CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP048640	Rhizobium oryzihabitans strain M15 plasmid p8, complete sequence	0 crisprs	NA	0
NZ_CP048633	Rhizobium oryzihabitans strain M15 plasmid p1, complete sequence	0 crisprs	csa3	1
NZ_CP048635	Rhizobium oryzihabitans strain M15 chromosome M15-12, complete sequence	0 crisprs	DEDDh,csa3	0
NZ_CP048637	Rhizobium oryzihabitans strain M15 plasmid p5, complete sequence	0 crisprs	csa3,DEDDh	2
NZ_CP048636	Rhizobium oryzihabitans strain M15 plasmid p4, complete sequence	0 crisprs	NA	0
NZ_CP048638	Rhizobium oryzihabitans strain M15 plasmid p6, complete sequence	0 crisprs	NA	0
NZ_CP048639	Rhizobium oryzihabitans strain M15 plasmid p7, complete sequence	0 crisprs	NA	0
NZ_CP048632	Rhizobium oryzihabitans strain M15 chromosome M15-11, complete sequence	1 crisprs	csa3,WYL,DEDDh,cas3	14
NZ_CP048634	Rhizobium oryzihabitans strain M15 plasmid p2, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6869 : 61181

Sinorhizobium_phage(12.5%)

integrase,transposase

attL 6482:6498|attR 71083:71099

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6482:6498	attL	NA	NA	NA	NA
WP_164056692.1\|6869_7676_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_164056694.1\|7859_8249_-	hypothetical protein	NA	NA	NA	NA
WP_052821201.1\|8229_8397_-	hypothetical protein	NA	NA	NA	NA
WP_164056696.1\|8891_9206_+	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_052821204.1\|14463_15228_-	damage-inducible mutagenesis protein	NA	NA	NA	NA
WP_052821205.1\|15645_16005_+	hypothetical protein	NA	NA	NA	NA
WP_052821206.1\|16310_17084_+	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	5.0e-42	38.9
WP_052821207.1\|17162_17576_+	hypothetical protein	NA	NA	NA	NA
WP_052821208.1\|18023_18269_-	hypothetical protein	NA	NA	NA	NA
WP_052821212.1\|18283_18598_-	histidine kinase	NA	NA	NA	NA
WP_035208414.1\|18882_19119_+	hypothetical protein	NA	NA	NA	NA
WP_082186168.1\|22312_22612_-	DUF982 domain-containing protein	NA	NA	NA	NA
WP_072495314.1\|22681_23158_-	Hsp20 family protein	A0A2L0V0Y9	Agrobacterium_phage	7.9e-22	42.5
WP_052821361.1\|24342_25155_-	Ku protein	NA	NA	NA	NA
WP_052821364.1\|25167_26067_-	Ku protein	A0A0A1EPK3	Mycobacterium_phage	4.4e-13	27.3
WP_052821360.1\|26267_26444_+	hypothetical protein	NA	NA	NA	NA
WP_164056690.1\|27732_27882_-	hypothetical protein	NA	NA	NA	NA
WP_052821357.1\|27878_28631_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.9e-27	32.2
WP_003504683.1\|28627_29437_-	ABC transporter permease	NA	NA	NA	NA
WP_164056698.1\|30272_30533_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_052821354.1\|31133_31451_+	hypothetical protein	NA	NA	NA	NA
WP_052821353.1\|31467_32067_+	hypothetical protein	NA	NA	NA	NA
WP_142174431.1\|32323_33550_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_142174431.1\|33744_34971_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_142174431.1\|36016_37243_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_037093903.1\|37310_37535_-	hypothetical protein	NA	NA	NA	NA
WP_052821397.1\|38508_39516_+	PAS domain S-box protein	NA	NA	NA	NA
WP_052821398.1\|39608_40646_+	PAS domain S-box protein	NA	NA	NA	NA
WP_037093893.1\|40702_40918_-	DUF982 domain-containing protein	NA	NA	NA	NA
WP_137067665.1\|41004_41295_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_082179115.1\|41547_44784_+	PAS domain S-box protein	NA	NA	NA	NA
WP_052821400.1\|44790_45003_-	hypothetical protein	NA	NA	NA	NA
WP_164056700.1\|46518_46887_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-23	51.4
WP_164056729.1\|46892_47630_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_052821404.1\|49327_51256_-	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	1.8e-35	43.3
WP_082186165.1\|51288_52512_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_052821408.1\|52534_52831_-	hypothetical protein	NA	NA	NA	NA
WP_052821409.1\|52956_53607_-	hypothetical protein	NA	NA	NA	NA
WP_052821406.1\|53780_54542_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-27	32.9
WP_142174431.1\|56332_57559_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_142174431.1\|57753_58980_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_164056730.1\|59144_59886_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.1e-12	39.2
WP_142174431.1\|59954_61181_+\|transposase	IS701 family transposase	NA	NA	NA	NA
71083:71099	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP048632

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048632_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048632_1

471731-471834

Orphan

Consensus_repeat	Method
AAGAAGAAGGCTCCGGCCAAGAAAAAGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048632_1

>merge|NZ_CP048632|1|471731-471834|CRISPRCasFinder
AAGAAGAAGGCTCCGGCCAAGAAAAAGGCTGCTGCCAAGGCTGACGACGCCGCTGAAGGCGAAGAAGCCGCTCCGAAGAAGAAGGCTCCGGCCAAGAAGAAGGC

>NZ_CP048632|1|1|471731-471834|CRISPRCasFinder
AAGAAGAAGGCTCCGGCCAAGAAAAAGGC	TGCTGCCAAGGCTGACGACGCCGCTGAAGGCGAAGAAGCCGCTCCG
AAGAAGAAGGCTCCGGCCAAGAAGAAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048632.1\|WP_065115811.1\|469266_469413_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP048632.1\|WP_164056161.1\|476175_478116_-\|sulfatase-like-hydrolase/transferase	unknown	unknown	gnl\|CDD\|224287
NZ_CP048632.1\|WP_003495743.1\|473379_474783_-\|Si-specific-NAD(P)(+)-transhydrogenase	unknown	unknown	gnl\|CDD\|235373
NZ_CP048632.1\|WP_164056596.1\|466659_468117_-\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	unknown	unknown	gnl\|CDD\|235416
NZ_CP048632.1\|WP_082184327.1\|478360_480040_+\|NAD+-synthase	unknown	unknown	gnl\|CDD\|237577
NZ_CP048632.1\|WP_082184333.1\|459654_461187_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341246
NZ_CP048632.1\|WP_082184321.1\|488262_489246_-\|dipeptide-epimerase	unknown	unknown	gnl\|CDD\|239435
NZ_CP048632.1\|WP_003495735.1\|468643_468787_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP048632.1\|WP_164056162.1\|483070_484177_-\|DUF2865-domain-containing-protein	unknown	unknown	gnl\|CDD\|371363
NZ_CP048632.1\|WP_137067540.1\|466034_466613_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NZ_CP048632.1\|WP_003495762.1\|486856_487696_+\|UDP-2,3-diacylglucosamine-diphosphatase	unknown	unknown	gnl\|CDD\|225460
NZ_CP048632.1\|WP_003495720.1\|461183_461447_-\|acyl-carrier-protein	unknown	unknown	gnl\|CDD\|223314
NZ_CP048632.1\|WP_082184323.1\|484312_486628_-\|NADP-dependent-malic-enzyme	unknown	unknown	gnl\|CDD\|183799
NZ_CP048632.1\|WP_003503003.1\|462599_463727_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP048632.1\|WP_082184332.1\|465498_466038_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
NZ_CP048632.1\|WP_003495742.1\|472370_473021_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048632.1\|WP_082184335.1\|456980_458138_+\|aminodeoxychorismate-synthase-component-I	unknown	unknown	gnl\|CDD\|236035
NZ_CP048632.1\|WP_082184328.1\|475529_476063_-\|DUF1003-domain-containing-protein	unknown	unknown	gnl\|CDD\|226844
NZ_CP048632.1\|WP_082184326.1\|480293_480671_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319937
NZ_CP048632.1\|WP_164056160.1\|458393_459671_-\|type-III-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|143506

Protein	Function_ID	Function_description	E-value
NZ_CP048632.1\|WP_065115811.1\|469266_469413_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	6.06016e-10
NZ_CP048632.1\|WP_164056161.1\|476175_478116_-\|sulfatase-like-hydrolase/transferase	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	8.95487e-131
NZ_CP048632.1\|WP_003495743.1\|473379_474783_-\|Si-specific-NAD(P)(+)-transhydrogenase	gnl\|CDD\|235373	PRK05249, PRK05249, Si-specific NAD(P)(+) transhydrogenase.	0
NZ_CP048632.1\|WP_164056596.1\|466659_468117_-\|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO	gnl\|CDD\|235416	PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed.	0
NZ_CP048632.1\|WP_082184327.1\|478360_480040_+\|NAD+-synthase	gnl\|CDD\|237577	PRK13981, PRK13981, NAD synthetase; Provisional.	0
NZ_CP048632.1\|WP_082184333.1\|459654_461187_-\|AMP-binding-protein	gnl\|CDD\|341246	cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL). Fatty acyl-CoA ligases catalyze the ATP-dependent activation of fatty acids in a two-step reaction. The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. This is a required step before free fatty acids can participate in most catabolic and anabolic reactions.	0
NZ_CP048632.1\|WP_082184321.1\|488262_489246_-\|dipeptide-epimerase	gnl\|CDD\|239435	cd03319, L-Ala-DL-Glu_epimerase, L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides. The genomic context and the substrate specificity of characterized members of this family from E.coli and B.subtilis indicates a possible role in the metabolism of the murein peptide of peptidoglycan, of which L-Ala-D-Glu is a component. L-Ala-D/L-Glu epimerase is a member of the enolase-superfamily, which is characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.	3.94178e-119
NZ_CP048632.1\|WP_164056162.1\|483070_484177_-\|DUF2865-domain-containing-protein	gnl\|CDD\|371363	pfam11064, DUF2865, Protein of unknown function (DUF2865). This bacterial family of proteins has no known function.	1.54868e-29
NZ_CP048632.1\|WP_137067540.1\|466034_466613_+\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	2.20739e-06
NZ_CP048632.1\|WP_003495762.1\|486856_487696_+\|UDP-2,3-diacylglucosamine-diphosphatase	gnl\|CDD\|225460	COG2908, COG2908, Uncharacterized protein conserved in bacteria [Function unknown].	9.65573e-108
NZ_CP048632.1\|WP_003495720.1\|461183_461447_-\|acyl-carrier-protein	gnl\|CDD\|223314	COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	8.11041e-07
NZ_CP048632.1\|WP_082184323.1\|484312_486628_-\|NADP-dependent-malic-enzyme	gnl\|CDD\|183799	PRK12862, PRK12862, malic enzyme; Reviewed.	0
NZ_CP048632.1\|WP_003503003.1\|462599_463727_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP048632.1\|WP_082184332.1\|465498_466038_+\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	8.23103e-07
NZ_CP048632.1\|WP_003495735.1\|468643_468787_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	2.25674e-13
NZ_CP048632.1\|WP_082184335.1\|456980_458138_+\|aminodeoxychorismate-synthase-component-I	gnl\|CDD\|236035	PRK07508, PRK07508, aminodeoxychorismate synthase component I.	0
NZ_CP048632.1\|WP_082184328.1\|475529_476063_-\|DUF1003-domain-containing-protein	gnl\|CDD\|226844	COG4420, COG4420, Predicted membrane protein [Function unknown].	5.36267e-72
NZ_CP048632.1\|WP_082184326.1\|480293_480671_-\|VOC-family-protein	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	3.7691e-23
NZ_CP048632.1\|WP_164056160.1\|458393_459671_-\|type-III-PLP-dependent-enzyme	gnl\|CDD\|143506	cd06839, PLPDE_III_Btrk_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase. This subfamily is composed of Bacillus circulans BtrK decarboxylase and similar proteins. These proteins are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases, eukaryotic ornithine decarboxylases and diaminopimelate decarboxylases. BtrK is presumed to function as a PLP-dependent decarboxylase involved in the biosynthesis of the aminoglycoside antibiotic butirosin. Homodimer formation and the presence of the PLP cofactor may be required for catalytic activity.	0

>NZ_CP048632.1|WP_065115811.1|469266_469413_-|DUF1127-domain-containing-protein
MNIARSLTNWRKYRQTVTELGRMTDRELSDLGIGRQDIRRVARTAVGI
>NZ_CP048632.1|WP_003495735.1|468643_468787_-|DUF1127-domain-containing-protein
MNPIRIAKNWISYRRTINELGSLSNQALSDIGLTRYDIRNVAARSFR
>NZ_CP048632.1|WP_164056596.1|466659_468117_-|methylenetetrahydrofolate--tRNA-(uracil(54)--C(5))-methyltransferase-(FADH(2)-oxidizing)-TrmFO
MDASMQDKTTSPIHVVGGGLAGSEAAWQIAESGVPVILHEMRGVRGTDAHKGDTLAELVCSNSFRSDDATANAVGVIHAEMRLAGSLIMACADRHQVPAGGALAVDRDGFSEAVTKELENHPLVTIVREEVSGLPPKEWGNSIIATGPLTSPDLAAAIQSQTGADALAFFDAIAPIVHRDSINMDICWYQSRYDKVGPGGTGKDYINCPMDEKQYNAFIDALIAGDTVGFKEWEGTPYFDGCLPIEIMAERGRQTLRHGPMKPMGLTNAHNPTVKAYAVVQLRQDNALGTLYNMVGFQTKLKYGVQADVFRMIPGLENAEFARLGGLHRNTYIDSPILLDPSLKLKSRPDLRFAGQITGCEGYVESASVGLLAGRFAAAEQKGEAPSLPPATTALGSLLNHITGGHLSSNDEPGKRSFQPMNINFGLFPELEPGSIVKPEGVKRFRGKDKTIMKRQLVAARALRDCAEWLKEGEAATTAGIVQGP
>NZ_CP048632.1|WP_137067540.1|466034_466613_+|pilus-assembly-protein
MMVVRLQSIFTTMMRSRAGVAAVEFSLLLPMLVVLLAVMIETGRGWLSYDRFVTVVDNTARWSARFPEFEERVRTGVKTFVIAAGRPLDPEKLDLTLRSARLVGGVAVTEFAPYNFFGSAENVKWDKMLKAGNFKEEEAVIVISGRYKYRPLFSFLSNTTLEFQYVATVNPYFSRHYKYQKGNSDWKFWNVR
>NZ_CP048632.1|WP_082184332.1|465498_466038_+|pilus-assembly-protein
MSTRRSSIVSLRCCCLLRSCVADIRAATAVEFGLLMPVYFLLVFGIFEVGLALLLSLNLATAANAGGELLRKAAVSQKAVTEAELRRVIASNFLLGTTEKDMKIALIPIPDADFTAAPLTFPIENKFQAPDRKTGQYLLALGYNWRFILPTTRLLVQGGGNRPQLQNLSLAITANRVTE
>NZ_CP048632.1|WP_003503003.1|462599_463727_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MDVRAAVAIQAGKPLEVMTVQLEGPRAGEVLVEVKATGICHTDDFTLSGADPEGLFPAILGHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRATQGQGVMPDGTSRFSIGKDKIHHYMGCSTFSNYTVLPEIALAKINPDAPFDKVCYIGCGVTTGIGAVINTAKVEIGSTAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNPKEVGEDIVPYLVNMTKRNGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSVIIGVAGAGQEISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMEGKIQIDPMITHTMPLEDINKGFDLMHKGESIRGVVVY
>NZ_CP048632.1|WP_003495720.1|461183_461447_-|acyl-carrier-protein
MVSAQLREADVSETIYSYLSQRFPAHAPFAADTQLLEGGVIDSLGFLELMIFLGEGFGIILSDEHFTPGNLGTPADLIAFVMQERRK
>NZ_CP048632.1|WP_082184333.1|459654_461187_-|AMP-binding-protein
MTPHVLLHHLLTARAESSGEALVFKEKSLSYREFSQAAERCAAALQDAGAERGDRVVIFLPRGIEECWSIFGVSMAGGVFVPVNALLKAQQIRHIVRDCGAKIVISSAAMTDELKAALEDLPHVKVLQAEDMDNRPAAPAKASAAIGEDLAAILYTSGSTGSPKGVMLSHRNLLAGARIVRTYLEITEKDRILSILPFSFDYGLNQLLTAVEQGATTIISTFRLGDDIVRDLRDHAITGLAGVPTVWAILTRAAPLLAKTPLPHLRYITNSGGRVPQETVRALREKLPDTKIYLMYGLTEAFRSTFLPPEEIDRRPTSIGKAIPECEIFIVTAEGQRAKPGEPGILVHRGPTVSLGYWNRPEDTAKVLRPHPFIPAERGGETVCYSGDLAVEDEDGFFSFVARNDAMIKSSGYRISPTEVEESLMSTGLFQQVAVIGLPDPFAGEKVHAVATAANENIDLSTALKKAAEMLAPFMIPRAIELVDRLPVTANGKVDYRALVRERTDNGAHG
>NZ_CP048632.1|WP_164056160.1|458393_459671_-|type-III-PLP-dependent-enzyme
MAPTDKPQSHGPALAAAQFAVDENDLVIGGLAVRDIVAETGTPCFLYDASAMRRAYRDLATALSGFADIFYSVKANPLPAIISLFREEGAGAEIASVGEYHAAIKAGMPPENIIFAGPGKRAAELLEVIKGGIGEIHIESAEEIARIEAIGRPVKASIRINPVPDTQAGAMRMGGKATAFGFDEEELENVLPLFKDIRHIDLVGVHIYGGTQILDAEMLISQWRHSILLAARMAEMLGRPLRTIDLGGGLGIPYFTGETPLDLAAVSAAIPDLKALMQAHPLIADAHVIVEPGRFLAGPGGVYVAEVNSVKTSRGTTFVVTDGGMHHHLAASGNLGQIVKRNYPIVTPAMMQADYGETATIVGPLCTPLDTLARNATLPNLKAGDLLAILQSGAYGASASPSGFLSHPAAKEVLVEDGAFGVIGR
>NZ_CP048632.1|WP_082184335.1|456980_458138_+|aminodeoxychorismate-synthase-component-I
MAHAPYVLFRDDTTGTVTAFTEPEEIIVADEPEAFFAALKRMEQLRRDGKYLAGYMSYEAGFLFEPKLAPLAAEPRNVPFLRFGVFSGPQPDEGRFARPTDLPDADAFLSDPVPAWSLEDYCQRFERLHGHLRRGDCYQGNLTMPVHARWSGDPLTAFWSLVERQPVRYGALVDLGGPVILSRSPELFFAVDAQGFIETHPMKGTTPRGANAQEDRAIIAAMLEDEKTLAENRMIVDLLRNDISRITEVGSLDVPRLFDIETYPTVHQMVSHVRAKLLPGVTVEDIFAALFPCGSVTGAPKMWAMKILRELEQTPRDAYCGAIGFMSPHGEMRFSVAIRTLSLFDDGRAVFNVGGGIIFDSVAEAEYDECLLKSKFAVGDRLLRE
>NZ_CP048632.1|WP_003495742.1|472370_473021_+|hypothetical-protein
MSPRTGFALLFSLFAVTGTAAHADEAGLIWKPVKNSDRSYTARIGAKLPVDTPIRAGLEMGMNASRTGQVVDTPVRLWGNVTLLAEQLPGVSLARDVGVIFNALTGSSSVSMTSQQKRIVTPELDIEANRNFTVRYDGTAQQWNGLDVSQSLRLSRSETGTAFVLTGASRNSFNEFSSGVAVEQKIGDNLTVRGTLDQGYADHFRPGVSARYSIRW
>NZ_CP048632.1|WP_003495743.1|473379_474783_-|Si-specific-NAD(P)(+)-transhydrogenase
MHQFDLIVVGSGPAGRRAAIQAAKLEKKVLVIEKGSRVGGVSVHTGTIPSKTLRETALNLTGWRERGFYGRSYRVKQEIDADDLRRRLLITLDHEVEVLEHQFARNRVQHIRGTASFVDANTMKVVKSDGEIMTVTGTSILLTIGTRPYRPPHIPFDGEAVLDSDEILEIKELPRSMVVVGAGVIGIEYATIFSALDTQVTVVEPRETMLEFIDKEIVEDFTYQLRDRNMKLIFGQKAEKVERDETGKCLVTLGNGRVLKAETVLFAAGRVGATDTLNLSACGLEADSRGRLKVDPETFQTSVPNIYAAGDIIGFPSLASTSMEQGRIAARHAVGAPAGEPPQFFPYGIYAVPEISTCGLTEEEVIERGIPYECGIAHFRETSRGHIMGLDSGLLKMIFSLKTRRLLGVHIVGEGATELVHIGQAVLNLKGTVEYFVENTFNYPTLAEAYKIAGLDAWNRMGELKKD
>NZ_CP048632.1|WP_082184328.1|475529_476063_-|DUF1003-domain-containing-protein
MTDISDYIVSHFKRSSREIGEVERRILELSHQKKLVSSDINAEFSAGASLGDKLADNIAKVGGSWGFILSFCLFLVFWAVVNTIVLATRAFDPYPFIFLNLLLSMLAAIQAPIIMMSQNRQAARDRFEAAKDYEVNLKAELEVLSLHEKIDVKVLAELAALRQDLANLHHHVTRKED
>NZ_CP048632.1|WP_164056161.1|476175_478116_-|sulfatase-like-hydrolase/transferase
MSLRHSAPKTTASEKAGFVFSPAWTRSLLKLSGTAYTLANLTFSSVMLVVALEWIARGSLTDVGAFLTSSARPGLTTIAAMLLLLVALDSILGRRYLSLIAVAPLCLLTGLISAQKQTYLSDPLYPSDLLFGRQILELLPTMLKAQPLTAVLVGLGLCATVAALAALWLLARRHSPGLSWRERFAGLALALPLLASLASLMDYSHYSWVRDRLNIIPMMWDQQENYRHNGFLMAFAFNIPMANVSAPQGYGENSIADLTAQPAAFAANKGDYPDVIMLMSESLWDPTRIEKVKLSADPMPTIRAKQSGNVFSPEFGGMTANVEFEALTGFSNAFLPYGSIPYQQYIRRPVPSLASFFRGEGYSAIAMHPFQEWFWNRKQVYQNFGFEEFRSEETLPAMEKRGNFASDDALMDEIMATAEQARNPLFLFAVTLQGHGPYEAGRYAADTIGVEGDLSPSASQALTTYSQGVVEADEALLKLMRWAKKRDRETIIVLFGDHLPPLGQTFVESGYMPGMVASRRAPLEVMKKEHETPLVVWSSKKGVRKNIGTISPALLPYHVLKTAGFSDPFYTGTLGEVQQAFSVIDRHMLVGTDGEALPDWSIAPNSIPDVVRDYRLLQFDMMFGEQYGRERFFPGFNWVNEGTPSV
>NZ_CP048632.1|WP_082184327.1|478360_480040_+|NAD+-synthase
MSDRHDIKNHLRIAVGQFNPTVGDVAGNLAKAREARADAATQGADLLLLTELFISGYPPEDLVLKPAFLKACLKAVEELAAETADGGPGIVIGFPRQGEAGRHNSVALLDGGKIISLRDKIDLPNYGEFDEKRVFAEGSISGPYNFRGVRIGIPICEEIWNEMGVCETLAESGAEILLVPNGSPYYRGKLDVRHQVALKQVIESGLPLVFANQLGGQDELVFDGASFAFNADKTLAFQMSQFEATLAVTDWKRTEEGWRCESGPFSKIPEGEEADYRACMLGFRDYVNKNGFKSVVLGLSGGIDSAICAALAVDALGEERVRCIMLPYRYTSEESLKDAADCAKALGCRYDIVPIVEPVEGFLSALSDLFEGTEEGITEENLQSRTRGTILMAVSNKFGSMVVTTGNKSEMSVGYATLYGDMNGGFNPIKDLYKMQVYAISAWRNAHVPPGALGPSGEVIPANIISKAPSAELRPNQTDQDSLPPYPVLDDILECLVEKEMSVEEILARGHDVATVHRVEHLLYLAEYKRRQSAPGVKITKKNFGRDRRYPITNRFRDR
>NZ_CP048632.1|WP_082184326.1|480293_480671_-|VOC-family-protein
MNTIADHGIRFGRIAAMLPVKNIEKARDFYVGVLGFEKTFENGNPVGFMILKQGNAELHLTLQPSHKAAPFNVAHMMVSDVDALHTLCKSQGLRIIKGLQDKDYGLRAFVFEDLDGNRIDVGQAI
>NZ_CP048632.1|WP_164056162.1|483070_484177_-|DUF2865-domain-containing-protein
MTRRQSRIIGLLLPLVFITPAAAFADQVCDTLYAQLREPPRVIGNTAEVRRYANALTRQNIEIRRIKNDLRRYGCSSGSVIIYGSPNAGLCAEIGDALVDAQSERAAIIRDRDDAMAAQRSDDGDIRRQRILAALDANGCSPLPETEAQLPPAPDVTRYPDAFRQQENQPGQAGLSPYPGSAGEGGLRTLCVRTCDGSFFPIAANASPLDFRAQAEQCQKMCPGTETELYFHSMTDQETADMVSAETGKPYKDLPTAFAYKNASAKAPGCACNMAAYHDEMQKQEEAARPEAEKPYSGITTIPSPQGDKAQKPAEQQQAAKPPEQPVPERDYDPNNSKVRVIGPKFLPDQTGRIDLKNPALKGIQPQQ
>NZ_CP048632.1|WP_082184323.1|484312_486628_-|NADP-dependent-malic-enzyme
MTSHDKNNTPANTAKADIEEQALFFHRYPRPGKLEIQATKPLGNQRDLALAYSPGVAAPCLAIHENPEMAAEYTARANLVAVISNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVFDIEIDAPGINDMVSTIAALEPTFGGINLEDIKAPECFEVERQLREKMNIPVFHDDQHGTAIIVAAAVTNALELAGKSLSSVKIVASGAGAAALACLNLLVAMGAKKENIWVHDIEGLVYDGRNTLMDEWKEVYAQKTDKRVLSETIDGADVFLGLSAAGVLKPELLERMAENPLILALANPNPEIMPEAARAARPDAMICTGRSDFPNQVNNVLCFPYIFRGALDCGATTINEEMKMAAVQAIAELAREEVSEVAAKAYSGETPIFGPNYLIPSPFDPRLILRIAPAVARAAAASGVAARPITDFEAYLDQLNRFVWRSGFIMKPVFNAAKAAEKKRIIFAEGEDERVLRAAQVLLEEGTGIPILIGRPQIIETRLKRFGLRIRPHTDFAVVNPEDDPRYRDYVDDYFALVGRAGINPEAARTIVRTNSTVIGALAVKRDEADALICGLEGRYDRHLRDVNQIIGKQEGVRSFAGLSLLITQQGALFLTDTFVNYDPTSEEVAEMAILAAKEIRRFGITPKIALASHSNFGSRDSESARKMRRALKIVQEAAPELEVDGEMQGGSALSEALRKRAMPNSVLTGEANLLVFPNLDAANITLGVTRTLTEGLHVGPILLGTALPAHILSPSVTSRGVVNMAAFAVVQASHPSV
>NZ_CP048632.1|WP_003495762.1|486856_487696_+|UDP-2,3-diacylglucosamine-diphosphatase
MKSVAGQIETRQFRTLFISDVHLGSKAAKTDYLLDFLKYHEAETIILVGDIVDGWRLRRSWYWPQGCNDVVQKILRKARKGTRIVYIPGNHDEFLREFPGMHFGGIEVAERMIHEAADGKKYLVIHGDEFDVVVRNARLLAYLGDWAYDAAIAINIAIAAVRRRIGLPYWSFSAWAKLQVKHAVNFIGEFQRVVADEARRNNVDGVICGHIHHAVMEDMDGIRYINTGDWVESCTAIAENADGSFELITWMQTSDVTAEQTSDEMEPVDIPGLIGKHAA
>NZ_CP048632.1|WP_082184321.1|488262_489246_-|dipeptide-epimerase
MPRYLQATTQRFPVAGSFTISRGTRTHADVVTCSIRDGSFTGHGECVPYPRYGESIDGVIADIEAIAEQIADGLTRQELQQAMQPGAARNAVDCALWDLEAKISGKSASERILGRAAEPLVTAYTISLADPETMAAKTAENAGRPLLKIKTGTADDEARLRAVRAAAPQARIIIDANEGWNDYNIEYYLRLAAELKISLIEQPLPAGKDAILARIDHPVLICADESVHSTRDLAGLRDRYDAINIKLDKTGGLTEALVMKAEAERLGFTIMVGCMLGTSLGMAPAVLAAQGTAFADLDGPLLLAEDRQPGLVYEGSLVYPARPELWG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3718 : 23766

Burkholderia_phage(33.33%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056562.1\|3718_4405_+\|capsid	minor capsid protein	A0A0P0IKX5	Acinetobacter_phage	4.9e-57	52.9
WP_164055987.1\|4591_6400_+	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	3.1e-66	41.5
WP_164055988.1\|6421_6922_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	5.8e-23	43.3
WP_164055989.1\|8099_8555_+	hypothetical protein	NA	NA	NA	NA
WP_164055990.1\|8558_8945_+	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	5.1e-19	47.2
WP_164055991.1\|8956_9271_+	hypothetical protein	NA	NA	NA	NA
WP_164056117.1\|9306_9780_+	hypothetical protein	A9YX26	Burkholderia_phage	9.6e-28	46.1
WP_164055992.1\|9782_10166_+	hypothetical protein	A0A2H4J1A4	uncultured_Caudovirales_phage	9.6e-10	34.8
WP_164055993.1\|10162_10744_+	hypothetical protein	NA	NA	NA	NA
WP_164055994.1\|10747_12232_+	DUF3383 family protein	A0A0P0I492	Acinetobacter_phage	2.3e-123	50.9
WP_164056122.1\|12304_12748_+	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	3.2e-41	59.3
WP_153513883.1\|12747_13149_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	5.9e-10	30.6
WP_170311449.1\|13190_13337_+	hypothetical protein	NA	NA	NA	NA
WP_164055995.1\|13336_15217_+	hypothetical protein	A0A2H4J9N7	uncultured_Caudovirales_phage	2.5e-42	34.6
WP_170311455.1\|15243_15741_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	6.1e-25	52.7
WP_164055996.1\|15755_16217_-	hypothetical protein	NA	NA	NA	NA
WP_164055997.1\|16423_16600_-	hypothetical protein	NA	NA	NA	NA
WP_164055998.1\|16668_16953_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_170311450.1\|17050_17200_+	hypothetical protein	NA	NA	NA	NA
WP_164055999.1\|17199_17583_+	hypothetical protein	NA	NA	NA	NA
WP_164056000.1\|17711_18380_+	hypothetical protein	A0A142KCV1	Gordonia_phage	1.1e-32	41.7
WP_164056001.1\|18376_18742_+	Lar family restriction alleviation protein	NA	NA	NA	NA
WP_164056002.1\|18738_19002_+	hypothetical protein	NA	NA	NA	NA
WP_164056003.1\|18998_19256_+	hypothetical protein	NA	NA	NA	NA
WP_164056004.1\|19651_19963_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	2.9e-17	50.0
WP_164056005.1\|19966_20896_+	hypothetical protein	A0A0P0HSL6	Acinetobacter_phage	1.1e-46	34.8
WP_164056006.1\|20895_21558_+	hypothetical protein	A9YX06	Burkholderia_phage	1.6e-44	47.7
WP_164056007.1\|21557_21911_+	hypothetical protein	A9YX11	Burkholderia_phage	1.7e-29	58.1
WP_164056008.1\|21910_23086_+	hypothetical protein	A9YX12	Burkholderia_phage	6.6e-94	51.2
WP_164056009.1\|23085_23766_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	2.5e-61	52.3

DBSCAN-SWA_2

285578 : 294000

Sinorhizobium_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056047.1\|285578_286091_+	hypothetical protein	A0A141GF26	Brucella_phage	3.7e-17	37.0
WP_164056048.1\|286087_286402_+	hypothetical protein	NA	NA	NA	NA
WP_164056049.1\|286398_286785_+	hypothetical protein	NA	NA	NA	NA
WP_164056050.1\|286785_287136_+	hypothetical protein	NA	NA	NA	NA
WP_164056580.1\|287832_288189_+	hypothetical protein	A0A076G6G6	Sinorhizobium_phage	1.9e-28	58.4
WP_164056582.1\|288249_288549_+	hypothetical protein	A0A076G6G8	Sinorhizobium_phage	2.7e-20	54.3
WP_164056051.1\|288545_289940_+	helicase	F8TUJ9	EBPR_podovirus	1.6e-123	49.0
WP_164056052.1\|289936_290932_+	site-specific DNA-methyltransferase	F4YCV3	Synechococcus_phage	2.3e-87	52.8
WP_164056053.1\|290921_291284_+	hypothetical protein	NA	NA	NA	NA
WP_164056054.1\|291252_291843_+	hypothetical protein	NA	NA	NA	NA
WP_164056055.1\|291835_292039_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052817745.1\|292035_292239_+	hypothetical protein	NA	NA	NA	NA
WP_164056056.1\|292226_292508_+	hypothetical protein	A0A2I7QMY9	Vibrio_phage	2.8e-06	41.1
WP_164056057.1\|292587_294000_+	DNA (cytosine-5-)-methyltransferase	A0A2I7QRH3	Vibrio_phage	2.0e-60	36.2

DBSCAN-SWA_3

298719 : 320274

Sinorhizobium_phage(35.71%)

head,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056064.1\|298719_300063_+	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	6.6e-114	51.1
WP_111791271.1\|301859_302186_+	hypothetical protein	NA	NA	NA	NA
WP_164056065.1\|302301_303270_+	hypothetical protein	R9TJ64	Synechococcus_phage	3.6e-130	75.6
WP_142173786.1\|303991_304426_+	hypothetical protein	A0A0S2SY74	Pseudomonas_phage	1.2e-05	38.8
WP_164056066.1\|304453_304768_+	hypothetical protein	NA	NA	NA	NA
WP_164056067.1\|304767_304998_+	hypothetical protein	A0A2D0Z7D0	Vibrio_phage	1.4e-08	49.2
WP_164056068.1\|304997_305516_+	hypothetical protein	R9TG38	Synechococcus_phage	1.6e-12	39.8
WP_164056069.1\|305515_305866_+	hypothetical protein	A0A2H4J5T3	uncultured_Caudovirales_phage	5.3e-07	31.1
WP_164056070.1\|305875_306226_+	hypothetical protein	NA	NA	NA	NA
WP_164056071.1\|306355_307393_+\|head	head morphogenesis protein	A0A076G6I6	Sinorhizobium_phage	2.2e-80	49.8
WP_162691458.1\|307815_308010_-	hypothetical protein	NA	NA	NA	NA
WP_164056072.1\|308023_308449_+	hypothetical protein	NA	NA	NA	NA
WP_164056073.1\|308463_308952_+	hypothetical protein	W6EKF5	Rhizobium_phage	1.1e-18	40.7
WP_164056074.1\|308960_309347_+	hypothetical protein	NA	NA	NA	NA
WP_164056075.1\|309529_309724_+	hypothetical protein	NA	NA	NA	NA
WP_164056076.1\|309720_309981_-	hypothetical protein	NA	NA	NA	NA
WP_164056077.1\|310041_312174_+\|tail	phage tail length tape measure family protein	I6PCW3	Cronobacter_phage	1.3e-07	38.3
WP_164056078.1\|312166_312820_+	hypothetical protein	A0A291AUM9	Sinorhizobium_phage	7.0e-53	51.8
WP_164056079.1\|313096_313684_+	DUF2163 domain-containing protein	A0A291AUM8	Sinorhizobium_phage	7.4e-70	68.6
WP_164056080.1\|313688_314093_+	hypothetical protein	A0A291AUN0	Sinorhizobium_phage	1.8e-43	66.4
WP_164056081.1\|314099_316913_+	DUF1983 domain-containing protein	A0A291AUN1	Sinorhizobium_phage	6.2e-223	56.7
WP_164056082.1\|316916_317150_+	hypothetical protein	NA	NA	NA	NA
WP_164056083.1\|318785_319160_+	hypothetical protein	NA	NA	NA	NA
WP_164056084.1\|319194_320274_+	DUF3380 domain-containing protein	W8EHB5	Pseudomonas_phage	3.1e-29	41.0

DBSCAN-SWA_4

349364 : 402666

Burkholderia_phage(20.59%)

head,capsid,protease,tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056102.1\|349364_349712_-	helix-turn-helix transcriptional regulator	A0A068C9F0	Rhizobium_phage	4.3e-33	60.0
WP_164056103.1\|350032_350344_+	hypothetical protein	NA	NA	NA	NA
WP_164056104.1\|350340_350805_+	hypothetical protein	NA	NA	NA	NA
WP_164056105.1\|350805_351009_+	hypothetical protein	NA	NA	NA	NA
WP_164056106.1\|351005_351173_+	hypothetical protein	NA	NA	NA	NA
WP_164056107.1\|351175_351502_+	hypothetical protein	NA	NA	NA	NA
WP_164056108.1\|351650_351845_-	hypothetical protein	NA	NA	NA	NA
WP_164056580.1\|351940_352297_+	hypothetical protein	A0A076G6G6	Sinorhizobium_phage	1.9e-28	58.4
WP_164056582.1\|352357_352657_+	hypothetical protein	A0A076G6G8	Sinorhizobium_phage	2.7e-20	54.3
WP_164056051.1\|352653_354048_+	helicase	F8TUJ9	EBPR_podovirus	1.6e-123	49.0
WP_164056052.1\|354044_355040_+	site-specific DNA-methyltransferase	F4YCV3	Synechococcus_phage	2.3e-87	52.8
WP_164056109.1\|355036_355393_+	hypothetical protein	NA	NA	NA	NA
WP_164056054.1\|355361_355952_+	hypothetical protein	NA	NA	NA	NA
WP_164056055.1\|355944_356148_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052817745.1\|356144_356348_+	hypothetical protein	NA	NA	NA	NA
WP_164056056.1\|356335_356617_+	hypothetical protein	A0A2I7QMY9	Vibrio_phage	2.8e-06	41.1
WP_164056590.1\|356830_358108_+	DNA (cytosine-5-)-methyltransferase	A0A2I7QRH3	Vibrio_phage	5.2e-44	34.4
WP_164056058.1\|358104_358449_+	hypothetical protein	NA	NA	NA	NA
WP_164056059.1\|358445_358715_+	hypothetical protein	NA	NA	NA	NA
WP_164056110.1\|358711_359047_+	hypothetical protein	NA	NA	NA	NA
WP_164056061.1\|359046_359526_+	hypothetical protein	NA	NA	NA	NA
WP_164056111.1\|360716_360878_+	hypothetical protein	NA	NA	NA	NA
WP_164056112.1\|360917_361073_+	hypothetical protein	NA	NA	NA	NA
WP_062653798.1\|361069_361426_+	hypothetical protein	A0A223W046	Agrobacterium_phage	3.4e-09	36.0
WP_164056113.1\|361422_361650_+	hypothetical protein	NA	NA	NA	NA
WP_164056114.1\|361676_361931_+	hypothetical protein	NA	NA	NA	NA
WP_164056115.1\|362158_362533_+	hypothetical protein	NA	NA	NA	NA
WP_164056592.1\|362606_363977_+\|terminase	phage terminase large subunit	A0A1P8VVI4	Erythrobacter_phage	9.7e-105	45.0
WP_164056116.1\|364015_365458_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	7.5e-140	56.5
WP_164056562.1\|365571_366258_+\|capsid	minor capsid protein	A0A0P0IKX5	Acinetobacter_phage	4.9e-57	52.9
WP_164055987.1\|366444_368253_+	DUF2213 domain-containing protein	A9YX03	Burkholderia_phage	3.1e-66	41.5
WP_164055988.1\|368274_368775_+	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	5.8e-23	43.3
WP_164055989.1\|369952_370408_+	hypothetical protein	NA	NA	NA	NA
WP_164055990.1\|370411_370798_+	DUF4054 domain-containing protein	A0A0M5M3S2	Salmonella_phage	5.1e-19	47.2
WP_164055991.1\|370809_371124_+	hypothetical protein	NA	NA	NA	NA
WP_164056117.1\|371159_371633_+	hypothetical protein	A9YX26	Burkholderia_phage	9.6e-28	46.1
WP_164056118.1\|371635_371842_+	hypothetical protein	NA	NA	NA	NA
WP_164056119.1\|371841_372018_+	hypothetical protein	NA	NA	NA	NA
WP_164056120.1\|372014_372596_+	hypothetical protein	NA	NA	NA	NA
WP_164056121.1\|372599_374084_+	DUF3383 family protein	A0A0P0I492	Acinetobacter_phage	7.7e-124	50.7
WP_164056122.1\|374108_374552_+	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	3.2e-41	59.3
WP_164056123.1\|374551_374953_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.0e-09	30.6
WP_164055979.1\|374982_375141_+	hypothetical protein	NA	NA	NA	NA
WP_164056594.1\|376234_377008_+	hypothetical protein	NA	NA	NA	NA
WP_170311456.1\|377034_377532_+	hypothetical protein	A0A0M3ULD5	Salmonella_phage	1.6e-25	52.7
WP_164056125.1\|377536_377998_-	hypothetical protein	NA	NA	NA	NA
WP_164056004.1\|378064_378376_+	hypothetical protein	A0A2H4J495	uncultured_Caudovirales_phage	2.9e-17	50.0
WP_164056005.1\|378379_379309_+	hypothetical protein	A0A0P0HSL6	Acinetobacter_phage	1.1e-46	34.8
WP_164056006.1\|379308_379971_+	hypothetical protein	A9YX06	Burkholderia_phage	1.6e-44	47.7
WP_164056007.1\|379970_380324_+	hypothetical protein	A9YX11	Burkholderia_phage	1.7e-29	58.1
WP_164056008.1\|380323_381499_+	hypothetical protein	A9YX12	Burkholderia_phage	6.6e-94	51.2
WP_164056009.1\|381498_382179_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	2.5e-61	52.3
WP_164056126.1\|382192_382936_+	hypothetical protein	A9YX14	Burkholderia_phage	2.3e-12	44.9
WP_164056011.1\|383520_383766_+	hypothetical protein	NA	NA	NA	NA
WP_164056012.1\|383765_384296_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_164056013.1\|384302_385637_-	hypothetical protein	NA	NA	NA	NA
WP_164056014.1\|385803_386883_+	DUF3380 domain-containing protein	W8EHB5	Pseudomonas_phage	4.0e-29	41.5
WP_164055978.1\|386879_387206_+	hypothetical protein	NA	NA	NA	NA
WP_164056015.1\|387265_387997_+	hypothetical protein	NA	NA	NA	NA
WP_164056127.1\|387993_389646_+	LamG domain-containing protein	NA	NA	NA	NA
WP_164056128.1\|389662_389998_+	hypothetical protein	A0A1Y0SY84	Sinorhizobium_phage	1.3e-07	42.1
WP_164056129.1\|390151_390451_-	hypothetical protein	NA	NA	NA	NA
WP_164056130.1\|390917_391232_+	hypothetical protein	NA	NA	NA	NA
WP_164056131.1\|391242_391479_+	hypothetical protein	NA	NA	NA	NA
WP_164056132.1\|391499_392525_-	hypothetical protein	NA	NA	NA	NA
WP_164056133.1\|392521_392893_-	hypothetical protein	NA	NA	NA	NA
WP_164056134.1\|392889_393543_-	hypothetical protein	NA	NA	NA	NA
WP_164056135.1\|395562_397188_-\|terminase	terminase large subunit	A0A2K5B285	Erysipelothrix_phage	3.3e-75	35.8
WP_164056136.1\|397171_397597_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_164056137.1\|397593_397911_-\|head	phage head closure protein	Q9MCV2	Escherichia_phage	2.4e-06	39.1
WP_164056138.1\|398025_398436_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_164056139.1\|398432_398852_-	HK97 gp10 family phage protein	B4UTQ0	Rhizobium_phage	2.6e-08	32.6
WP_164056140.1\|398844_399162_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_164056141.1\|399274_399736_-	HNH endonuclease	A0A1Q1PV86	Escherichia_phage	3.3e-25	41.3
WP_164056142.1\|399739_400225_-	hypothetical protein	NA	NA	NA	NA
WP_113380326.1\|400584_400965_-	hypothetical protein	NA	NA	NA	NA
WP_164056143.1\|400977_402117_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	1.0e-59	37.6
WP_164056144.1\|402120_402666_-\|head,protease	HK97 family phage prohead protease	A0A2D1GNL2	Pseudomonas_phage	3.9e-25	39.6

DBSCAN-SWA_5

427917 : 436335

uncultured_Mediterranean_phage(75.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035242442.1\|427917_428766_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.0e-35	34.3
WP_137037732.1\|428755_429490_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.9e-39	47.6
WP_035223099.1\|429619_429835_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	1.0e-08	70.5
WP_082184353.1\|429888_430608_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003495662.1\|430604_431408_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.1e-42	41.2
WP_082184352.1\|431512_432796_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.3e-99	46.0
WP_003495666.1\|433002_433773_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-23	29.1
WP_167373900.1\|433769_434423_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.3e-11	35.1
WP_164056159.1\|434769_436335_+	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	I3PV24	Clostridium_phage	1.1e-11	30.4

DBSCAN-SWA_6

452780 : 461187

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003495706.1\|452780_453275_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.1e-26	37.7
WP_035223126.1\|453304_453874_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	3.2e-46	57.9
WP_003495709.1\|453910_454420_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.4e-45	58.8
WP_082184337.1\|454731_455814_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_082184336.1\|455813_456944_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.0e-104	53.0
WP_082184335.1\|456980_458138_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	6.8e-43	43.9
WP_164056160.1\|458393_459671_-	type III PLP-dependent enzyme	NA	NA	NA	NA
WP_082184333.1\|459654_461187_-	AMP-binding protein	A0A2K9KZV5	Tupanvirus	3.3e-21	22.4

DBSCAN-SWA_7

1135909 : 1143350

Burkholderia_phage(50.0%)

portal,head,tail,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082183974.1\|1135909_1136131_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_082183973.1\|1136127_1136487_-	gene transfer agent family protein	NA	NA	NA	NA
WP_003497085.1\|1136486_1136894_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_164056617.1\|1136985_1138215_+	MFS transporter	NA	NA	NA	NA
WP_082183972.1\|1138222_1138618_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_082183971.1\|1138614_1138950_-\|head	phage head closure protein	NA	NA	NA	NA
WP_082183970.1\|1138953_1139523_-\|head,tail	phage head-tail connector protein	NA	NA	NA	NA
WP_082183969.1\|1139722_1140991_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	1.0e-76	42.4
WP_003497097.1\|1141669_1141990_-	hypothetical protein	NA	NA	NA	NA
WP_082184631.1\|1142183_1143350_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	3.2e-64	39.0

DBSCAN-SWA_8

1357592 : 1391935

Rhizobium_phage(97.83%)

head,plate,tail,transposase,terminase,integrase

attL 1353993:1354008|attR 1369714:1369729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1353993:1354008	attL	NA	NA	NA	NA
WP_003492047.1\|1357592_1358384_-	helix-turn-helix domain-containing protein	R9U2Q5	Rhizobium_phage	2.9e-138	98.4
WP_035241028.1\|1358529_1358832_+	helix-turn-helix domain-containing protein	R9U1A5	Rhizobium_phage	1.7e-49	99.0
WP_003492045.1\|1358828_1359530_+	hypothetical protein	R9U0S2	Rhizobium_phage	5.4e-67	64.5
WP_003492043.1\|1359650_1360610_+	ParB N-terminal domain-containing protein	R9U496	Rhizobium_phage	2.5e-107	69.0
WP_035241025.1\|1360609_1361074_+	hypothetical protein	R9U2Q7	Rhizobium_phage	7.4e-81	98.7
WP_003492039.1\|1361070_1363347_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	R9U1A8	Rhizobium_phage	0.0e+00	96.4
WP_003492037.1\|1363374_1364142_+	ATP-binding protein	R9U430	Rhizobium_phage	1.3e-138	98.8
WP_003492034.1\|1364138_1364705_+	hypothetical protein	R9U0S5	Rhizobium_phage	5.4e-94	92.0
WP_035241022.1\|1364686_1365076_+	MarR family transcriptional regulator	R9U499	Rhizobium_phage	6.6e-67	96.1
WP_003492029.1\|1365065_1365272_+	hypothetical protein	R9U2R2	Rhizobium_phage	3.8e-29	97.1
WP_003492026.1\|1365285_1365561_+	hypothetical protein	R9U1B1	Rhizobium_phage	2.5e-28	74.7
WP_164056227.1\|1365578_1366106_+	host-nuclease inhibitor Gam family protein	R9U434	Rhizobium_phage	8.9e-83	94.7
WP_035241019.1\|1366116_1366395_+	hypothetical protein	R9U0S7	Rhizobium_phage	9.9e-25	64.1
WP_158001514.1\|1366391_1366556_+	hypothetical protein	NA	NA	NA	NA
WP_003492019.1\|1366552_1366753_+	hypothetical protein	NA	NA	NA	NA
WP_035241017.1\|1366742_1367018_+	hypothetical protein	R9U2R5	Rhizobium_phage	3.1e-26	71.1
WP_003492014.1\|1367014_1367461_+	regulatory protein GemA	R9U1B6	Rhizobium_phage	3.1e-68	89.2
WP_003492012.1\|1367463_1367781_-	hypothetical protein	R9U440	Rhizobium_phage	2.4e-51	95.2
WP_003492010.1\|1367882_1368260_+	hypothetical protein	R9U0S8	Rhizobium_phage	2.2e-67	99.2
WP_003492008.1\|1368339_1369188_+	hypothetical protein	R9U4A9	Rhizobium_phage	9.2e-138	88.4
WP_003492006.1\|1369187_1369595_+	hypothetical protein	R9U2R8	Rhizobium_phage	1.2e-66	96.3
WP_003492004.1\|1369591_1369840_+	hemolysin XhlA family protein	R9U1B9	Rhizobium_phage	2.6e-24	70.7
1369714:1369729	attR	NA	NA	NA	NA
WP_003492002.1\|1369844_1370336_+	DUF1804 family protein	R9U444	Rhizobium_phage	6.0e-81	100.0
WP_003491999.1\|1370332_1371988_+\|terminase	phage terminase large subunit	R9U0T3	Rhizobium_phage	0.0e+00	98.5
WP_003491996.1\|1371984_1373403_+	DUF935 family protein	R9U4B4	Rhizobium_phage	9.9e-262	96.0
WP_035241842.1\|1373483_1374932_+\|head	head morphogenesis protein	R9U2S4	Rhizobium_phage	4.5e-270	92.8
WP_003491993.1\|1375035_1375500_+	phage virion morphogenesis protein	R9U1C4	Rhizobium_phage	6.4e-77	94.8
WP_139009042.1\|1375774_1376896_+	hypothetical protein	R9U448	Rhizobium_phage	2.0e-193	94.6
WP_003491989.1\|1376911_1377256_+	DUF2190 family protein	R9U0T4	Rhizobium_phage	1.9e-41	84.7
WP_003491987.1\|1377267_1378224_+	hypothetical protein	G8GWE7	Rhodobacter_phage	4.0e-121	65.6
WP_003491984.1\|1378236_1378770_+	hypothetical protein	R9U2T2	Rhizobium_phage	2.1e-47	87.3
WP_003491981.1\|1378867_1379338_+	DUF1320 family protein	R9U1C9	Rhizobium_phage	6.3e-80	95.5
WP_035241010.1\|1379334_1379820_+	hypothetical protein	R9U453	Rhizobium_phage	2.7e-78	90.8
WP_003491976.1\|1379833_1380055_+	hypothetical protein	R9U0U0	Rhizobium_phage	1.1e-29	87.7
WP_003491974.1\|1380058_1381318_+\|tail	phage tail sheath subtilisin-like domain-containing protein	R9U4C2	Rhizobium_phage	2.4e-235	98.6
WP_003491972.1\|1381333_1381846_+\|tail	phage major tail tube protein	R9U2T4	Rhizobium_phage	8.9e-96	98.2
WP_003491970.1\|1381887_1382205_+	hypothetical protein	R9U1D3	Rhizobium_phage	9.5e-48	89.5
WP_003491968.1\|1382286_1382652_+	hypothetical protein	R9U460	Rhizobium_phage	2.1e-30	63.5
WP_003491967.1\|1382678_1382816_+	hypothetical protein	NA	NA	NA	NA
WP_003491965.1\|1382902_1385383_+	hypothetical protein	R9U4C6	Rhizobium_phage	1.5e-252	90.2
WP_003491963.1\|1385387_1385564_+	hypothetical protein	NA	NA	NA	NA
WP_003491961.1\|1385560_1386037_+\|tail	phage tail protein	R9U2U2	Rhizobium_phage	1.1e-79	96.8
WP_003491959.1\|1386033_1386303_+\|tail	tail protein X	R9U1D8	Rhizobium_phage	6.0e-43	93.3
WP_139009041.1\|1386305_1387304_+	late control protein D	R9U464	Rhizobium_phage	4.6e-173	95.5
WP_003491955.1\|1387284_1387716_+	hypothetical protein	R9U0U6	Rhizobium_phage	1.6e-69	87.4
WP_003491953.1\|1387715_1387979_+	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	7.2e-25	93.1
WP_003491951.1\|1388090_1388498_+	hypothetical protein	R9U2U6	Rhizobium_phage	1.9e-69	93.3
WP_003491949.1\|1388490_1389624_+\|plate	baseplate J/gp47 family protein	R9U1E3	Rhizobium_phage	3.3e-191	94.3
WP_003491947.1\|1389616_1390276_+\|tail	phage tail protein I	R9U468	Rhizobium_phage	2.0e-111	95.0
WP_003491945.1\|1390279_1391935_+\|tail	phage tail protein	R9U0V1	Rhizobium_phage	5.9e-165	75.8

DBSCAN-SWA_9

1676617 : 1704003

Aurantimonas_phage(21.05%)

portal,tail,terminase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010970908.1\|1676617_1676830_-\|tail	tail protein X	A0A077K8R0	Ralstonia_phage	2.1e-11	53.2
WP_164056254.1\|1677360_1677594_+	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_164055983.1\|1677485_1678160_+	hypothetical protein	NA	NA	NA	NA
WP_164056255.1\|1680429_1680699_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_164056256.1\|1680773_1681286_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.0e-14	31.0
WP_164056257.1\|1681298_1682762_-\|tail	phage tail sheath subtilisin-like domain-containing protein	Q9ZXK4	Pseudomonas_virus	1.8e-19	29.5
WP_164056258.1\|1682878_1683451_-	hypothetical protein	A0A2L0V114	Agrobacterium_phage	5.8e-35	44.2
WP_164056259.1\|1683459_1684527_-	hypothetical protein	A0A223W077	Agrobacterium_phage	7.2e-55	45.8
WP_170311452.1\|1684588_1684762_-	hypothetical protein	NA	NA	NA	NA
WP_164056260.1\|1687052_1687718_-\|tail	phage tail protein I	A0A0A8IL57	Aurantimonas_phage	5.4e-77	63.6
WP_164056640.1\|1687714_1688656_-\|plate	baseplate J/gp47 family protein	A0A0A8IKZ9	Aurantimonas_phage	4.8e-87	55.7
WP_112161072.1\|1688664_1689042_-	GPW/gp25 family protein	K4I3Z7	Acidithiobacillus_phage	1.4e-18	50.0
WP_164056261.1\|1688992_1689190_-	hypothetical protein	NA	NA	NA	NA
WP_164056262.1\|1689200_1689752_-\|plate	phage baseplate assembly protein V	NA	NA	NA	NA
WP_164056263.1\|1689751_1690498_-	hypothetical protein	A0A0A8IKZ7	Aurantimonas_phage	6.4e-42	42.6
WP_164056642.1\|1690506_1690884_-	hypothetical protein	NA	NA	NA	NA
WP_164056264.1\|1690885_1691209_-	DUF2190 family protein	NA	NA	NA	NA
WP_164056265.1\|1691284_1692940_-	hypothetical protein	A0A2I7QRU0	Vibrio_phage	1.1e-30	30.3
WP_164056266.1\|1693039_1693690_-	hypothetical protein	B7SYD7	Stenotrophomonas_phage	2.4e-29	42.1
WP_164056267.1\|1693676_1695224_-\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	8.7e-78	38.4
WP_164056268.1\|1695223_1695418_-	hypothetical protein	NA	NA	NA	NA
WP_164056269.1\|1695417_1697199_-\|terminase	phage terminase large subunit family protein	Q9JMP6	Wolbachia_phage	4.8e-72	29.9
WP_164056270.1\|1697113_1697926_-	MerR family transcriptional regulator	A0A2K9V3V2	Faecalibacterium_phage	8.0e-06	27.8
WP_164056271.1\|1698007_1698577_-	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	1.2e-21	40.1
WP_170311453.1\|1698822_1699509_-	antitermination protein	NA	NA	NA	NA
WP_010970900.1\|1700765_1701059_-	hypothetical protein	A0A068C9G0	Rhizobium_phage	4.6e-20	50.0
WP_164056272.1\|1701692_1702244_-	hypothetical protein	A0A291AUS3	Sinorhizobium_phage	1.1e-27	42.2
WP_164056273.1\|1702240_1702621_-	DUF4031 domain-containing protein	R9TSA1	Rhizobium_phage	1.7e-30	61.0
WP_164056274.1\|1702617_1704003_-	SAM-dependent methyltransferase	A0A068C9F4	Rhizobium_phage	1.6e-126	60.2

DBSCAN-SWA_10

1707246 : 1714885

Sinorhizobium_phage(50.0%)

integrase

attL 1705434:1705448|attR 1716462:1716476

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1705434:1705448	attL	NA	NA	NA	NA
WP_112967344.1\|1707246_1707669_+	tellurite resistance TerB family protein	A0A1Y0T181	Sinorhizobium_phage	3.7e-23	48.0
WP_155276033.1\|1707671_1707818_+	hypothetical protein	NA	NA	NA	NA
WP_164056279.1\|1707876_1708068_+	hypothetical protein	NA	NA	NA	NA
WP_164056280.1\|1708125_1708389_+	hypothetical protein	NA	NA	NA	NA
WP_164056281.1\|1708385_1708568_+	hypothetical protein	NA	NA	NA	NA
WP_164056282.1\|1708598_1708931_+	hypothetical protein	A0A291AUR5	Sinorhizobium_phage	1.2e-37	75.2
WP_164056283.1\|1708990_1709896_+	DUF2303 family protein	A0A291AUR3	Sinorhizobium_phage	1.5e-106	61.9
WP_164056284.1\|1709955_1710948_+	DUF5131 family protein	R9TNA8	Rhizobium_phage	1.4e-97	53.0
WP_164056285.1\|1710944_1711391_+	hypothetical protein	A0A291AUQ6	Sinorhizobium_phage	3.8e-42	56.5
WP_164056286.1\|1711387_1711774_+	hypothetical protein	NA	NA	NA	NA
WP_164056643.1\|1712343_1712748_+	hypothetical protein	A0A0U1UNM2	Pseudomonas_phage	7.7e-18	43.5
WP_164056287.1\|1712744_1713002_+	hypothetical protein	NA	NA	NA	NA
WP_142840991.1\|1712994_1713225_+	hypothetical protein	NA	NA	NA	NA
WP_164056288.1\|1713211_1714234_+\|integrase	tyrosine-type recombinase/integrase	F8TUV0	EBPR_podovirus	1.4e-36	33.9
WP_164056645.1\|1714492_1714885_+	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	2.2e-25	49.1
1716462:1716476	attR	NA	NA	NA	NA

DBSCAN-SWA_11

1723396 : 1737557

Bordetella_phage(25.0%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056298.1\|1723396_1728775_-	hypothetical protein	K7ZRM7	Xanthomonas_citri_phage	3.7e-91	24.7
WP_164056299.1\|1728846_1729152_+	hypothetical protein	NA	NA	NA	NA
WP_164056300.1\|1729148_1729406_+	hypothetical protein	NA	NA	NA	NA
WP_164056647.1\|1729402_1730914_-	TIGR02594 family protein	A0A1V0EEJ8	Caulobacter_phage	7.9e-23	41.8
WP_164056301.1\|1731678_1732188_-	hypothetical protein	Q775D2	Bordetella_phage	7.2e-05	40.3
WP_164056302.1\|1732180_1732648_-	hypothetical protein	Q858G2	Salmonella_phage	1.7e-24	39.6
WP_164056303.1\|1732814_1734962_-	hypothetical protein	Q775D1	Bordetella_phage	1.9e-102	39.8
WP_164056304.1\|1734965_1735547_-	hypothetical protein	A0A193GYT2	Enterobacter_phage	7.7e-27	38.0
WP_164056305.1\|1735620_1736100_-	hypothetical protein	NA	NA	NA	NA
WP_164056306.1\|1736092_1736536_-	hypothetical protein	K4NYY6	Pseudomonas_phage	4.2e-17	46.6
WP_164056307.1\|1736561_1737557_-\|capsid	phage capsid protein	T1S9H9	Salmonella_phage	7.6e-83	47.3

DBSCAN-SWA_12

2880454 : 2937304

Bacillus_phage(28.57%)

protease,tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082182748.1\|2880454_2881408_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003494524.1\|2881597_2882449_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_003494526.1\|2882445_2883492_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-20	32.5
WP_142174431.1\|2883813_2885040_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_003524068.1\|2885457_2885778_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_082182747.1\|2885930_2887106_-	DUF3095 domain-containing protein	NA	NA	NA	NA
WP_003494532.1\|2887391_2888498_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_082182745.1\|2889148_2890051_+	cation transporter	NA	NA	NA	NA
WP_003494539.1\|2890068_2890533_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	9.4e-28	50.0
WP_082182743.1\|2891404_2891995_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_035242113.1\|2892230_2892812_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.3e-29	36.7
WP_003494546.1\|2892911_2893169_-	pentapeptide MXKDX repeat protein	NA	NA	NA	NA
WP_080600263.1\|2893354_2893903_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_082182741.1\|2894626_2895709_-	esterase-like activity of phytase family protein	NA	NA	NA	NA
WP_164055984.1\|2895775_2896030_-	hypothetical protein	NA	NA	NA	NA
WP_082182740.1\|2895995_2897174_+	benzoate/H(+) symporter BenE family transporter	NA	NA	NA	NA
WP_082182739.1\|2897208_2897478_+	BrnT family toxin	NA	NA	NA	NA
WP_035242751.1\|2897467_2897701_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_164056481.1\|2898018_2899728_+	2-isopropylmalate synthase	NA	NA	NA	NA
WP_082182737.1\|2899936_2900887_-	metallophosphoesterase	NA	NA	NA	NA
WP_082182736.1\|2900953_2901445_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_082182735.1\|2901460_2902453_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_082182734.1\|2902752_2903322_+	N-acetyltransferase	NA	NA	NA	NA
WP_082182733.1\|2903659_2904973_+	MFS transporter	NA	NA	NA	NA
WP_082182732.1\|2905032_2905998_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_082182731.1\|2906085_2907039_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_082184486.1\|2907035_2907449_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_082182730.1\|2907536_2909621_-	hypothetical protein	NA	NA	NA	NA
WP_082182729.1\|2909622_2912433_-	DUF4159 domain-containing protein	NA	NA	NA	NA
WP_035242117.1\|2912429_2913344_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_082182728.1\|2913436_2914447_-	MoxR family ATPase	NA	NA	NA	NA
WP_082182727.1\|2914622_2915252_+	DUF1285 domain-containing protein	NA	NA	NA	NA
WP_164056483.1\|2915248_2915887_+	CoA pyrophosphatase	NA	NA	NA	NA
WP_082182726.1\|2915883_2917140_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A1B0V011	Roseobacter_phage	7.7e-48	32.4
WP_003523091.1\|2917166_2917352_-	DUF1059 domain-containing protein	NA	NA	NA	NA
WP_082182725.1\|2917472_2917739_-	hypothetical protein	NA	NA	NA	NA
WP_082182724.1\|2917861_2918773_-	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_035242123.1\|2918902_2919178_+	hypothetical protein	NA	NA	NA	NA
WP_003494601.1\|2919279_2920932_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_082182723.1\|2921104_2921578_-\|tRNA	tRNA (cytidine(34)-2'-O)-methyltransferase	NA	NA	NA	NA
WP_137067554.1\|2921614_2921839_-	hypothetical protein	NA	NA	NA	NA
WP_082184484.1\|2921812_2922688_+	phosphodiesterase	NA	NA	NA	NA
WP_082182722.1\|2923071_2924922_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-33	27.8
WP_082182721.1\|2925253_2927119_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-31	28.2
WP_082182720.1\|2927318_2929232_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_082182719.1\|2929292_2930225_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_035220195.1\|2930534_2931113_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_035220197.1\|2931127_2932411_+	cytochrome b N-terminal domain-containing protein	NA	NA	NA	NA
WP_035220199.1\|2932433_2933318_+	cytochrome c1	NA	NA	NA	NA
WP_003494623.1\|2933534_2934077_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.7e-34	45.8
WP_082182718.1\|2934350_2934818_-	MaoC family dehydratase	NA	NA	NA	NA
WP_003494628.1\|2934814_2935288_-	MaoC family dehydratase	NA	NA	NA	NA
WP_082184483.1\|2935635_2936739_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_035242132.1\|2936992_2937304_+\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA

DBSCAN-SWA_13

3167019 : 3176438

Rhizobium_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_082182586.1\|3167019_3168759_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.6e-19	37.2
WP_164056505.1\|3170131_3170338_-	hypothetical protein	NA	NA	NA	NA
WP_164056507.1\|3170334_3170691_-	hypothetical protein	NA	NA	NA	NA
WP_164056509.1\|3170690_3170969_-	hypothetical protein	A0A068CE33	Rhizobium_phage	2.1e-30	80.0
WP_164056511.1\|3170972_3171767_-	DUF551 domain-containing protein	NA	NA	NA	NA
WP_164056512.1\|3171756_3172053_-	hypothetical protein	NA	NA	NA	NA
WP_164056514.1\|3172042_3172249_-	hypothetical protein	NA	NA	NA	NA
WP_164056516.1\|3172229_3172622_-	hypothetical protein	A0A2H4J7V6	uncultured_Caudovirales_phage	5.6e-05	45.2
WP_082182495.1\|3172618_3172822_-	hypothetical protein	A0A068CCC3	Rhizobium_phage	1.1e-12	56.9
WP_164056036.1\|3172818_3173217_-	HNH endonuclease	A0A0U2C107	Paracoccus_phage	1.9e-24	52.2
WP_164056037.1\|3173216_3173465_-	hypothetical protein	NA	NA	NA	NA
WP_164056518.1\|3173464_3173668_-	hypothetical protein	NA	NA	NA	NA
WP_164056520.1\|3173664_3174432_-	recombination protein NinB	A0A076GCY8	Sinorhizobium_phage	2.2e-29	48.9
WP_164056523.1\|3174431_3174914_-	HNH endonuclease	A0A2I7QWC6	Vibrio_phage	2.8e-22	40.9
WP_164056525.1\|3174903_3175530_-	YqaJ viral recombinase family protein	K7ZRM9	Xanthomonas_citri_phage	3.1e-42	49.0
WP_164056527.1\|3175526_3176438_-	ERF family protein	W8EDP7	Vibrio_phage	5.1e-25	34.6

DBSCAN-SWA_14

3182786 : 3191625

Sinorhizobium_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164056550.1\|3182786_3183557_+	hypothetical protein	U5PSN4	Bacillus_phage	9.9e-14	36.4
WP_164056552.1\|3183616_3183874_+	hypothetical protein	NA	NA	NA	NA
WP_164056554.1\|3183870_3184038_+	hypothetical protein	NA	NA	NA	NA
WP_164056556.1\|3184040_3184361_+	hypothetical protein	NA	NA	NA	NA
WP_164056108.1\|3184511_3184706_-	hypothetical protein	NA	NA	NA	NA
WP_164056682.1\|3184801_3185158_+	hypothetical protein	A0A076G6G6	Sinorhizobium_phage	9.4e-28	56.6
WP_164056558.1\|3185173_3185794_+	hypothetical protein	NA	NA	NA	NA
WP_164056582.1\|3185873_3186173_+	hypothetical protein	A0A076G6G8	Sinorhizobium_phage	2.7e-20	54.3
WP_164056051.1\|3186169_3187564_+	helicase	F8TUJ9	EBPR_podovirus	1.6e-123	49.0
WP_164056052.1\|3187560_3188556_+	site-specific DNA-methyltransferase	F4YCV3	Synechococcus_phage	2.3e-87	52.8
WP_164056109.1\|3188552_3188909_+	hypothetical protein	NA	NA	NA	NA
WP_164056054.1\|3188877_3189468_+	hypothetical protein	NA	NA	NA	NA
WP_164056055.1\|3189460_3189664_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052817745.1\|3189660_3189864_+	hypothetical protein	NA	NA	NA	NA
WP_164056056.1\|3189851_3190133_+	hypothetical protein	A0A2I7QMY9	Vibrio_phage	2.8e-06	41.1
WP_164056057.1\|3190212_3191625_+	DNA (cytosine-5-)-methyltransferase	A0A2I7QRH3	Vibrio_phage	2.0e-60	36.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP048637

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17808 : 86412

uncultured_Caudovirales_phage(28.57%)

transposase,holin,integrase

attL 22999:23014|attR 88773:88788

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130521458.1\|17808_20781_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.7e-186	37.9
WP_130521259.1\|21069_22023_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_130521257.1\|22154_23432_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.5e-86	46.1
22999:23014	attL	NA	NA	NA	NA
WP_130521255.1\|23526_24420_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.3e-25	35.8
WP_130521253.1\|24440_25337_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.2e-09	35.6
WP_130521252.1\|25375_26626_+	D-amino acid dehydrogenase	NA	NA	NA	NA
WP_130521250.1\|26677_28012_+	D-serine ammonia-lyase	NA	NA	NA	NA
WP_130521248.1\|28321_28600_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_130521246.1\|28602_28896_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_130521244.1\|29013_29352_-	hypothetical protein	NA	NA	NA	NA
WP_130521242.1\|29348_30266_-	J domain-containing protein	A0A1V0SE10	Indivirus	4.1e-06	42.4
WP_130521238.1\|34310_35948_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	2.4e-57	30.7
WP_164056907.1\|37489_39214_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_130521231.1\|39206_40286_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-24	32.6
WP_130521225.1\|42762_43869_+	mandelate racemase/muconate lactonizing enzyme family protein	NA	NA	NA	NA
WP_165909500.1\|43910_44645_-	FCD domain-containing protein	NA	NA	NA	NA
WP_130519695.1\|50974_52240_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_164056969.1\|52884_53541_-	VIT1/CCC1 transporter family protein	NA	NA	NA	NA
WP_165909439.1\|54139_54352_-	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_052820499.1\|54357_54633_-	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
WP_165909441.1\|59721_60864_-	DUF1612 domain-containing protein	NA	NA	NA	NA
WP_164056908.1\|61072_61504_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_125271659.1\|61490_61769_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_162750716.1\|61846_63007_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_164056909.1\|63305_63899_-	recombinase family protein	A0A219Y912	Aeromonas_phage	1.3e-21	34.6
WP_003501158.1\|67010_67616_-	recombinase family protein	A0A0C4UR34	Shigella_phage	3.9e-42	53.1
WP_164056910.1\|69053_69365_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
WP_164056911.1\|69366_69798_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
WP_164056912.1\|74994_75396_-	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_164056913.1\|75409_76018_-	DUF1419 domain-containing protein	NA	NA	NA	NA
WP_164056914.1\|76159_77125_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_052821190.1\|77529_77883_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052821191.1\|77876_78320_+	GNAT family N-acetyltransferase	A0A2H4J155	uncultured_Caudovirales_phage	5.9e-11	35.9
WP_052821192.1\|78335_78863_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	6.7e-30	44.6
WP_052821193.1\|78862_79921_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_052821194.1\|79923_80349_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.6e-43	63.5
WP_082179066.1\|80275_81052_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	7.2e-89	67.5
WP_052821196.1\|82251_82611_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_052821197.1\|82653_83169_+	hypothetical protein	NA	NA	NA	NA
WP_164056915.1\|83217_84222_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	9.5e-17	25.9
WP_082179067.1\|84214_85177_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_052821200.1\|85173_86412_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
88773:88788	attR	NA	NA	NA	NA

DBSCAN-SWA_2

175822 : 302185

101

Escherichia_phage(13.64%)

transposase,integrase

attL 277508:277541|attR 280817:280850

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035228067.1\|175822_176575_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.5e-40	44.2
WP_080514379.1\|176745_177120_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	6.7e-08	36.4
WP_011983004.1\|178758_179457_+	hypothetical protein	NA	NA	NA	NA
WP_035228312.1\|181799_182399_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011983008.1\|182464_184444_-	oleate hydratase	NA	NA	NA	NA
WP_164056923.1\|184537_185137_-	ABC transporter permease	NA	NA	NA	NA
WP_164056924.1\|185184_185640_-	ABC transporter permease	NA	NA	NA	NA
WP_082179096.1\|185636_186845_-	ABC transporter permease	NA	NA	NA	NA
WP_164056925.1\|186847_187732_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_082179097.1\|187942_188584_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011983013.1\|188685_189885_-	sodium/glutamate symporter	NA	NA	NA	NA
WP_082186257.1\|190002_191058_-	ABC transporter permease	NA	NA	NA	NA
WP_082186256.1\|191091_192081_-\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.1e-44	36.2
WP_082186255.1\|192353_194138_-	PAS domain-containing methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-14	36.0
WP_082186254.1\|194409_197190_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.7e-18	34.3
WP_164056926.1\|197462_197612_-	hypothetical protein	NA	NA	NA	NA
WP_164056970.1\|197563_197929_+	hypothetical protein	NA	NA	NA	NA
WP_082186252.1\|197925_198423_+	AAA family ATPase	NA	NA	NA	NA
WP_082186332.1\|199393_199819_-	pseudoazurin	NA	NA	NA	NA
WP_082186331.1\|199937_200930_-	FAD:protein FMN transferase	NA	NA	NA	NA
WP_082186251.1\|200922_201489_-	nitrous oxide reductase accessory protein NosL	NA	NA	NA	NA
WP_082186250.1\|201485_202313_-	ABC transporter permease	NA	NA	NA	NA
WP_082186249.1\|202309_203230_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.4e-24	31.6
WP_082186247.1\|204598_206518_-	TAT-dependent nitrous-oxide reductase	NA	NA	NA	NA
WP_125271749.1\|207054_207807_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.6e-40	44.2
WP_164056927.1\|208513_210202_-	hypothetical protein	I6R9X8	Croceibacter_phage	2.5e-09	42.2
WP_082186245.1\|210206_210731_-	hypothetical protein	NA	NA	NA	NA
WP_082186244.1\|210786_212601_-	cyclic nucleotide-binding/CBS domain-containing protein	NA	NA	NA	NA
WP_082186243.1\|212702_214469_-	cation acetate symporter	NA	NA	NA	NA
WP_035228095.1\|214483_214744_-	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_082186241.1\|216701_217091_-	Na+/H+ antiporter subunit G	NA	NA	NA	NA
WP_082186240.1\|217102_217372_-	K+/H+ antiporter subunit F	NA	NA	NA	NA
WP_082186239.1\|217368_217857_-	Na+/H+ antiporter subunit E	NA	NA	NA	NA
WP_082186237.1\|219385_219748_-	Na+/H+ antiporter subunit C	NA	NA	NA	NA
WP_164056928.1\|224174_224507_-	hypothetical protein	A0A1B0VMK3	Pseudomonas_phage	4.7e-05	32.7
WP_164056929.1\|224488_225922_-	sensor histidine kinase	NA	NA	NA	NA
WP_164056930.1\|225944_226280_-	DUF1850 domain-containing protein	NA	NA	NA	NA
WP_082186233.1\|226311_228393_-	TRAP transporter permease	NA	NA	NA	NA
WP_082186232.1\|228475_229423_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_137067687.1\|229810_230756_+\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	2.1e-10	22.6
WP_011983001.1\|231693_233232_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.1e-47	37.1
WP_082186231.1\|233319_234114_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	2.8e-32	34.9
WP_082186230.1\|235104_236067_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	2.9e-07	30.7
WP_035228067.1\|236111_236864_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	3.5e-40	44.2
WP_164056724.1\|236919_237873_-	DUF1403 family protein	NA	NA	NA	NA
WP_164056931.1\|237997_239131_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_164056725.1\|239225_239492_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_164056733.1\|239488_239911_+	PIN domain-containing protein	NA	NA	NA	NA
WP_164056932.1\|239923_240592_+	hypothetical protein	NA	NA	NA	NA
WP_164056739.1\|240727_241615_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_164056731.1\|241693_242161_-	hypothetical protein	NA	NA	NA	NA
WP_164056738.1\|242597_243557_-	hypothetical protein	NA	NA	NA	NA
WP_164056933.1\|243954_245199_-	replication initiation protein RepC	L7TKN6	Rhizobium_phage	1.9e-19	27.4
WP_164056934.1\|245355_246348_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	3.4e-59	41.7
WP_164056935.1\|247999_248965_+	P-type conjugative transfer ATPase TrbB	NA	NA	NA	NA
WP_164056936.1\|248954_249350_+	TrbC/VirB2 family protein	NA	NA	NA	NA
WP_164056937.1\|249342_249642_+	VirB3 family type IV secretion system protein	NA	NA	NA	NA
WP_164056938.1\|249651_252087_+	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_164056939.1\|252079_252889_+	P-type conjugative transfer protein TrbJ	NA	NA	NA	NA
WP_164056940.1\|252885_253089_+	entry exclusion protein TrbK	NA	NA	NA	NA
WP_164056941.1\|253082_254264_+	P-type conjugative transfer protein TrbL	NA	NA	NA	NA
WP_164056942.1\|254285_254948_+	conjugal transfer protein TrbF	NA	NA	NA	NA
WP_164056943.1\|254964_255795_+	P-type conjugative transfer protein TrbG	NA	NA	NA	NA
WP_164056944.1\|255798_256245_+	conjugal transfer protein TrbH	NA	NA	NA	NA
WP_164056945.1\|257605_258271_-	N-acyl-L-homoserine lactone (AHL) synthase	NA	NA	NA	NA
WP_164056946.1\|258387_259251_-	autoinducer binding domain-containing protein	A0A1I9KF49	Aeromonas_phage	8.2e-09	29.3
WP_164056947.1\|259574_259874_+	transcriptional regulator	NA	NA	NA	NA
WP_164056948.1\|259885_260590_-	transcriptional regulator TraR	NA	NA	NA	NA
WP_164056971.1\|261009_261648_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_164056949.1\|261648_262263_+	RES domain-containing protein	NA	NA	NA	NA
WP_164056950.1\|262285_262897_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_164056951.1\|262914_264081_-	conjugal transfer protein TraB	NA	NA	NA	NA
WP_164056952.1\|264070_264640_-	conjugative transfer signal peptidase TraF	NA	NA	NA	NA
WP_164056953.1\|264636_268233_-	Ti-type conjugative transfer relaxase TraA	A0A2R8FE73	Brazilian_cedratvirus	2.0e-16	26.5
WP_164056954.1\|268485_268782_+	TraC family protein	NA	NA	NA	NA
WP_164056955.1\|268786_269002_+	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_164056956.1\|268988_270926_+	Ti-type conjugative transfer system protein TraG	NA	NA	NA	NA
WP_164056957.1\|270954_271152_+	hypothetical protein	NA	NA	NA	NA
WP_164056958.1\|273922_274231_+	WGR domain-containing protein	NA	NA	NA	NA
WP_164056959.1\|274227_274668_+	thermonuclease family protein	G8DH70	Emiliania_huxleyi_virus	1.2e-08	40.9
WP_170311463.1\|274702_274876_-	hypothetical protein	NA	NA	NA	NA
WP_164056960.1\|275289_275673_+	hypothetical protein	NA	NA	NA	NA
WP_170311464.1\|275758_275908_-	hypothetical protein	NA	NA	NA	NA
WP_125271654.1\|276983_277172_+	hypothetical protein	NA	NA	NA	NA
WP_170311466.1\|277183_277534_-	hypothetical protein	A0A1B1IWW8	uncultured_Mediterranean_phage	2.7e-11	55.3
277508:277541	attL	NA	NA	NA	NA
WP_080823871.1\|279772_280762_+\|integrase	site-specific integrase	A0A1P8DJ76	Virus_Rctr85	4.8e-13	32.3
WP_125271653.1\|281786_282071_+	hypothetical protein	NA	NA	NA	NA
280817:280850	attR	NA	NA	NA	NA
WP_125271652.1\|282182_282770_-	hypothetical protein	NA	NA	NA	NA
WP_125271694.1\|283089_283539_-	hypothetical protein	NA	NA	NA	NA
WP_125271649.1\|284871_286626_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_164056961.1\|286928_287819_+	DUF4238 domain-containing protein	NA	NA	NA	NA
WP_125271647.1\|287835_288645_+	hypothetical protein	NA	NA	NA	NA
WP_164056962.1\|288641_293753_-	DEAD/DEAH box helicase family protein	I6WLR1	Burkholderia_virus	0.0e+00	42.5
WP_164056963.1\|293845_294448_-	DUF1419 domain-containing protein	NA	NA	NA	NA
WP_125271645.1\|294564_295533_-	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_170311465.1\|295722_295899_-	hypothetical protein	NA	NA	NA	NA
WP_125271644.1\|296956_297661_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_125271692.1\|297950_298808_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_125271690.1\|299242_300148_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_164056964.1\|300204_300381_-	hypothetical protein	NA	NA	NA	NA
WP_125271689.1\|301480_302185_-\|transposase	IS6 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048633

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP048632

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP048637

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection