CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP044463	Acinetobacter schindleri strain HZE23-1 chromosome, complete genome	0 crisprs	TnsE_C,csa3,cas14j,cas3,DEDDh,WYL	0	8
NZ_CP044473	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-10, complete sequence	0 crisprs	NA	0	0
NZ_CP044467	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-4, complete sequence	0 crisprs	NA	0	0
NZ_CP044471	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-8, complete sequence	0 crisprs	NA	0	0
NZ_CP044468	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-5, complete sequence	0 crisprs	NA	0	0
NZ_CP044470	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-7, complete sequence	0 crisprs	NA	0	0
NZ_CP044466	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-3, complete sequence	0 crisprs	NA	0	0
NZ_CP044464	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-1, complete sequence	0 crisprs	RT,WYL,DEDDh	0	1
NZ_CP044465	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-2, complete sequence	0 crisprs	NA	0	0
NZ_CP044472	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-9, complete sequence	0 crisprs	NA	0	0
NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	1 crisprs	NA	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

106861 : 149025

uncultured_Caudovirales_phage(34.78%)

integrase,transposase

attL 92190:92206|attR 112117:112133

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
92190:92206	attL	NA	NA	NA	NA
WP_163170685.1\|106861_108982_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_163170686.1\|108968_109772_-	TnsA endonuclease C-terminal domain-containing protein	NA	NA	NA	NA
WP_039890759.1\|110200_110467_+	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_163164519.1\|110456_110945_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163170687.1\|110954_111905_-\|transposase	IS481 family transposase	E2FK51	Porcine_endogenous_retrovirus	2.1e-05	30.1
WP_163170688.1\|112549_114388_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1I2B0	Paramecium_bursaria_Chlorella_virus	3.8e-128	44.4
112117:112133	attR	NA	NA	NA	NA
WP_163170689.1\|114399_115764_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	3.5e-30	37.7
WP_163172649.1\|115784_116261_-	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_163170690.1\|116283_117201_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_004814175.1\|117221_117671_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_004895821.1\|117675_118146_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.8e-34	53.3
WP_163170691.1\|118165_119281_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	8.0e-57	37.1
WP_001067784.1\|120591_121296_-\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8
WP_163170692.1\|121337_122171_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	2.0e-60	44.9
WP_005253618.1\|122330_123422_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	9.8e-92	56.7
WP_092621673.1\|123531_124485_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.0e-60	42.3
WP_005253621.1\|124502_125207_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.4e-91	70.8
WP_010116223.1\|125211_126252_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_005253624.1\|126257_126731_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	9.3e-39	53.8
WP_163170693.1\|126735_127059_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	2.9e-20	58.5
WP_163170694.1\|127103_127538_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-44	63.3
WP_163170695.1\|127858_128563_-\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	7.2e-120	85.3
WP_163170696.1\|128626_129907_-	cation transporter	NA	NA	NA	NA
WP_004281856.1\|129996_130389_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_005180699.1\|130531_130942_+	hypothetical protein	NA	NA	NA	NA
WP_163170697.1\|130991_132359_+	TolC family protein	NA	NA	NA	NA
WP_004281853.1\|132360_133596_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_163170698.1\|133585_136744_+	CusA/CzcA family heavy metal efflux RND transporter	S5VL66	Leptospira_phage	1.8e-24	20.4
WP_163170699.1\|136829_137729_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_163170695.1\|137886_138591_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	7.2e-120	85.3
WP_005180690.1\|139689_139884_+	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
WP_016658935.1\|140063_140273_-	hypothetical protein	NA	NA	NA	NA
WP_001067856.1\|140497_141202_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	100.0
WP_001067855.1\|143065_143770_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000018326.1\|143899_144715_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.3e-161	98.5
WP_000902128.1\|144868_145048_-	hypothetical protein	NA	NA	NA	NA
WP_001067856.1\|145139_145844_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	100.0
WP_163170700.1\|145880_147200_-	DUF4113 domain-containing protein	A0A2H4JBL5	uncultured_Caudovirales_phage	8.3e-154	60.2
WP_005180682.1\|147196_147769_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	1.7e-55	59.5
WP_163172651.1\|148086_149025_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.7e-58	41.8

DBSCAN-SWA_2

160332 : 166896

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163170707.1\|160332_161532_+	methyltransferase domain-containing protein	A0A2H4J5G6	uncultured_Caudovirales_phage	3.9e-33	79.3
WP_163170708.1\|161518_162574_+	HNH endonuclease	A0A2I2MUI7	uncultured_Caudovirales_phage	6.0e-78	63.7
WP_163170709.1\|162799_163285_+	type I restriction-modification system subunit M N-terminal domain-containing protein	A0A2H4PQP4	Staphylococcus_phage	7.9e-09	53.2
WP_163170710.1\|163562_164306_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	8.0e-45	38.3
WP_163170711.1\|164316_164859_-	DUF1376 domain-containing protein	NA	NA	NA	NA
WP_163170712.1\|164927_165176_-	hypothetical protein	NA	NA	NA	NA
WP_163170713.1\|165165_166350_-	DUF3596 domain-containing protein	A0A1W6JTA0	Pseudomonas_phage	3.2e-40	30.7
WP_001054887.1\|166363_166579_-	hypothetical protein	NA	NA	NA	NA
WP_163170714.1\|166689_166896_+	helix-turn-helix domain-containing protein	S5MTW4	Brevibacillus_phage	2.7e-11	58.1

DBSCAN-SWA_3

1538866 : 1609167

Catovirus(20.0%)

holin,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163171333.1\|1538866_1540522_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	5.3e-57	30.4
WP_163171334.1\|1540651_1541422_+	hypothetical protein	NA	NA	NA	NA
WP_163171335.1\|1541763_1543965_+	OsmC domain/YcaO domain-containing protein	NA	NA	NA	NA
WP_163168155.1\|1544205_1545204_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_163166057.1\|1545191_1545986_+	PIG-L family deacetylase	NA	NA	NA	NA
WP_005222089.1\|1545966_1546575_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004894797.1\|1546571_1547294_+	glycosyltransferase	NA	NA	NA	NA
WP_034434010.1\|1547504_1548737_+	MFS transporter	NA	NA	NA	NA
WP_163171336.1\|1548768_1550199_-	trehalose-6-phosphate synthase	NA	NA	NA	NA
WP_163171337.1\|1550165_1551053_-	trehalose-phosphatase	NA	NA	NA	NA
WP_004894786.1\|1552539_1553457_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_163171338.1\|1553569_1554622_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_171522373.1\|1554814_1555744_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_163166065.1\|1556012_1557068_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_034434008.1\|1557189_1557663_+	nucleoside deaminase	NA	NA	NA	NA
WP_163171340.1\|1558002_1559094_+	BMP family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163170902.1\|1559560_1560262_+\|transposase	IS1 family transposase	A0A218MNG1	uncultured_virus	5.4e-35	54.4
WP_071320292.1\|1561640_1562738_+	ABC transporter permease	NA	NA	NA	NA
WP_004809345.1\|1562759_1563680_+	ABC transporter permease	NA	NA	NA	NA
WP_163171341.1\|1563712_1565098_+	amidohydrolase family protein	NA	NA	NA	NA
WP_163171342.1\|1565217_1565901_+	metallophosphoesterase	A0A0A0YRJ8	Escherichia_phage	1.3e-38	37.7
WP_004894766.1\|1565980_1566430_-	cyanase	NA	NA	NA	NA
WP_163171343.1\|1566714_1567524_+	formate/nitrite transporter family protein	NA	NA	NA	NA
WP_163170939.1\|1568210_1568681_-\|transposase	transposase	NA	NA	NA	NA
WP_163170940.1\|1568628_1569024_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_163171344.1\|1570405_1571731_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_163171345.1\|1572232_1572931_-	DUF1826 domain-containing protein	NA	NA	NA	NA
WP_163171346.1\|1573190_1574189_+	DUF1852 family protein	NA	NA	NA	NA
WP_163171347.1\|1574231_1575275_+	methionine synthase	NA	NA	NA	NA
WP_163171348.1\|1575372_1575867_+	flavin reductase	NA	NA	NA	NA
WP_163171349.1\|1576291_1576963_+	DUF1345 domain-containing protein	NA	NA	NA	NA
WP_163171350.1\|1577198_1577900_+	VIT1/CCC1 transporter family protein	NA	NA	NA	NA
WP_163171351.1\|1578088_1579765_+	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
WP_103800130.1\|1579766_1580438_+	response regulator transcription factor	Q56AR1	Bacillus_thuringiensis_phage	6.6e-06	26.5
WP_163171352.1\|1580444_1581764_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_163171353.1\|1581789_1582500_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_163171354.1\|1582539_1582926_-	diacylglycerol kinase	NA	NA	NA	NA
WP_163171355.1\|1583168_1583978_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_163171356.1\|1584315_1586646_-	DUF839 domain-containing protein	NA	NA	NA	NA
WP_163171357.1\|1586813_1587590_-	twin-arginine translocase subunit TatC	NA	NA	NA	NA
WP_163171358.1\|1587586_1588003_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_163171359.1\|1588012_1588231_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_163170620.1\|1588502_1588658_-	hypothetical protein	NA	NA	NA	NA
WP_004894712.1\|1588863_1589121_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163171360.1\|1589120_1590347_+	HipA domain-containing protein	NA	NA	NA	NA
WP_163171361.1\|1591193_1591934_+	UTRA domain-containing protein	NA	NA	NA	NA
WP_144723746.1\|1591963_1593709_+	fumarate reductase/succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_096902711.1\|1593756_1594002_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_096902712.1\|1594011_1595457_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_096902716.1\|1595550_1596348_+	ABC transporter permease	NA	NA	NA	NA
WP_144723747.1\|1596347_1597169_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.3e-37	40.1
WP_163171362.1\|1597176_1598169_+	HEAT repeat domain-containing protein	NA	NA	NA	NA
WP_163171363.1\|1598155_1598434_+	DUF971 domain-containing protein	NA	NA	NA	NA
WP_171522374.1\|1599313_1600084_-	OmpA family protein	NA	NA	NA	NA
WP_163171365.1\|1600091_1601051_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_163171366.1\|1601093_1604921_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_163171367.1\|1604969_1606400_-	hypothetical protein	NA	NA	NA	NA
WP_163171368.1\|1606396_1607389_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_163171369.1\|1607352_1609167_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_4

1770236 : 1780921

Indivirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163171445.1\|1770236_1772870_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.3e-38	23.8
WP_004812595.1\|1773072_1773396_+	ferredoxin family protein	NA	NA	NA	NA
WP_004812593.1\|1773535_1774249_+	hypothetical protein	NA	NA	NA	NA
WP_004894345.1\|1774381_1775047_+	O-methyltransferase	S5YRC3	Mycobacterium_phage	2.5e-29	38.7
WP_071321085.1\|1775248_1776091_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.8e-32	32.5
WP_171063875.1\|1776278_1776875_-	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	2.3e-10	52.4
WP_163171446.1\|1776891_1777491_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.1e-23	37.5
WP_004894337.1\|1777598_1778786_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_163171447.1\|1778782_1780921_-	type I secretion system permease/ATPase	F2Y2R6	Organic_Lake_phycodnavirus	8.8e-20	32.0

DBSCAN-SWA_5

1817395 : 1831939

uncultured_Caudovirales_phage(50.0%)

integrase

attL 1816448:1816463|attR 1828574:1828589

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1816448:1816463	attL	NA	NA	NA	NA
WP_163171463.1\|1817395_1818991_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8L8	uncultured_Caudovirales_phage	3.3e-96	46.9
WP_163171464.1\|1819170_1819761_+	hypothetical protein	NA	NA	NA	NA
WP_163171465.1\|1820122_1820782_+	hypothetical protein	NA	NA	NA	NA
WP_163171466.1\|1820800_1821997_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	4.3e-40	32.8
WP_163171467.1\|1822056_1822554_-	hypothetical protein	NA	NA	NA	NA
WP_163171468.1\|1822553_1822850_-	anaerobic dehydrogenase	G8GWD9	Rhodobacter_phage	7.1e-21	54.2
WP_163171469.1\|1822861_1823452_-	glycoside hydrolase	A0A2H4JDB4	uncultured_Caudovirales_phage	2.1e-96	90.2
WP_163171470.1\|1823432_1823735_-	hypothetical protein	A0A2H4JCY6	uncultured_Caudovirales_phage	2.3e-43	89.0
WP_044112749.1\|1823715_1824042_-	hypothetical protein	A0A2H4JCD6	uncultured_Caudovirales_phage	1.7e-52	95.4
WP_004980417.1\|1824203_1824434_-	hypothetical protein	NA	NA	NA	NA
WP_163171471.1\|1824426_1826322_-	hypothetical protein	B7SYF1	Stenotrophomonas_phage	6.4e-30	27.8
WP_163171472.1\|1826331_1826721_-	hypothetical protein	NA	NA	NA	NA
WP_163171473.1\|1826717_1827014_-	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_163171474.1\|1827013_1828276_-	hypothetical protein	NA	NA	NA	NA
WP_163171475.1\|1828327_1831939_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	2.7e-202	35.4
1828574:1828589	attR	NA	NA	NA	NA

DBSCAN-SWA_6

1839464 : 1859292

Acinetobacter_phage(60.0%)

terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163171485.1\|1839464_1840544_-\|capsid	major capsid protein	V5Q8X6	Xylella_phage	1.7e-19	26.2
WP_163171486.1\|1840549_1840924_-	hypothetical protein	NA	NA	NA	NA
WP_163171487.1\|1840927_1841902_-	hypothetical protein	NA	NA	NA	NA
WP_163171488.1\|1841955_1843161_-\|capsid	minor capsid protein	A0A2K9VGX3	Faecalibacterium_phage	3.7e-23	34.4
WP_163171489.1\|1843138_1843375_-	hypothetical protein	NA	NA	NA	NA
WP_163171490.1\|1843374_1844859_-	DUF935 family protein	A0A2H4JHL1	uncultured_Caudovirales_phage	2.1e-105	43.4
WP_163171491.1\|1844868_1846404_-\|terminase	phage terminase large subunit	Q6XQD9	Escherichia_phage	6.0e-87	37.8
WP_163171492.1\|1846404_1846872_-	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	2.5e-28	50.7
WP_163171493.1\|1846917_1847559_-	hypothetical protein	A0A2H4JE07	uncultured_Caudovirales_phage	2.7e-113	89.2
WP_163171494.1\|1847518_1847956_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	2.3e-39	59.6
WP_171406442.1\|1847948_1848122_-	hypothetical protein	NA	NA	NA	NA
WP_163171495.1\|1849290_1849740_-	hypothetical protein	A0A2H4J353	uncultured_Caudovirales_phage	7.4e-70	85.2
WP_163171496.1\|1849736_1850147_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	1.4e-38	61.7
WP_163172702.1\|1850217_1850463_-	hypothetical protein	A0A2H4J6Z3	uncultured_Caudovirales_phage	8.2e-31	83.3
WP_163171497.1\|1850465_1851215_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	1.9e-62	52.2
WP_163171498.1\|1851211_1852135_-	hypothetical protein	A0A068C8G6	Acinetobacter_phage	9.3e-43	50.9
WP_163171499.1\|1852131_1852431_-	hypothetical protein	A0A0P0HSJ2	Acinetobacter_phage	1.9e-13	48.1
WP_171522348.1\|1852427_1852589_-	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	7.0e-07	58.0
WP_048881625.1\|1852637_1853126_-	hypothetical protein	NA	NA	NA	NA
WP_163172704.1\|1853526_1854300_+	helix-turn-helix domain-containing protein	M4T3N8	Psychrobacter_phage	2.2e-21	31.7
WP_163171500.1\|1854309_1854525_+	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	1.7e-19	69.0
WP_005236627.1\|1855065_1855347_+	hypothetical protein	NA	NA	NA	NA
WP_163170621.1\|1855334_1855703_-	hypothetical protein	NA	NA	NA	NA
WP_163171501.1\|1855922_1856345_+	hypothetical protein	A0A0N7IRF7	Acinetobacter_phage	9.8e-32	55.0
WP_163171502.1\|1856347_1857466_+	AAA family ATPase	A0A0P0HSM9	Acinetobacter_phage	4.0e-165	78.2
WP_163171503.1\|1857462_1858647_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.3e-30	30.9
WP_163171504.1\|1858777_1859020_+	hypothetical protein	NA	NA	NA	NA
WP_163171505.1\|1859019_1859292_+	hypothetical protein	A0A0P0J0F2	Acinetobacter_phage	2.2e-24	62.4

DBSCAN-SWA_7

2090805 : 2097614

Acinetobacter_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_171056639.1\|2090805_2091381_+	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	4.1e-105	95.3
WP_163172726.1\|2091387_2092434_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.7e-154	81.4
WP_163171642.1\|2092454_2093261_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	6.1e-123	83.2
WP_163168420.1\|2093611_2094295_+	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	7.3e-85	73.4
WP_171249847.1\|2094388_2094937_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	8.1e-95	96.7
WP_163171644.1\|2095032_2095392_+	DUF861 domain-containing protein	NA	NA	NA	NA
WP_163171646.1\|2095645_2096209_+	DUF4385 family protein	A0A222YVL1	Synechococcus_phage	1.2e-32	48.4
WP_163171648.1\|2096210_2097614_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.9e-16	35.8

DBSCAN-SWA_8

2773199 : 2838178

uncultured_Mediterranean_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004890401.1\|2773199_2774183_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_163172290.1\|2774182_2776252_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_163172292.1\|2776321_2777050_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_004813407.1\|2777715_2778105_+	hypothetical protein	NA	NA	NA	NA
WP_163172294.1\|2778328_2778835_+	hypothetical protein	NA	NA	NA	NA
WP_103800674.1\|2778934_2779453_+	hypothetical protein	NA	NA	NA	NA
WP_163172296.1\|2779491_2780445_-	2-hydroxyacid dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	1.9e-19	28.6
WP_004813413.1\|2780540_2780738_-	hypothetical protein	NA	NA	NA	NA
WP_004890416.1\|2780859_2782131_-	hypothetical protein	NA	NA	NA	NA
WP_163172299.1\|2782244_2783027_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_163167350.1\|2783050_2783614_+	hypothetical protein	NA	NA	NA	NA
WP_004890423.1\|2783631_2784042_-	GFA family protein	NA	NA	NA	NA
WP_163172301.1\|2784124_2785327_-	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_171522383.1\|2785330_2785975_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_004813427.1\|2786058_2786244_+	DNA gyrase inhibitor YacG	NA	NA	NA	NA
WP_005220781.1\|2786389_2786569_+	hypothetical protein	NA	NA	NA	NA
WP_163172305.1\|2787084_2787729_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	8.2e-22	30.4
WP_004813436.1\|2787750_2788758_-	ferrochelatase	NA	NA	NA	NA
WP_004813438.1\|2788825_2789854_-	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_008303930.1\|2789982_2790846_-	glutamate racemase	NA	NA	NA	NA
WP_163167356.1\|2790894_2791506_-	DUF1285 domain-containing protein	NA	NA	NA	NA
WP_163172307.1\|2791691_2793404_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_163171222.1\|2794098_2794569_-\|transposase	transposase	NA	NA	NA	NA
WP_163171221.1\|2794516_2794912_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_163172309.1\|2795045_2796755_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_163172311.1\|2796767_2797214_-	hypothetical protein	NA	NA	NA	NA
WP_075167225.1\|2797511_2797940_-	hypothetical protein	NA	NA	NA	NA
WP_163172313.1\|2798041_2798956_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_163172315.1\|2798956_2801596_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.7e-281	53.3
WP_004813458.1\|2801845_2802103_-	sulfurtransferase TusA	NA	NA	NA	NA
WP_017401517.1\|2802334_2803144_+	CBS domain-containing protein	NA	NA	NA	NA
WP_163172318.1\|2803140_2804703_+	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_163172320.1\|2804905_2805241_-	hypothetical protein	NA	NA	NA	NA
WP_034424813.1\|2805525_2805954_-	type II secretion system major pseudopilin GspG	NA	NA	NA	NA
WP_163172322.1\|2806081_2807287_-	type II secretion system inner membrane protein GspF	NA	NA	NA	NA
WP_163172325.1\|2807422_2809660_+	primosomal protein N'	NA	NA	NA	NA
WP_163172327.1\|2809701_2811555_+	cation:proton antiporter	NA	NA	NA	NA
WP_004813475.1\|2811605_2812481_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_163172329.1\|2812941_2813406_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_004813478.1\|2813600_2814062_+	DUF2147 domain-containing protein	NA	NA	NA	NA
WP_008303908.1\|2814568_2814898_+	hypothetical protein	NA	NA	NA	NA
WP_008303905.1\|2814980_2815244_+	YdcH family protein	NA	NA	NA	NA
WP_171063225.1\|2815689_2817777_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_004637724.1\|2818038_2818308_-	30S ribosomal protein S15	NA	NA	NA	NA
WP_163171222.1\|2818763_2819234_-\|transposase	transposase	NA	NA	NA	NA
WP_163171221.1\|2819181_2819577_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_163172330.1\|2820140_2821913_-	exodeoxyribonuclease V subunit alpha	A0A0K2FLP8	Brevibacillus_phage	5.1e-21	24.9
WP_163172331.1\|2821984_2826103_-	UvrD-helicase domain-containing protein	Q331U3	Clostridium_botulinum_C_phage	4.1e-05	24.8
WP_163172332.1\|2826103_2829811_-	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_004890494.1\|2829987_2830491_+	hypothetical protein	NA	NA	NA	NA
WP_008303884.1\|2830533_2831952_-	polyphosphate--AMP phosphotransferase	NA	NA	NA	NA
WP_048881195.1\|2832159_2832864_+	hypothetical protein	NA	NA	NA	NA
WP_004813497.1\|2833207_2833531_+	hypothetical protein	NA	NA	NA	NA
WP_004890506.1\|2834014_2834959_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_163172333.1\|2834970_2835648_+	hypothetical protein	NA	NA	NA	NA
WP_163172334.1\|2835660_2837280_+	2-octaprenylphenol hydroxylase	C7U092	Ostreococcus_tauri_virus	1.2e-29	27.9
WP_004646477.1\|2837364_2837835_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_004646478.1\|2837782_2838178_-\|transposase	transposase family protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044464

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3201 : 59472

Escherichia_phage(30.0%)

integrase,transposase

attL 41794:41853|attR 58815:59338

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163143549.1\|3201_3585_+\|transposase	transposase	NA	NA	NA	NA
WP_163167833.1\|3527_3917_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_127801007.1\|5988_7650_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.6e-170	54.9
WP_127801006.1\|8160_8400_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_154320129.1\|10147_10531_+\|transposase	transposase	NA	NA	NA	NA
WP_163172794.1\|10527_10863_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_163172796.1\|10937_12542_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.1e-143	54.5
WP_000934717.1\|12750_14016_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
WP_000366814.1\|14015_14321_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_004726728.1\|15241_15499_-	hypothetical protein	NA	NA	NA	NA
WP_154320129.1\|15805_16189_+\|transposase	transposase	NA	NA	NA	NA
WP_163172794.1\|16185_16521_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_163172796.1\|16595_18200_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.1e-143	54.5
WP_004658347.1\|18368_18965_-	putative adenosine monophosphate-protein transferase Fic	NA	NA	NA	NA
WP_002125865.1\|18977_19145_-	DUF2559 family protein	NA	NA	NA	NA
WP_127800793.1\|19461_19911_+	hypothetical protein	NA	NA	NA	NA
WP_127800787.1\|19897_22237_+	hypothetical protein	NA	NA	NA	NA
WP_151208140.1\|22241_25442_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_150378268.1\|25769_26000_-	hypothetical protein	NA	NA	NA	NA
WP_000602738.1\|27591_28344_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	2.4e-41	44.7
WP_000742814.1\|28765_29791_-	aminoglycoside O-phosphotransferase APH(4)-Ia	NA	NA	NA	NA
WP_001199192.1\|30019_30796_-	aminoglycoside N-acetyltransferase AAC(3)-IVa	NA	NA	NA	NA
WP_001067856.1\|30909_31614_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	6.9e-139	100.0
WP_005245164.1\|32639_33839_+\|integrase	tyrosine-type recombinase/integrase	E5AGD0	Erwinia_phage	2.6e-37	29.3
WP_005245162.1\|34373_35105_+	transglutaminase family protein	NA	NA	NA	NA
WP_127800877.1\|35091_35979_+	cation transporter	NA	NA	NA	NA
WP_004658363.1\|36683_36935_-	hypothetical protein	NA	NA	NA	NA
WP_004658364.1\|37129_37351_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_038350081.1\|38945_39734_+	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_077170035.1\|39860_40319_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_127800590.1\|40553_41719_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.1e-139	84.9
41794:41853	attL	NA	NA	NA	NA
WP_001120888.1\|41911_43405_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_082987283.1\|43435_43681_+	hypothetical protein	NA	NA	NA	NA
WP_044502095.1\|43975_44353_+	hypothetical protein	NA	NA	NA	NA
WP_064754130.1\|44349_45513_+	tetracycline-inactivating monooxygenase Tet(X)	NA	NA	NA	NA
WP_077782102.1\|45530_46391_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_001067855.1\|47449_48154_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_152342664.1\|48292_48820_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.1e-27	39.8
WP_024160783.1\|49009_50176_+	tetracycline-inactivating monooxygenase Tet(X)	NA	NA	NA	NA
WP_001366550.1\|50324_51062_+	recombinase family protein	NA	NA	NA	NA
WP_000743213.1\|51058_51283_+	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|51493_52987_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_163172798.1\|53168_53324_-	hypothetical protein	NA	NA	NA	NA
WP_084929516.1\|53327_54200_-	hypothetical protein	NA	NA	NA	NA
WP_156734113.1\|54648_56142_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001447541.1\|56172_57057_+	DUF3363 domain-containing protein	NA	NA	NA	NA
WP_000214122.1\|57273_58488_+	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	1.2e-18	28.7
WP_001255015.1\|58515_58821_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001120891.1\|58932_59472_+\|transposase	IS91 family transposase	NA	NA	NA	NA
58815:59338	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP044469

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044469_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044469_1

4917-5016

Orphan

Consensus_repeat	Method
ATGTCCGGTAAAAGTAGTTTTTTAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044469_1

>merge|NZ_CP044469|1|4917-5016|CRISPRCasFinder
ATGTCCGGTAAAAGTAGTTTCTATGTCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTAATGTCCGGTAAAAGTAGTTTTTTAA

>NZ_CP044469|1|1|4917-5016|CRISPRCasFinder
ATGTCCGGTAAAAGTAGTTTCTATG	TCCGGTAAAAGTAGTTTTTTAAGTCCATTTTGTCCGGCATTTGTAGTTTA
ATGTCCGGTAAAAGTAGTTTTTTAA

Protein	Function_ID	Function_description	E-value
NZ_CP044469.1\|WP_004870770.1\|5497_7150_-\|MobA/MobL-family-protein	gnl\|CDD\|367473	pfam03389, MobA_MobL, MobA/MobL family. This family includes of the MobA protein from the E. coli plasmid RSF1010, and the MobL protein from the Thiobacillus ferrooxidans plasmid PTF1. These sequences are mobilisation proteins, which are essential for specific plasmid transfer.	2.5527e-73
NZ_CP044469.1\|WP_020846814.1\|3844_4786_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.65033e-31
NZ_CP044469.1\|WP_000155092.1\|547_1432_-\|Mph(E)-family-macrolide-2'-phosphotransferase	gnl\|CDD\|270701	cd05152, MPH2', Macrolide 2'-Phosphotransferase. MPH2' catalyzes the transfer of the gamma-phosphoryl group from ATP to the 2'-hydroxyl of macrolide antibiotics such as erythromycin, clarithromycin, and azithromycin, among others. Macrolides penetrate the bacterial cell and bind to ribosomes, where it interrupts protein elongation, leading ultimately to the demise of the bacterium. Phosphorylation of macrolides leads to their inactivation. Based on substrate specificity and amino acid sequence, MPH2' is divided into types I and II, encoded by mphA and mphB genes, respectively. MPH2'I inactivates 14-membered ring macrolides while MPH2'II inactivates both 14- and 16-membered ring macrolides. Enzymatic inactivation of macrolides has been reported as a mechanism for bacterial resistance in clinical samples. MPH2' is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	6.72435e-130
NZ_CP044469.1\|WP_000052512.1\|1487_2963_-\|ABC-F-type-ribosomal-protection-protein-Msr(E)	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.75095e-109

>NZ_CP044469.1|WP_020846814.1|3844_4786_-|replication-initiation-protein
MDENKKTYPLSWVVMQNNVQECFKSMNIDEKRMLILASPIARTTDATEKDRIMITAEEFARECGIKTHSAYTQLELASKNLLKRNFSYNNERGKKVLSNWVIDCTYEDGGIAIRFPEIVLLMLKEFDKLNPYTKYKKDIVLSLKKDYSFDLYHLAKKHQAMGQFEMSLEHIKNELGLPKSYDKLCNLKDRVMKPSLNEITTNTDIELTYENVKKGRSVVGFKFIVKEKPKPKLIAPQRDQRTIDMFCNLSDAQINKYSTILSKLSELSDLSNFPDYPTFALWISGILRDPKSVREETTKRIFKALHSKTDFKP
>NZ_CP044469.1|WP_004870774.1|3560_3848_-|hypothetical-protein
MRTKAELDAMSHQELKDYEQSLLALWTPRMAIESDIERLSTHHSELLEVFNQLKNPDAPKNSRLKDSILSLKYKIESLEGKLSDLIQDNRLNSAD
>NZ_CP044469.1|WP_000052512.1|1487_2963_-|ABC-F-type-ribosomal-protection-protein-Msr(E)
MSLIIKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKSSLLKVLNGEIVLAEATLQRFGDFAHISQLGGIEIETVEDRAMLSRLGVSNVQNDTMSGGEETRAKIAAAFSQQVHGILADEPTSHLDLNGIDLLIGQLKAFDGALLVISHDRYFLDMVVDKIWELKDGKITEYWGGYSDYLRQKEEERQHQAVEYELMMKERERLESAVQEKRQQANRLDNKKKGEKSKNSTESAGRLGHAKMTGTKQRKLYQAAKSMEKRLAALEDIQAPEHLRSIRFRQSSALELHNKFPITADGLSLKFGSRTIFDDANFIIPLGAKVAITGSNGTGKTSLLKMISERADGLTISPKAEIGYFTQTGYKFNTHKSVLSFMQEECEYTVAEIRAVLASMGIGANDIQKNLSDLSGGEIIKLLLSKMLLGKYNILLMDEPGNYLDLKSIAALETMMKSYAGTIIFVSHDKQLVDNIADIIYEIKDHKIIKTFERDC
>NZ_CP044469.1|WP_000155092.1|547_1432_-|Mph(E)-family-macrolide-2'-phosphotransferase
MTIQDIQSLAEAHGLLLTDKMNFNEMGIDFKVVFALDTKGQQWLLRIPRRDGMREQIKKEKRILELVKKHLSVEVPDWRISSTELVAYPILKDNPVLNLDAETYEIIWNMDKDSPKYITSLAKTLFEIHSIPEKEVRENDLKIMKPSDLRPEIANNLQLVKSEIGISEQLETRYRKWLDNDVLWADFTQFIHGDLYAGHVLASKDGAVSGVIDWSTAHIDDPAIDFAGHVTLFGEESLKTLIIEYEKLGGKVWNKLYEQTLERAAASPLMYGLFALETQNESLIVGAKAQLGVI
>NZ_CP044469.1|WP_163169824.1|15_318_+|hypothetical-protein
MSVDNLEQKIAKQEERLRQLKEQKKAAIAREKKKVSDQQRKDDTRRKILLGAWALNKLKNDESFKQQLADFEQFLNTENKTEENKQKDKDLFNGFIWDKT
>NZ_CP044469.1|WP_004870770.1|5497_7150_-|MobA/MobL-family-protein
MAIYHFSVKTISRGNGRSAVACAAYRSSEKLVCDFYGKEQDYTRKTGVEFTKIYAPENTNTELLKRQTLWNEVEKVERRKDALLAREFEIAFPSELNAEQRENMLNELCRNLVKKYGVIVDAAIHAPHTDSGSDERNYHAHIMFTTRSINEQGGFSAKKYRDFSRDNGTETVSHWRESFAELCNHHLEQNGFDERVDHRSYEDQESDLEATQHEGPQATYLRRRGIFTEISLKNDEIKLRNLKIKKVIALDENIKVSEDLVQKVRSELQFQYSQAEYSEKTSQKLYEFQNEELSKLTTKLDTMSSAISELRKKEPLFFKTKWINQINDLIDQHNTQLDIQKHISGLSEIEKKERYSDHLNKWTEENQLLQPKKSFAKFDEPNITVKQRKLNDQISNIDHQISEISRRETEYQEYVRDQRLEIINSYIFEEDNYGNKYFSPQNGEKQKRLYAEEMEDLKIQELHAAFTKKIETEAQQEFSQKRAIQLENDRKDRESREQQLRKEREQQEQRYAQEREQQEHLAFVRRQEQEKQQRNEPKKPENDNNHDYTP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP044477	Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence	1455-1504	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP044487	Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence	60-109	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP032272	Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence	9937-9986	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP031712	Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence	9573-9622	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP032282	Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence	2168-2217	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	3115-3164	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	10800-10849	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	18495-18544	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP043310	Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence	26190-26239	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP032104	Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence	6071-6120	1.0
NZ_CP044469_1	1.1\|4942\|50\|NZ_CP044469\|CRISPRCasFinder	4942-4991	50	NZ_CP044469	Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence	4942-4991	1.0

1. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP044477 (Acinetobacter schindleri strain HZE33-1 plasmid pHZE33-1-3, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

2. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP044487 (Acinetobacter schindleri strain HZE30-1 plasmid pHZE30-1-4, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

3. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP032272 (Acinetobacter sp. WCHAc010034 plasmid p4_010034, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

4. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP031712 (Acinetobacter wuhouensis strain WCHA60 plasmid p4_010060, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

5. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP032282 (Acinetobacter sp. WCHA55 plasmid p3_010055, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

6. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

7. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

8. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

9. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP043310 (Acinetobacter johnsonii strain Acsw19 plasmid pAcsw19-3, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

10. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP032104 (Acinetobacter lwoffii strain EK30A plasmid pALWEK1.11, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

11. spacer 1.1|4942|50|NZ_CP044469|CRISPRCasFinder matches to NZ_CP044469 (Acinetobacter schindleri strain HZE23-1 plasmid pHZE23-1-6, complete sequence) position: , mismatch: 0, identity: 1.0

tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	CRISPR spacer
tccggtaaaagtagttttttaagtccattttgtccggcatttgtagttta	Protospacer
**************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044463

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044464

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP044469

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection