536_+	AAA family ATPase	NA	NA	NA	NA
WP_133279695.1\|1080610_1081525_+	DNA adenine methylase	NA	NA	NA	NA
WP_133279694.1\|1081607_1082828_+\|integrase	site-specific integrase	A0A0P0I3D2	Lactobacillus_phage	1.9e-83	42.1
1083604:1083617	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1286307 : 1296144

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|1286307_1287303_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|1287929_1288067_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_011101401.1\|1288162_1288603_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
WP_003643095.1\|1288673_1289234_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
WP_061876166.1\|1289321_1291760_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
WP_003643097.1\|1291762_1292377_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_027822909.1\|1292719_1293667_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.0e-177	99.7
WP_033608586.1\|1293852_1294824_+	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	5.9e-181	98.5
WP_061876165.1\|1294914_1296144_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	4.6e-215	97.4

DBSCAN-SWA_5

1503869 : 1610970

103

Lactobacillus_phage(61.36%)

transposase,terminase,tRNA,head,integrase,holin,capsid,tail,protease,portal

attL 1518368:1518384|attR 1601425:1601441

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046947841.1\|1503869_1504793_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	2.6e-13	27.2
WP_046947814.1\|1505298_1506933_-	TIGR04141 family sporadically distributed protein	NA	NA	NA	NA
WP_046947815.1\|1507423_1509364_-	ATP-dependent helicase	NA	NA	NA	NA
WP_046947816.1\|1509345_1511715_-	AAA family ATPase	NA	NA	NA	NA
WP_046947817.1\|1511943_1513191_-	hypothetical protein	NA	NA	NA	NA
WP_080343129.1\|1513216_1514254_-	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_046947819.1\|1514770_1514968_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_063489331.1\|1515002_1516385_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_157664747.1\|1516442_1517480_-	hypothetical protein	NA	NA	NA	NA
WP_046947822.1\|1517508_1518468_-	glycosyltransferase	NA	NA	NA	NA
1518368:1518384	attL	NA	NA	NA	NA
WP_046947823.1\|1518452_1519727_-	hypothetical protein	NA	NA	NA	NA
WP_046947824.1\|1519710_1520751_-	glycosyltransferase	NA	NA	NA	NA
WP_046947825.1\|1520770_1521856_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_046947826.1\|1521855_1522533_-	sugar transferase	NA	NA	NA	NA
WP_046947827.1\|1522513_1523461_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI6	Catovirus	1.8e-41	34.9
WP_027822000.1\|1523478_1524252_-	tyrosine protein phosphatase	NA	NA	NA	NA
WP_011101299.1\|1524238_1524967_-	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_052751298.1\|1524978_1525749_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_076657828.1\|1526105_1526708_+\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	1.7e-32	42.5
WP_046947829.1\|1526765_1527770_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	2.0e-67	41.5
WP_057136724.1\|1527975_1529175_+	hypothetical protein	NA	NA	NA	NA
WP_046947831.1\|1529345_1530764_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_133279742.1\|1531006_1532326_-	oligosaccharide repeat unit polymerase	NA	NA	NA	NA
WP_052098028.1\|1532390_1533437_-	sugar transferase	NA	NA	NA	NA
WP_046947833.1\|1533426_1534428_-	hypothetical protein	NA	NA	NA	NA
WP_052098027.1\|1534435_1535437_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.3e-10	30.4
WP_046947845.1\|1535457_1536240_-	DUF4422 domain-containing protein	NA	NA	NA	NA
WP_133279741.1\|1536299_1537421_-	hypothetical protein	NA	NA	NA	NA
WP_046947835.1\|1537425_1538016_-	AAA family ATPase	NA	NA	NA	NA
WP_046947836.1\|1538020_1538686_-	hypothetical protein	NA	NA	NA	NA
WP_046947837.1\|1538976_1540092_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	8.8e-173	79.3
WP_003643315.1\|1540241_1540958_-	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_003643314.1\|1541147_1542077_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_003646267.1\|1542462_1543581_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.7e-20	31.2
WP_011101277.1\|1543786_1544962_-	serine hydrolase	NA	NA	NA	NA
WP_046947838.1\|1545229_1546576_+	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
WP_061876112.1\|1546658_1547222_-	hypothetical protein	NA	NA	NA	NA
WP_003643305.1\|1547655_1548096_-	hypothetical protein	NA	NA	NA	NA
WP_003643304.1\|1548295_1548496_+	hypothetical protein	NA	NA	NA	NA
WP_003643303.1\|1548645_1549512_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644138.1\|1549504_1550812_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003643301.1\|1550945_1551386_+	universal stress protein	NA	NA	NA	NA
WP_003644595.1\|1551486_1552749_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_060417438.1\|1553244_1553460_-	hypothetical protein	NA	NA	NA	NA
WP_060417439.1\|1553740_1554118_-\|holin	holin	A0A2H4PBB2	Lactobacillus_phage	3.1e-13	81.2
WP_060417440.1\|1554128_1554392_-\|holin	holin	E9LUR9	Lactobacillus_phage	1.1e-33	87.4
WP_060417441.1\|1554391_1555564_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.4e-200	89.7
WP_060417442.1\|1555579_1556455_-	hypothetical protein	E9LUR7	Lactobacillus_phage	9.2e-133	88.1
WP_003641409.1\|1556603_1556843_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.9e-32	97.4
WP_060417444.1\|1559605_1562017_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	91.8
WP_060417445.1\|1562083_1563856_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	1.1e-310	92.2
WP_133279610.1\|1563920_1568777_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	61.2
WP_015640500.1\|1568808_1568994_-	hypothetical protein	NA	NA	NA	NA
WP_060417447.1\|1569038_1569413_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	1.0e-56	93.5
WP_060417448.1\|1569492_1570152_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	1.4e-104	91.7
WP_060417449.1\|1570167_1570548_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	1.6e-57	88.9
WP_060417450.1\|1570547_1570955_-	hypothetical protein	A0A2P0ZLE6	Lactobacillus_phage	1.2e-66	94.7
WP_060417451.1\|1570957_1571305_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	5.2e-55	93.0
WP_060417452.1\|1571305_1571584_-	hypothetical protein	A0A2P0ZLF2	Lactobacillus_phage	9.9e-33	72.8
WP_060417453.1\|1571674_1573036_-\|capsid	phage major capsid protein	A0A0M7RF71	Lactobacillus_phage	8.2e-96	60.1
WP_060417454.1\|1573042_1573648_-\|head,protease	HK97 family phage prohead protease	B8R651	Lactobacillus_phage	8.2e-40	49.1
WP_060417455.1\|1573619_1574738_-\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	1.8e-64	39.2
WP_060417456.1\|1574957_1576874_-\|terminase	terminase large subunit	A0A0M7RDK9	Lactobacillus_phage	5.7e-135	42.0
WP_049821959.1\|1576860_1577295_-\|terminase	phage terminase small subunit P27 family	B8R648	Lactobacillus_phage	8.3e-18	37.7
WP_060417457.1\|1577529_1577832_-	hypothetical protein	NA	NA	NA	NA
WP_060417458.1\|1577858_1578518_-	HNH endonuclease	E9LUP6	Lactobacillus_phage	1.6e-17	89.6
WP_033098961.1\|1578677_1579490_-	hypothetical protein	NA	NA	NA	NA
WP_133279611.1\|1580698_1581124_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	1.2e-61	80.9
WP_080440299.1\|1581340_1581775_-	hypothetical protein	A0A2K9VD97	Lactobacillus_phage	8.8e-36	55.3
WP_060417460.1\|1581855_1582110_-	hypothetical protein	A0A2H4PBA1	Lactobacillus_phage	1.1e-35	82.1
WP_060417461.1\|1582263_1582572_-	hypothetical protein	E9LUN7	Lactobacillus_phage	6.2e-44	86.3
WP_060417462.1\|1582707_1583493_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.2e-131	91.2
WP_052098025.1\|1584282_1584840_-	hypothetical protein	X2KXT0	Enterococcus_phage	1.1e-22	51.4
WP_060417463.1\|1584915_1585173_-	hypothetical protein	NA	NA	NA	NA
WP_003641371.1\|1585628_1585829_-	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
WP_016511003.1\|1585831_1586080_-	hypothetical protein	E9LUT6	Lactobacillus_phage	2.3e-28	75.0
WP_003641369.1\|1586092_1586296_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003641368.1\|1586461_1586752_+	hypothetical protein	NA	NA	NA	NA
WP_003641367.1\|1587345_1587606_-	hypothetical protein	NA	NA	NA	NA
WP_025015699.1\|1587663_1587885_+	hypothetical protein	NA	NA	NA	NA
WP_003641365.1\|1587879_1588128_-	hypothetical protein	NA	NA	NA	NA
WP_060417464.1\|1588141_1588351_-	hypothetical protein	NA	NA	NA	NA
WP_060417479.1\|1588362_1589082_-	antirepressor	D2IZW4	Enterococcus_phage	9.1e-70	57.9
WP_033608412.1\|1589115_1589325_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_050495853.1\|1589579_1590014_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033608411.1\|1590023_1590500_+	hypothetical protein	NA	NA	NA	NA
WP_003641356.1\|1591540_1591855_+	hypothetical protein	NA	NA	NA	NA
WP_060417466.1\|1592022_1593204_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.4e-59	38.2
WP_046947873.1\|1593445_1594780_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
WP_003641353.1\|1594792_1595800_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003638174.1\|1595986_1596187_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641352.1\|1596530_1596896_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_003641351.1\|1597051_1597828_-	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
WP_003644133.1\|1597852_1598731_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_003641349.1\|1598855_1599740_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003644132.1\|1599732_1601049_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_024971402.1\|1601289_1603629_-	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	2.4e-39	24.9
1601425:1601441	attR	NA	NA	NA	NA
WP_003641346.1\|1603896_1604475_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003641345.1\|1604928_1606302_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.2e-124	50.0
WP_003641344.1\|1606635_1607658_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
WP_003641343.1\|1607762_1609187_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_003641342.1\|1609186_1610650_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_003641341.1\|1610649_1610970_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA

DBSCAN-SWA_6

2008103 : 2016727

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013355240.1\|2008103_2009099_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
WP_003640969.1\|2009237_2010023_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_013355239.1\|2010026_2010923_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
WP_003640967.1\|2011021_2011369_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|2011393_2012413_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|2012429_2012759_-	hypothetical protein	NA	NA	NA	NA
WP_011101140.1\|2012755_2013421_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|2013818_2014070_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|2014084_2014684_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|2014699_2015008_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|2015029_2016727_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_7

2163052 : 2224246

uncultured_Mediterranean_phage(22.22%)

protease,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_061876050.1\|2163052_2164324_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-96	43.7
WP_003642042.1\|2164790_2166404_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|2166576_2167185_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|2167229_2167670_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_024971479.1\|2168032_2168965_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003642038.1\|2168979_2170332_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003642037.1\|2170351_2171161_+	sugar-phosphatase	NA	NA	NA	NA
WP_024971609.1\|2171329_2172316_-	hypothetical protein	NA	NA	NA	NA
WP_003642034.1\|2172398_2173421_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|2173709_2174690_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003642032.1\|2175055_2175880_-	serine hydrolase	NA	NA	NA	NA
WP_061876049.1\|2176115_2177498_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|2177566_2178403_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|2178895_2179159_-	hypothetical protein	NA	NA	NA	NA
WP_003642028.1\|2179173_2179716_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003646500.1\|2180794_2181592_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|2181584_2182283_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|2182551_2183496_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003642021.1\|2183805_2184672_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|2184804_2185056_-	Veg protein	NA	NA	NA	NA
WP_003642019.1\|2185160_2186051_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|2186047_2186611_-	ribonuclease M5	NA	NA	NA	NA
WP_003642017.1\|2186597_2187374_-	TatD family hydrolase	NA	NA	NA	NA
WP_043992601.1\|2188675_2189566_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_016511603.1\|2189599_2190784_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003643823.1\|2191016_2193068_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_033608013.1\|2193389_2193818_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_027821490.1\|2194373_2195216_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_027821491.1\|2195215_2195920_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_027821492.1\|2195941_2196901_-	hypothetical protein	NA	NA	NA	NA
WP_046947774.1\|2196893_2198168_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|2198213_2199131_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_061876048.1\|2199299_2200094_-	hypothetical protein	NA	NA	NA	NA
WP_046947773.1\|2200098_2201232_-	hypothetical protein	NA	NA	NA	NA
WP_046947772.1\|2201685_2202699_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003642004.1\|2202811_2203558_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011101006.1\|2203707_2204604_-	ROK family protein	NA	NA	NA	NA
WP_003642002.1\|2204724_2206161_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
WP_003643816.1\|2206178_2207534_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_046947771.1\|2207756_2208179_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|2208168_2208357_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|2208363_2209725_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|2209797_2210508_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003643815.1\|2210913_2211930_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_021356643.1\|2212369_2213146_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_046947770.1\|2213404_2215714_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003641993.1\|2215808_2216012_-	hypothetical protein	NA	NA	NA	NA
WP_003641992.1\|2216149_2216836_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641991.1\|2216929_2217610_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641990.1\|2217696_2218365_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641987.1\|2219211_2220588_-	HlyD family secretion protein	NA	NA	NA	NA
WP_003641986.1\|2220603_2222754_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	6.1e-45	27.9
WP_003641985.1\|2223020_2223191_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
WP_003643811.1\|2223215_2223374_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_046947769.1\|2223472_2224246_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040857

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP040858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection