CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP048879	Oceanospirillales bacterium S2-4-1H plasmid pA, complete sequence	0 crisprs	NA	0	0	6
NZ_CP048878	Oceanospirillales bacterium S2-4-1H chromosome, complete genome	2 crisprs	Cas9_archaeal,RT,cas3,csa3,PD-DExK,DEDDh,DinG,WYL,TnsE_C	3	3	23
NZ_CP048881	Oceanospirillales bacterium S2-4-1H plasmid pC, complete sequence	0 crisprs	NA	0	0	1
NZ_CP048880	Oceanospirillales bacterium S2-4-1H plasmid pB, complete sequence	1 crisprs	NA	0	2	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 24597

Macacine_betaherpesvirus(20.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836642.1\|493_1591_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_163836643.1\|1591_2926_-	AAA family ATPase	A0A2I6B2X3	Macacine_betaherpesvirus	4.4e-62	36.1
WP_163836644.1\|3169_4249_-	replication initiation protein	NA	NA	NA	NA
WP_163836645.1\|4814_5531_-	hypothetical protein	NA	NA	NA	NA
WP_163836646.1\|5527_6628_-	hypothetical protein	W0LNS9	Mycobacterium_phage	1.6e-12	29.9
WP_163836647.1\|6969_7362_+	hypothetical protein	NA	NA	NA	NA
WP_163836648.1\|7543_8038_+	hypothetical protein	NA	NA	NA	NA
WP_163836649.1\|8118_8493_-	DUF2750 domain-containing protein	NA	NA	NA	NA
WP_163836650.1\|9427_10417_+	queuosine precursor transporter	A0A1W7AG82	Streptococcus_virus	3.0e-23	32.3
WP_163836651.1\|10419_10821_+	hypothetical protein	NA	NA	NA	NA
WP_163836652.1\|10859_11597_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163836653.1\|11843_12572_+	response regulator transcription factor	NA	NA	NA	NA
WP_163836654.1\|12580_12973_+	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_163836655.1\|13000_14290_+	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	7.1e-41	29.9
WP_163836656.1\|14504_14849_+	hypothetical protein	NA	NA	NA	NA
WP_163836657.1\|14883_16647_+	hypothetical protein	NA	NA	NA	NA
WP_163836658.1\|16695_24597_+	hypothetical protein	A0A2H4JFP5	uncultured_Caudovirales_phage	3.9e-12	35.4

DBSCAN-SWA_2

30957 : 47733

Acinetobacter_phage(12.5%)

protease,transposase,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836793.1\|30957_31287_+	hypothetical protein	A0A0P0IKL1	Acinetobacter_phage	5.7e-11	37.5
WP_163836667.1\|31271_31754_+	single-stranded DNA-binding protein	A0A0U4K5C0	Pseudomonas_phage	1.2e-36	60.0
WP_163836668.1\|32378_32555_-	hypothetical protein	NA	NA	NA	NA
WP_163836669.1\|32638_32911_-	hypothetical protein	NA	NA	NA	NA
WP_163836794.1\|33384_33834_+	transglycosylase SLT domain-containing protein	M4R0Y9	Tetraselmis_viridis_virus	8.3e-29	48.6
WP_163836670.1\|33833_34172_+	hypothetical protein	NA	NA	NA	NA
WP_163836671.1\|34140_34371_+	hypothetical protein	NA	NA	NA	NA
WP_163836672.1\|34363_34813_+	hypothetical protein	NA	NA	NA	NA
WP_163836673.1\|34809_35907_+	hypothetical protein	NA	NA	NA	NA
WP_163836674.1\|35899_37399_+\|terminase	terminase	Q5QBP2	Enterobacteria_phage	2.4e-117	44.6
WP_163836675.1\|37404_37683_-	hypothetical protein	NA	NA	NA	NA
WP_163836676.1\|37916_38531_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.0e-37	46.2
WP_163836677.1\|38647_39223_+	hypothetical protein	NA	NA	NA	NA
WP_163836678.1\|39309_39732_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_163836679.1\|39722_40001_-	hypothetical protein	NA	NA	NA	NA
WP_163836795.1\|40247_40409_-	DUF2559 family protein	NA	NA	NA	NA
WP_163836680.1\|40531_40825_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_163836796.1\|40841_43022_-	ATP-dependent RecD-like DNA helicase	A0A0H3UZA5	Geobacillus_virus	4.7e-61	28.7
WP_163836681.1\|43186_43513_-	hypothetical protein	NA	NA	NA	NA
WP_163836682.1\|43672_44008_+	DNA-binding protein	NA	NA	NA	NA
WP_163836683.1\|44121_45204_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_163836684.1\|45285_45741_-	hypothetical protein	NA	NA	NA	NA
WP_163836685.1\|45762_46341_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-22	40.8
WP_163836686.1\|46337_46805_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163836687.1\|47106_47733_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.0e-29	37.6

DBSCAN-SWA_3

52502 : 53486

Listeria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836696.1\|52502_53486_+	gas vesicle protein GvpN	S4U6G7	Listeria_phage	3.3e-06	25.3

DBSCAN-SWA_4

77847 : 84601

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836726.1\|77847_79971_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	6.3e-26	24.5
WP_163836727.1\|80147_80441_-	hypothetical protein	NA	NA	NA	NA
WP_163836728.1\|80462_80828_-	hypothetical protein	NA	NA	NA	NA
WP_163836729.1\|81039_81240_-	hypothetical protein	NA	NA	NA	NA
WP_163836730.1\|81340_82477_-	hypothetical protein	NA	NA	NA	NA
WP_163836731.1\|82586_83291_-	hypothetical protein	A0A1P8CX02	Bacillus_phage	8.7e-09	31.7
WP_163836732.1\|83338_84601_-	Y-family DNA polymerase	A0A1W6JNT0	Morganella_phage	1.8e-113	50.0

DBSCAN-SWA_5

89535 : 91906

Lactococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836741.1\|89535_89745_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	2.2e-16	59.7
WP_163836742.1\|90030_90708_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.3e-46	45.0
WP_163836743.1\|90835_91201_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_163836744.1\|91270_91906_-	methyltransferase domain-containing protein	A0A2P1JQT7	Mycobacterium_phage	4.6e-17	33.3

DBSCAN-SWA_6

95161 : 140450

Escherichia_phage(61.9%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836746.1\|95161_96580_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	1.9e-63	35.4
WP_163836747.1\|96581_97691_-	hypothetical protein	NA	NA	NA	NA
WP_163836748.1\|98682_98943_+	WGR domain-containing protein	NA	NA	NA	NA
WP_163836749.1\|99050_99482_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.1e-27	46.4
WP_163836750.1\|99544_100246_+	hypothetical protein	NA	NA	NA	NA
WP_163836751.1\|100301_100502_-	hypothetical protein	NA	NA	NA	NA
WP_163836752.1\|100863_101463_+	hypothetical protein	NA	NA	NA	NA
WP_163836753.1\|101464_101773_+	hypothetical protein	NA	NA	NA	NA
WP_163836754.1\|101769_102840_+	hypothetical protein	A0A222YXT1	Escherichia_phage	3.0e-37	33.1
WP_163836755.1\|102836_103340_+	hypothetical protein	NA	NA	NA	NA
WP_163836756.1\|103332_104865_+\|tail	tail fiber domain-containing protein	A0A0F6R513	Sinorhizobium_phage	5.0e-17	31.6
WP_163836757.1\|104854_105721_+	hypothetical protein	A0A142EZX0	Stenotrophomonas_phage	6.5e-06	35.5
WP_163836758.1\|105711_106431_+	hypothetical protein	NA	NA	NA	NA
WP_163836759.1\|106408_107428_+	hypothetical protein	A0A222YXZ0	Escherichia_phage	1.3e-26	23.8
WP_163836760.1\|107417_108155_+	hypothetical protein	A0A222YWF1	Escherichia_phage	2.4e-17	34.8
WP_163836761.1\|108154_108445_+	PaaR repeat-containing protein	Q71TL3	Escherichia_phage	1.0e-08	41.3
WP_163836762.1\|108643_109333_+	hypothetical protein	NA	NA	NA	NA
WP_163836798.1\|109488_109632_+	hypothetical protein	G3MBI0	Bacillus_virus	2.6e-05	45.7
WP_163836763.1\|109695_110292_+	hypothetical protein	NA	NA	NA	NA
WP_163836764.1\|110528_112088_+	DUF2460 domain-containing protein	Q1MVJ5	Enterobacteria_phage	2.7e-66	31.5
WP_163836765.1\|112166_112424_+	hypothetical protein	NA	NA	NA	NA
WP_163836766.1\|112420_114241_+	hypothetical protein	A0A222YWC8	Escherichia_phage	9.4e-55	28.9
WP_163836767.1\|114258_114897_+	hypothetical protein	NA	NA	NA	NA
WP_163836768.1\|114902_115505_+	hypothetical protein	A0A222YY02	Escherichia_phage	1.3e-29	37.8
WP_163836769.1\|115533_116022_+	hypothetical protein	A0A222YWE4	Escherichia_phage	1.4e-21	36.0
WP_163836770.1\|116018_116579_+	hypothetical protein	NA	NA	NA	NA
WP_163836771.1\|116578_117076_+	hypothetical protein	A0A222YY05	Escherichia_phage	5.8e-15	29.2
WP_163836772.1\|117082_117862_+	hypothetical protein	A0A1B0VBL3	Salmonella_phage	7.9e-19	28.4
WP_163836773.1\|117960_120009_+	hypothetical protein	NA	NA	NA	NA
WP_163836774.1\|120011_120359_+	hypothetical protein	NA	NA	NA	NA
WP_163836775.1\|120358_121756_+	lipopolysaccharide biosynthesis protein BplA	Q71TP2	Escherichia_phage	1.1e-55	31.7
WP_163836776.1\|121766_122552_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163836777.1\|122589_123132_-	hypothetical protein	NA	NA	NA	NA
WP_163836778.1\|123316_123982_+	hypothetical protein	NA	NA	NA	NA
WP_163836779.1\|124075_124465_-	hypothetical protein	NA	NA	NA	NA
WP_163836780.1\|124707_125520_+	hypothetical protein	A0A222YWB7	Escherichia_phage	1.4e-23	32.7
WP_163836799.1\|125519_125948_+	hypothetical protein	NA	NA	NA	NA
WP_163836781.1\|125966_126590_+	coiled-coil domain-containing protein 22	NA	NA	NA	NA
WP_163836782.1\|126593_127706_+	hypothetical protein	A0A077SLK4	Escherichia_phage	7.1e-13	35.3
WP_163836783.1\|127722_128046_+	hypothetical protein	NA	NA	NA	NA
WP_163836784.1\|128048_129800_+	hypothetical protein	G9BW42	Planktothrix_phage	1.8e-07	36.5
WP_163836785.1\|129832_130528_+	hypothetical protein	NA	NA	NA	NA
WP_163836786.1\|130739_131456_+	hypothetical protein	NA	NA	NA	NA
WP_163836787.1\|131493_131952_-	hypothetical protein	NA	NA	NA	NA
WP_163836788.1\|132104_138236_+	DEAD/DEAH box helicase family protein	A0A077SK04	Escherichia_phage	1.6e-255	33.8
WP_163836789.1\|138238_138667_+	hypothetical protein	NA	NA	NA	NA
WP_163836790.1\|138845_140450_+	hypothetical protein	A0A077SL38	Escherichia_phage	1.8e-73	36.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP048880

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048880_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048880_1

77654-77766

Orphan

Consensus_repeat	Method
TAGTTTTGCATGCAAAACTGA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP048880_1

>merge|NZ_CP048880|1|77654-77766|PILER-CR
TGGTTTTGCATGCAAAACTGACTGTCTAATATTAAAAAACACACGTCGAGTTTTGCATGCAAAACTAATAGCAAATACACTTAGTGTGACACTAGTTTTGCATGCAAAACTGA

>NZ_CP048880|1|1|77654-77766|PILER-CR
TGGTTTTGCATGCAAAACTGA	CTGTCTAATATTAAAAAACACACGTC
GAGTTTTGCATGCAAAACTAA	TAGCAAATACACTTAGTGTGACAC
TAGTTTTGCATGCAAAACTGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048880.1\|WP_163836877.1\|70345_71314_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836874.1\|66224_66533_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836879.1\|72956_73757_+\|DUF2163-domain-containing-protein	unknown	unknown	gnl\|CDD\|274038
NZ_CP048880.1\|WP_163836876.1\|69434_70346_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836892.1\|83400_84264_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|269828
NZ_CP048880.1\|WP_163836885.1\|78483_79392_+\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP048880.1\|WP_163836883.1\|77005_77458_+\|DUF2793-domain-containing-protein	unknown	unknown	gnl\|CDD\|371324
NZ_CP048880.1\|WP_163836878.1\|71310_72960_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836884.1\|77807_78473_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|222854
NZ_CP048880.1\|WP_163836882.1\|74156_77006_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379255
NZ_CP048880.1\|WP_163836888.1\|81745_82138_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836887.1\|81247_81706_+\|lysozyme	unknown	unknown	gnl\|CDD\|381597
NZ_CP048880.1\|WP_163836880.1\|73756_73987_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836889.1\|82159_82432_-\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259853
NZ_CP048880.1\|WP_163836893.1\|84387_84615_+\|EexN-family-lipoprotein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836891.1\|82885_83233_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377085
NZ_CP048880.1\|WP_163836886.1\|79448_80510_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP048880.1\|WP_163836875.1\|66498_69435_+\|tape-measure-protein	unknown	unknown	gnl\|CDD\|131723
NZ_CP048880.1\|WP_163836881.1\|73983_74181_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048880.1\|WP_163836890.1\|82657_82873_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP048880.1\|WP_163836882.1\|74156_77006_+\|hypothetical-protein	gnl\|CDD\|379255	pfam13550, Phage-tail_3, Putative phage tail protein. This putative domain is found in the large gene transfer agent protein. These produce defective phage like particles. This domain is similar to other phage-tail protein families.	6.63347e-06
NZ_CP048880.1\|WP_163836885.1\|78483_79392_+\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	7.38237e-29
NZ_CP048880.1\|WP_163836887.1\|81247_81706_+\|lysozyme	gnl\|CDD\|381597	cd00735, T4-like_lys, bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.	2.4202e-48
NZ_CP048880.1\|WP_163836879.1\|72956_73757_+\|DUF2163-domain-containing-protein	gnl\|CDD\|274038	TIGR02218, conserved_hypothetical_protein, phage conserved hypothetical protein BR0599. This model describes a family of proteins found almost exclusively in phage or in prophage regions of bacterial genomes, including the phage-like Rhodobacter capsulatus gene transfer agent, which packages DNA. An apparent exception is Wolbachia pipientis wMel, a bacterial endosymbiont of the fruit fly, which has several candidate phage-related genes physically separate from obvious prophage regions. [Mobile and extrachromosomal element functions, Prophage functions].	1.6678e-20
NZ_CP048880.1\|WP_163836889.1\|82159_82432_-\|HU-family-DNA-binding-protein	gnl\|CDD\|259853	cd13831, HU, histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.	6.07202e-43
NZ_CP048880.1\|WP_163836891.1\|82885_83233_+\|hypothetical-protein	gnl\|CDD\|377085	pfam03631, Virul_fac_BrkB, Virulence factor BrkB. This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.	0.00594432
NZ_CP048880.1\|WP_163836886.1\|79448_80510_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	3.07043e-47
NZ_CP048880.1\|WP_163836875.1\|66498_69435_+\|tape-measure-protein	gnl\|CDD\|131723	TIGR02675, Mu-like_prophage_FluMu_protein_gp42, tape measure domain. Proteins containing this domain are strictly bacterial, including bacteriophage and prophage regions of bacterial genomes. Most members are 800 to 1800 amino acids long, making them among the longest predicted proteins of their respective phage genomes, where they are encoded in tail protein regions. This roughly 80-residue domain described here usually begins between residue 100 and 250. Many members are known or predicted to act as phage tail tape measure proteins, a minor tail component that regulates tail length.	1.30165e-19
NZ_CP048880.1\|WP_163836883.1\|77005_77458_+\|DUF2793-domain-containing-protein	gnl\|CDD\|371324	pfam10983, DUF2793, Protein of unknown function (DUF2793). This is a bacterial family of proteins with unknown function.	3.16636e-20
NZ_CP048880.1\|WP_163836892.1\|83400_84264_+\|hypothetical-protein	gnl\|CDD\|269828	cd14743, PAAR_CT_1, proline-alanine-alanine-arginine (PAAR) domain with C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Some members contains C-terminal domain extensions corresponding to Rearrangement hotspot (Rhs) protein repeats and conserved Rhs repeat-associated unique core sequences as well as uncharacterized domains. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. Rhs and related YD-peptide repeat proteins are widely distributed in bacteria. Rhs shares similar architecture with distantly related WapA proteins of Bacillus and Listeria species, suggesting intercellular growth inhibition as its primary function. Additionally, a plasmid-encoded Rhs protein has been implicated in bacteriocin production in Pseudomonas savastanoi. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	5.92271e-28
NZ_CP048880.1\|WP_163836884.1\|77807_78473_+\|AAA-family-ATPase	gnl\|CDD\|222854	PHA02518, PHA02518, ParA-like protein; Provisional.	1.45322e-37

>NZ_CP048880.1|WP_163836883.1|77005_77458_+|DUF2793-domain-containing-protein
MAKKEPNTGLNYGWKLGESGWNLQMDENLKAIGALLVISVLSATTTEPPASPTPGDRYLVPTGATGVWAESINKLVRWDGSAWEVYTPGNGWEVTAQDTMQRWHYNGENWDLYSSRLARYENDEAAAEGGTPIGGTYVNSKTGVVHMRIA
>NZ_CP048880.1|WP_163836882.1|74156_77006_+|hypothetical-protein
MGGKKKAVTVGYKYYIGMHMLLCHGPVDKITQINVDGKRAWSGGHGGGRLHISASNLFGGEKREGGVSGSVDILMGHPNQPKNDYLKARLGSKIPAFRGVVSAILRQVYIGMNPYLKRWAFRVQRIHVRDDGRPQWYNDKAEIGSGDMNPAHIIRECLTSLDWGMGYTDEDIDDNSFIHAANQLHAEGFGLSLLWDKETTIDKFIELILKHIDGALFVDRKTGRFTLKLIRDDYDKSSLIKLGPHNVGKINDFTRPTVGELTNSVTVQYWDRSTGKNATVSAQDIALAQQQGCVISTTQKYPGITNGGLASRVASRDLRGYANPLIGCVLIANREAASLNVGDVFLFEWPQYGVSETVMRVTNISLGTLTDNKVKIECVQDVFALSEAIYASPTPTGWALPLSEPAPCPYRLLVEAPYYEVVQRVGMDEAAKLAKEDGFLIVAGTKPAEDALNADLHVNSGGGYELVESLEFTPTALLMADAGYMDTSLSIGQTVDIDIVEIGSHIQINDELMQVTAISDTEIKVNRGVADTIPHKHPSGSRVFAWDYYGETDGVNYQTGEIVHAKITPATGRGILDLGVAPQDSVRFNSRASRPYPPGNFKINNQYYPKLVTGALVLSWAHRDRVQQADHLKGFTFGDVGPESGTTYKLKIWDENNNLVVNESELTGNTYNYTDEKKHLGQKVTNPTNIFEYAIEGEHTPSDGYLLINVGVRRRERDPHLNILNTDDPDWDTNYGQTKDIGVFHYVYDPATATSIIEQPEIIPVFDLSWELYIFCWNRSSGNDVAEIDLELQNKTGQTIAAIRVKKEGSYKNGLWYGSSLNDLTKAKQEGSYPGTKGVFSFEADRLIFQHNLDDPNRNLAFEFQCDMSSVAQIKASNMKTVTGYDYAGTYIKIIGGGTGSFMRQRRLNHKLRISLSSQRDELQSNQSYDVTVDRDGYGYQYGKYYGGH
>NZ_CP048880.1|WP_163836881.1|73983_74181_+|hypothetical-protein
MIIRINHIRSALFCSKGARQFFERHGLDWGDFLKHGIESEKLLATGDAMAKQVVDLAEWAEKRKP
>NZ_CP048880.1|WP_163836880.1|73756_73987_+|hypothetical-protein
MWPAVVAWIGALVLVAVSMRPKQQDQTPVAKDVKIPTNEEGTEIPVVFGTRDIESPMNAWYGHLRTVPIRKKGGKK
>NZ_CP048880.1|WP_163836879.1|72956_73757_+|DUF2163-domain-containing-protein
MSYDLIETSADSGQPVELYEFGQGVQRWYFTSSEHEIFYQSKTYIPAPIKRSSVNVTDDIFKAALKLTFPRDNELARQFLGFSPELPTTVTIFRGHWEDDDYIVYWKGRVSGAKGAGSTITLECESVFTSIQRPGLRAKYQRMCRHVLYDHKCQVNQKQFEVKAVVQNINGTHLTLTETSRYQAGWFTGGMVKTEDDAVRFVSSHNGSDLIITRPFHDLKPNTTVKLYPGCNHLSDTCLNKFNNLDNYGGFPHIPTRNPFDGSSII
>NZ_CP048880.1|WP_163836878.1|71310_72960_+|hypothetical-protein
MIKRIVDGAIFTEVAPWDHVNELDNRTYAVLPYGCLLSASPKTGNIQNTQPVDELKQRYTGFQMRGFQYDFYYRIHVKPAHISLGNLLSEQTRNVEVWNAYLTPKKLASVVESGTEGLALAQPVTAPTQFGGLEARLYTLNISVNGPPVVNAEFTFNFETGPTKLVVTGKRVVVWPFAPQANVSEVLEWKTDILQAYEGEQRLALRPAPRQKFSYNYLLDGNQFSRAKAIATQWGHRVYGVPVWTNLAFIGPLASGVSEITVNTTAADYRADDVILVWDNDEYYEAVETTEVSPSKIGLKLPLSKPYQNAYVMPLRFGRTYSGAKFTRDASDITESNVSFSVTENINLAASNFPKYRDIDVLTDRSVIVSSLDENIIRDVEVIDNSTGTIIVDTKTNYPLHKQKINWHTTSKAELWRVKQWIYSRQGKQKAFWLPSWGQDLTLTEVMAAQSGAFIVRPIGYPLYYGIKDVMLITKSGEIFYRRVLGGSVNDDGNEVLSIDKALGATVYPTDVEILCFMSLVRFDADRVQISHTQAGNAKISIAVVEVPA
>NZ_CP048880.1|WP_163836877.1|70345_71314_+|hypothetical-protein
MAFETGPANGVDDLLDKLKIFADALGYEILRWRDSSDYNGKELSLKHSKAGVFNFYTDNGNGDEGNPGPWLACYGSTSFDSDINTMERNSSNNLAPAQPGHSPLNATNGLIGPFTRYYFFGTQQYLHIVIEISPGVYAHSSVGTLDKAFDYVGGEYVVCTSWYHGKYNNRIGSSGDNYHGYPWDNKAYYASYYDRIRCDLPDLNHPYWLTFYDREEDGYCWGGMPRNGERGPIHGVFHHSPSTFNGLAPLFPIMNIARVTGGRRYILGTPADVRIVNITHLVPGQSMHIGNDEWLIFPVKSKNGPKGQPNSGIYGLAYRKIV
>NZ_CP048880.1|WP_163836876.1|69434_70346_+|hypothetical-protein
MAVEIGTADNYLDLLDKLRIFLTTNEELVNTGQQWEILRWNNGHELILKAPGLSGAEKIYMGIWAYENTTNDYYNFNICGLVGYIPEHSFADQPYKQSAFVCLWQHKIPYWFIANGQRVIVAAKISTVYEYFYLGKILPYGTPQQYPYPLFVGGTTNADGERWSGTGARHSGFQCPGYGSYLYTIDSVWRRVCNREPYSSSHRWRGENTIFLYPTDTWSFGGGNCKLSNIQQNTDSTYTLLPYILHTSDQPAKNVYGELDGAYWITGNKSASENIITINGQDYLVIQNIHRTTWADYLALELK
>NZ_CP048880.1|WP_163836875.1|66498_69435_+|tape-measure-protein
MTTAAQLQIAVETTGVNTATSVLQQLAIQGQRSERATDGLTDAIRDLVRQGRLTEQAVNRLGVSLDRLEGDTQDAARATDGLANSFSRVKGVLSAIAGSMAIREVVQAADAFAKMQAQLDLVSSSASEARQSYSALFDLAQESRADIEATVGLYSKLARSTKEMSLSNEQLLAITETVNKSFKISGASAEEAKYSIIQLGQGLASGVLRGDEFNSVMENAPRLARAMADELNLTTGELRALAQEGKLTSKVVAGSILNQANAIREEYKKIPRTVGDALTQLKNDFTNAFGRTDVTPLTSAIDDLRKLIADEGFQQSVVALGTAITKVIGAAGEGLSELVDLGRQIGTLAAKASGSTDEIEDLRQAITRLQTLQNSSDLSRTGIFYIDGEFDLHLDQQEIAEALENKKTQLNELLKKYGFSPEYDDSGAKIKPNKAEGKIDVSFSVSGNLEAVQKRIAALNEEASTLGMTARAIDIYKASQQEATKADLKAINAAYDKIEAYQNQQKFDALAQSLRTEEELIKDNYKTSLEIVRNNTTATAELRQRLTGRVTAEYHKELAALKKQKADEIQTIKDSLATEEELILSSYDKRLNQILEKTRTGSKLQQDLLERLNKKFATNVLDGFRSSPKSTDEKIADLEDEYKRAQNVVLKRTQITEEEKTKLLVQLAEERQKRLEEIEKNSEVNKVRNALKTEPERATDLFQERLKTIDESGESEEEKDSLRGRATKQYATDVLGDFAKEQTIEEKINKINEDAEKTREAILANEALTQEQQTELVSELTKQRNEQVQQLNDQKNQQMLATSGKFFDGMAGLAKAYAGEQSGIYRALFAVSKAHALAEALLEAKSLYMKAAASAPPPANAVPIALAVAQGAAGVAQVAAVNFSGAYDKGGHIPAGKFGLVGEYGPEFVNGPANVTSRKDTTKMLEQASQKAEATPPPQVNVRVVNAVDPAIVGDFLDTHEGEQLIMNVVRRNQGALS
>NZ_CP048880.1|WP_163836874.1|66224_66533_+|hypothetical-protein
MQLPPKGSKKSLKAQLLQVYKATGKKPKELAEQPKCPEELEYIFHWWLEVRSSETLTFTELYHWSELTKKNLRAWEVDLIRSLDRIYWNIINDDSGTAANSS
>NZ_CP048880.1|WP_163836884.1|77807_78473_+|AAA-family-ATPase
MAKVISFINQKGGSTKTTNAITLSHGLHKRGNRVLLIDTDQQSTASKAYARALESGFTVADLPSVISVPRETIADEIKSYRNSFDYIVIDSPGSLADLKIPAGVIKASDLAIVPVQPSPYDIEDSAAVVEMIHSRREIADGQPKAGILISRTKDKTILGREIQAALEQFELPIMESRIPDSEVFKQTAISGGSVFDANPKKHPKPVDAANAFVDEVLNILS
>NZ_CP048880.1|WP_163836885.1|78483_79392_+|ParB/RepB/Spo0J-family-partition-protein
MLNSLKNFKVQKGATQAQIDAVKDEVVSTAKSEGRYLTLPANQFEPDLNQPRKTFDKQALKELQQSIESKGQLQPILVKEKGDSGKYQIIAGERRWRAISDSQVIKNITAIVRAGSADDLLVLLMQLDENNKREQVPALENAEAIKRVVDICKADGYDQAHAASMIGISKGHLSKYLSLLNAPDHIKQLSLNGDTQDVVALYDLARAAKKNEKAVNVLVDQWKSGELEGSLRKASRELAENTSKPSKNKSATAKTPTIKKLNLIEKGGQLQIQIELDKKTVVFNLSEAALKELQSGLKIRQR
>NZ_CP048880.1|WP_163836886.1|79448_80510_-|replication-initiation-protein
MDQKKRLRVNKANALIEAKSYFVNGGEVFDHRLGLWEQKVVLSVISKIQPKDKGQLNYTLTYEELSQLSEISIAELKRKKTTAMLVKLRSKTIAIFDTEDAPLITGWFSDIQPKPKDGLIEFSVSPKLKPYLLDLNNNFTSYHLKQVVKLGSVFSIRLYELLRQYLPLKSGRDSSERVIELGELRSYLGLADSKYKRFQDFKRHVLLPAKTELEDKTDLTFDFEGLRVGRSVGEVKFSIHKNVTFEAADSSLEGVLVNDNVVIDEELAKRIRVFIPDIKPSQIDLLFATYTKEELSESLVALATAVAMGSIEKSPLSYYQGVLSNKAKERVPERQTQDWTDTSWEDEVSFDDF
>NZ_CP048880.1|WP_163836887.1|81247_81706_+|lysozyme
MSSIIALIEYEEGWREKPYLCSEGYPTIGYGFKIGPKGAPINLYQFEISQSVGRLWLNEILADLQEKAFAHTEIRTAVAACNDARKAVLISMAYQMGISGLLKFRKALKAIADQRWSDGKTEMLDSRWARQTKKRALRHANQMLSGVWFDGY
>NZ_CP048880.1|WP_163836888.1|81745_82138_+|hypothetical-protein
MKKVTFTLLLILAALLSSCSDEKHITKDYYLFSNDNGVRSIYCKVGDSLYKNLLWYKVISVENGGGFLLGRLVVSGFEKDFVIFIEDNKSCMNSKVVTYETEKEFISKSKAEKISDDIVMSVLASINQDS
>NZ_CP048880.1|WP_163836889.1|82159_82432_-|HU-family-DNA-binding-protein
MNKAELIDLIADKADISKAQAKAALDAKLVSIQEALKEGDQVQLVGFGTFKVKHRAARTGRNPQTGAEIQIAAANVPSFVAGKALKESLK
>NZ_CP048880.1|WP_163836890.1|82657_82873_+|hypothetical-protein
MSSKVQYDLELSKDLEEMIKKISASMTNGDEKELIRKAILLMDTVDQAQANGESLALINQNNDVTARVILN
>NZ_CP048880.1|WP_163836891.1|82885_83233_+|hypothetical-protein
MSDIETIIVGDQKNTNKEKVEPKTIFVDGESKKERYIVHDFKHHPEKNKFSLAKWVLLGLLILLLFILCCLAYVNTHAPNFSERWDSIFSQLVTPIFSLASLVVGYYFGNNTNQT
>NZ_CP048880.1|WP_163836892.1|83400_84264_+|hypothetical-protein
MADLAKIGDKHNCPLCGTNAVAEGSSNVLLDGMPVARVGDKTTCGASIVTGLGWLNVDNKSVAVLGSVTSHGGVIEASSTARAGAPGGSGISPTDFNRVAFQGMKYGFQRDPERPELDGNKGMHYFGDMDSSGLGFNAAVNNGTIQGEVKKEQEKPKNWVKIQLVDQNEKGLAGEVYIVKDAASGQLLDTGYLGKHGSKHIPLPEHVKQVTVEYPEIEPYDQYDMHLARRPGESDVSYAKRIQEQGSGGNMSRSLLDARPELQELFRSYFELVEQASREGKGLYITF
>NZ_CP048880.1|WP_163836893.1|84387_84615_+|EexN-family-lipoprotein
MVKPYIVVVTLFLSACGETVQTLEWYKENPEARKEMIKKCNSNPTELAETPNCINAQTAQARDSSWFKKSDDTGW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048880_1	1.1\|77675\|26\|NZ_CP048880\|PILER-CR	77675-77700	26	NZ_CP048880	Oceanospirillales bacterium S2-4-1H plasmid pB, complete sequence	77675-77700	0	1.0
NZ_CP048880_1	1.2\|77722\|24\|NZ_CP048880\|PILER-CR	77722-77745	24	NZ_CP048880	Oceanospirillales bacterium S2-4-1H plasmid pB, complete sequence	77722-77745	0	1.0
NZ_CP048880_1	1.1\|77675\|26\|NZ_CP048880\|PILER-CR	77675-77700	26	NZ_CP018746	Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed1	25737-25762	6	0.769
NZ_CP048880_1	1.1\|77675\|26\|NZ_CP048880\|PILER-CR	77675-77700	26	NC_017239	Borreliella afzelii PKo plasmid lp28-2, complete sequence	21696-21721	6	0.769
NZ_CP048880_1	1.1\|77675\|26\|NZ_CP048880\|PILER-CR	77675-77700	26	NZ_CP009063	Borreliella afzelii K78 plasmid lp28-2, complete sequence	4928-4953	6	0.769
NZ_CP048880_1	1.1\|77675\|26\|NZ_CP048880\|PILER-CR	77675-77700	26	NZ_CP028865	Borreliella garinii strain 20047 plasmid lp36, complete sequence	11266-11291	6	0.769

1. spacer 1.1|77675|26|NZ_CP048880|PILER-CR matches to NZ_CP048880 (Oceanospirillales bacterium S2-4-1H plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

ctgtctaatattaaaaaacacacgtc	CRISPR spacer
ctgtctaatattaaaaaacacacgtc	Protospacer
**************************

2. spacer 1.2|77722|24|NZ_CP048880|PILER-CR matches to NZ_CP048880 (Oceanospirillales bacterium S2-4-1H plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

tagcaaatacacttagtgtgacac	CRISPR spacer
tagcaaatacacttagtgtgacac	Protospacer
************************

3. spacer 1.1|77675|26|NZ_CP048880|PILER-CR matches to NZ_CP018746 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid unnamed1) position: , mismatch: 6, identity: 0.769

ctgtctaatattaaaaaacacacgtc	CRISPR spacer
atttctaatattaaaaaacacaatgt	Protospacer
 * *******************   .

4. spacer 1.1|77675|26|NZ_CP048880|PILER-CR matches to NC_017239 (Borreliella afzelii PKo plasmid lp28-2, complete sequence) position: , mismatch: 6, identity: 0.769

ctgtctaatattaaaaaacacacgtc	CRISPR spacer
atttctaatattaaaaaacacaatgt	Protospacer
 * *******************   .

5. spacer 1.1|77675|26|NZ_CP048880|PILER-CR matches to NZ_CP009063 (Borreliella afzelii K78 plasmid lp28-2, complete sequence) position: , mismatch: 6, identity: 0.769

ctgtctaatattaaaaaacacacgtc	CRISPR spacer
atttctaatattaaaaaacacaatgt	Protospacer
 * *******************   .

6. spacer 1.1|77675|26|NZ_CP048880|PILER-CR matches to NZ_CP028865 (Borreliella garinii strain 20047 plasmid lp36, complete sequence) position: , mismatch: 6, identity: 0.769

ctgtctaatattaaaaaacacacgtc	CRISPR spacer
atttctaatattaaaaaacacaatgt	Protospacer
 * *******************   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35956 : 46952

uncultured_Caudovirales_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836830.1\|35956_36355_-	hypothetical protein	A0A2P1JUB0	Erwinia_phage	5.2e-35	53.1
WP_163836831.1\|36354_36648_-	hypothetical protein	NA	NA	NA	NA
WP_163836832.1\|36650_36812_-	hypothetical protein	NA	NA	NA	NA
WP_163836833.1\|37671_38478_-	recombinase RecT	A0A2H4J1F0	uncultured_Caudovirales_phage	1.9e-52	62.8
WP_163836834.1\|38539_39583_-	hypothetical protein	D2IYT8	Enterococcus_phage	4.9e-32	40.7
WP_163836835.1\|39586_39901_-	hypothetical protein	NA	NA	NA	NA
WP_163836836.1\|40040_40520_-	hypothetical protein	NA	NA	NA	NA
WP_163836837.1\|40833_41592_+	NYN domain-containing protein	A0A0R6PGY5	Moraxella_phage	2.5e-41	42.0
WP_163836838.1\|41588_42206_-	helix-turn-helix domain-containing protein	K7PLZ5	Enterobacterial_phage	2.9e-24	32.4
WP_163836839.1\|42282_42507_+	Cro/Cl family transcriptional regulator	M4R204	Salicola_phage	6.4e-06	47.2
WP_163836840.1\|42484_43108_+	hypothetical protein	A0A0S2SYA8	Pseudomonas_phage	1.5e-07	27.2
WP_163836841.1\|43528_44392_+	replication protein	K7PGT1	Enterobacteria_phage	2.8e-09	38.3
WP_163836842.1\|44395_45118_+	replication protein P	A0A2H4J1T4	uncultured_Caudovirales_phage	1.5e-19	30.5
WP_163836843.1\|45238_45841_+	hypothetical protein	NA	NA	NA	NA
WP_163836844.1\|45827_46952_+	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	2.4e-32	30.6

DBSCAN-SWA_2

53816 : 100604

Pseudomonas_phage(29.03%)

capsid,coat,transposase,terminase,integrase

attL 93362:93377|attR 100374:100389

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836857.1\|53816_54158_+	hypothetical protein	K7PJX6	Enterobacterial_phage	1.4e-07	46.3
WP_163836858.1\|54175_55135_-	transcription termination factor Rho	NA	NA	NA	NA
WP_163836859.1\|55702_56107_+	hypothetical protein	A0A2I7S7C3	Vibrio_phage	4.0e-14	34.0
WP_163836860.1\|56109_56325_+	hypothetical protein	NA	NA	NA	NA
WP_163836861.1\|56321_56525_+	hypothetical protein	NA	NA	NA	NA
WP_163836862.1\|56514_57138_+	hypothetical protein	A0A2H4J2I6	uncultured_Caudovirales_phage	5.0e-24	37.8
WP_163836863.1\|57134_58619_+\|terminase	terminase	A0A2H4J8J8	uncultured_Caudovirales_phage	9.5e-231	76.0
WP_163836864.1\|58618_60019_+	DUF4055 domain-containing protein	A0A2H4J5M6	uncultured_Caudovirales_phage	2.3e-146	55.4
WP_163836865.1\|60011_61112_+\|capsid	minor capsid protein	A0A2H4J831	uncultured_Caudovirales_phage	1.9e-106	55.5
WP_163836866.1\|61127_61877_+	hypothetical protein	A0A060RIN6	Pseudomonas_phage	2.1e-21	38.8
WP_163836867.1\|61889_62903_+\|coat	phage coat protein	A0A0B4ZZB1	Achromobacter_phage	3.4e-99	53.2
WP_163836868.1\|62934_63225_+	hypothetical protein	A0A2D0W9V2	Bordetella_phage	1.7e-06	45.3
WP_163836869.1\|63226_63733_+	hypothetical protein	A0A1B0VND3	Pseudomonas_phage	6.3e-17	38.1
WP_163836870.1\|63729_64089_+	hypothetical protein	A0A0S0NA58	Pseudomonas_phage	1.5e-09	33.3
WP_163836871.1\|64468_64885_+	hypothetical protein	A0A1X9IAQ7	Xanthomonas_phage	1.4e-22	40.0
WP_163836872.1\|64885_65824_+	hypothetical protein	A0A125SA50	Pseudomonas_phage	7.6e-117	67.6
WP_163836873.1\|65823_66198_+	hypothetical protein	A0A1B0Z0C9	Vibrio_phage	4.2e-26	50.4
WP_163836874.1\|66224_66533_+	hypothetical protein	A0A1L2C8U2	Pseudomonas_phage	2.7e-23	56.2
WP_163836875.1\|66498_69435_+	tape measure protein	A0A125SA53	Pseudomonas_phage	6.6e-42	45.6
WP_163836876.1\|69434_70346_+	hypothetical protein	A0A2D1GMZ0	Marinobacter_phage	7.5e-45	39.1
WP_163836877.1\|70345_71314_+	hypothetical protein	A0A2D2W2C7	Stenotrophomonas_phage	2.4e-25	31.5
WP_163836878.1\|71310_72960_+	hypothetical protein	A0A125SA56	Pseudomonas_phage	6.5e-148	48.2
WP_163836879.1\|72956_73757_+	DUF2163 domain-containing protein	A0A0A1IX16	Pseudomonas_phage	1.4e-79	53.2
WP_163836880.1\|73756_73987_+	hypothetical protein	A0A1X9IAN5	Xanthomonas_phage	8.2e-17	58.4
WP_163836881.1\|73983_74181_+	hypothetical protein	A0A1X9IAJ5	Xanthomonas_phage	9.5e-14	61.4
WP_163836882.1\|74156_77006_+	hypothetical protein	A0A0A1IVS6	Pseudomonas_phage	2.8e-215	53.0
WP_163836883.1\|77005_77458_+	DUF2793 domain-containing protein	A0A248XD96	Klebsiella_phage	6.2e-16	41.9
WP_163836884.1\|77807_78473_+	AAA family ATPase	A0A2H4JGZ2	uncultured_Caudovirales_phage	9.4e-29	38.9
WP_163836885.1\|78483_79392_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_163836886.1\|79448_80510_-	replication initiation protein	A0A218MNI2	uncultured_virus	2.4e-10	31.6
WP_163836887.1\|81247_81706_+	lysozyme	A0A2I7R771	Vibrio_phage	9.9e-30	45.5
WP_163836888.1\|81745_82138_+	hypothetical protein	NA	NA	NA	NA
WP_163836889.1\|82159_82432_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	5.5e-20	58.9
WP_163836890.1\|82657_82873_+	hypothetical protein	NA	NA	NA	NA
WP_163836891.1\|82885_83233_+	hypothetical protein	NA	NA	NA	NA
WP_163836892.1\|83400_84264_+	hypothetical protein	NA	NA	NA	NA
WP_163836893.1\|84387_84615_+	EexN family lipoprotein	NA	NA	NA	NA
WP_163836894.1\|84645_84873_-	WGR domain-containing protein	NA	NA	NA	NA
WP_163836895.1\|85205_85997_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_163836896.1\|86159_86639_+	hypothetical protein	NA	NA	NA	NA
WP_163836897.1\|86732_87440_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_163836109.1\|87888_88479_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-41	49.2
WP_163836898.1\|88669_90397_+	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_163836899.1\|92137_93577_+\|transposase	transposase	NA	NA	NA	NA
93362:93377	attL	NA	NA	NA	NA
WP_163836900.1\|93577_94018_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163836901.1\|94062_94278_-	toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_163836902.1\|94249_94699_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_163836903.1\|95009_95558_-	hypothetical protein	NA	NA	NA	NA
WP_163836904.1\|95819_96242_-	hypothetical protein	NA	NA	NA	NA
WP_163836905.1\|96899_97088_+	hypothetical protein	NA	NA	NA	NA
WP_163836906.1\|97194_97803_+	transcriptional regulator	NA	NA	NA	NA
WP_163836907.1\|98007_98343_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0N9RU54	Staphylococcus_phage	4.7e-05	46.6
WP_163836089.1\|98650_98971_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_163836090.1\|98986_99337_-	hypothetical protein	NA	NA	NA	NA
WP_163836908.1\|99551_99743_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_163836909.1\|99742_100156_+	PIN domain nuclease	NA	NA	NA	NA
WP_163836910.1\|100202_100604_-\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	2.2e-25	44.9
100374:100389	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP048878

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048878_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048878_1

3442877-3443020

Orphan

Consensus_repeat	Method
AAACAAATAAGTTTGTAACTAAC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP048878_1

>merge|NZ_CP048878|1|3442877-3443020|PILER-CR
AAACAAATAAGTTTGTAACTAGAGCCGCCTATAACCCGCATTCTTCCGTTTACGCCAATAGCATTAACAAAAATAAGTTTGTAACCAACCAAAGATAATGACTAAAAAATACTCTGATTCATAACAAATAAGTTTGTAACTAAC

>NZ_CP048878|1|1|3442877-3443020|PILER-CR
AAACAAATAAGTTTGTAACTAGA	GCCGCCTATAACCCGCATTCTTCCGTTTACGCCAATAGCATTA
ACAAAAATAAGTTTGTAACCAAC	CAAAGATAATGACTAAAAAATACTCTGATTCA
TAACAAATAAGTTTGTAACTAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048878.1\|WP_163836495.1\|3450817_3451129_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP048878.1\|WP_163833961.1\|3456243_3457593_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP048878.1\|WP_163833962.1\|3457921_3458734_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225856
NZ_CP048878.1\|WP_163833955.1\|3437759_3442661_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|227226
NZ_CP048878.1\|WP_163833960.1\|3453864_3455124_-\|diaminobutyrate--2-oxoglutarate-transaminase	unknown	unknown	gnl\|CDD\|236437
NZ_CP048878.1\|WP_163833951.1\|3433802_3435737_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP048878.1\|WP_163833947.1\|3427820_3428183_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP048878.1\|WP_163833953.1\|3436125_3436314_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163833958.1\|3451410_3451767_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376699
NZ_CP048878.1\|WP_163830705.1\|3458765_3459701_-\|IS1595-family-transposase	unknown	unknown	gnl\|CDD\|372298
NZ_CP048878.1\|WP_163833948.1\|3428235_3429579_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP048878.1\|WP_163833954.1\|3436722_3437214_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163833959.1\|3452076_3453747_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP048878.1\|WP_163833957.1\|3446917_3450736_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238697
NZ_CP048878.1\|WP_163833949.1\|3429593_3431405_+\|site-specific-integrase	unknown	unknown	unknown
NZ_CP048878.1\|WP_163833956.1\|3443219_3446594_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380193
NZ_CP048878.1\|WP_163830705.1\|3455188_3456124_-\|IS1595-family-transposase	unknown	unknown	gnl\|CDD\|372298
NZ_CP048878.1\|WP_163836494.1\|3431833_3433321_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP048878.1\|WP_163833950.1\|3433329_3433794_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163833952.1\|3435833_3436088_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|225072

Protein	Function_ID	Function_description	E-value
NZ_CP048878.1\|WP_163833961.1\|3456243_3457593_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.31088e-43
NZ_CP048878.1\|WP_163833947.1\|3427820_3428183_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	1.35803e-65
NZ_CP048878.1\|WP_163833962.1\|3457921_3458734_-\|hypothetical-protein	gnl\|CDD\|225856	COG3319, COG3319, Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism].	4.66641e-23
NZ_CP048878.1\|WP_163833955.1\|3437759_3442661_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|227226	COG4889, COG4889, Predicted helicase [General function prediction only].	0
NZ_CP048878.1\|WP_163833951.1\|3433802_3435737_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP048878.1\|WP_163833957.1\|3446917_3450736_-\|hypothetical-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	9.70318e-42
NZ_CP048878.1\|WP_163833958.1\|3451410_3451767_+\|hypothetical-protein	gnl\|CDD\|376699	pfam01981, PTH2, Peptidyl-tRNA hydrolase PTH2. Peptidyl-tRNA hydrolases are enzymes that release tRNAs from peptidyl-tRNA during translation.	1.11699e-16
NZ_CP048878.1\|WP_163833948.1\|3428235_3429579_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	4.11211e-08
NZ_CP048878.1\|WP_163833959.1\|3452076_3453747_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP048878.1\|WP_163836495.1\|3450817_3451129_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	1.22995e-34
NZ_CP048878.1\|WP_163830705.1\|3458765_3459701_-\|IS1595-family-transposase	gnl\|CDD\|372298	pfam12762, DDE_Tnp_IS1595, ISXO2-like transposase domain. This domain probably functions as an integrase that is found in a wide variety of transposases, including ISXO2.	5.19026e-43
NZ_CP048878.1\|WP_163833956.1\|3443219_3446594_+\|hypothetical-protein	gnl\|CDD\|380193	NF033189, internalin_A, class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.	7.55717e-60
NZ_CP048878.1\|WP_163830705.1\|3455188_3456124_-\|IS1595-family-transposase	gnl\|CDD\|372298	pfam12762, DDE_Tnp_IS1595, ISXO2-like transposase domain. This domain probably functions as an integrase that is found in a wide variety of transposases, including ISXO2.	5.19026e-43
NZ_CP048878.1\|WP_163836494.1\|3431833_3433321_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	0.00287306
NZ_CP048878.1\|WP_163833960.1\|3453864_3455124_-\|diaminobutyrate--2-oxoglutarate-transaminase	gnl\|CDD\|236437	PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate transaminase.	0
NZ_CP048878.1\|WP_163833952.1\|3435833_3436088_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|225072	COG2161, StbD, Antitoxin of toxin-antitoxin stability system [Cell division and chromosome partitioning].	5.49787e-09

>NZ_CP048878.1|WP_163833955.1|3437759_3442661_+|DEAD/DEAH-box-helicase
MGSALNRLLETYRSHAKTPRELGSYFESISKAYLENDDIQRQLYSKIWRYADWAAEQGLSKADTGIDLVAQMADDAGLCAIQCKFYDKDYRLQRKDLDSFFSASGKKPFSRRIVIDTTLGDLGKNAQSAFEGQQIETLRIGLSALEESRIDWLTFVSDDEVRLCPKKQILPHQKEALKAVKAGLATTSRGKLIMACGTGKTFTGLKIAENLAGLGKRVLFLVPSLSLMSQTVTKWTNDTVLALRSFAVCSDTQVGKRRKEDVADLEKQDLVFPATTHAETLAKKASSDAPDKMTVVFSTYQSIQAISDAQLLYGLPEFDLIICDEAHRTTGATLMGEAESSFVKVHNQDFIQGKKRLYMTATPRIFGDAAKVKANEAAAVLCSMDDTALFGEKLFELTFSQAVQTNLLSDYKVVVLAVDEGLVSQNVQRRLASEDNELKLDDATKIIGCYKALAKKNLASDIEDDVQPMRRALAFCRDIKSSKLIESEFGKVVEEYLNHHPDQVQDLRCGVRHVDGTFNTKARNQQLEWLKENTEKQEARLLTNARCLSEGVDVPELDAIIFMHPRKSQIDVVQSVGRVMRKAEGKEMGYVILPVGIPAGVEPEEALNNNEKYEVIWQILNALRAHDDRFDAMINKAGLGEDVSSNIQIVGISSEESTATTAVVQELPSRNQQEEKRINIGGSNHYETEGDGKSVVDVRGPQQFSFIFDELSKAVMAKIVKKCGTRLYWEDWAKDIAKIAQAHVTRIATVVEQLGTKERNAFEKLLEELRDDLNDSITEAEAIEMLAQHLITKPVFDVLFEGHSFTQENPVSKAIQGVLDVLEEQHLEKESQSLKKFYDSVKQRAQGVETIQGKQHLVVELYNKFFRKAFPLMANRLGIVYTPVEVVDFIIHSVNDVLKDEFGLTLGSKGVHILDPFTGTGTFITRLMQSGLITLEELVYKYTHEIHANEIVLLAYYIAAINIEAVYHDLSAGEYVPFKGICLTDTFHMHEKEDLISHLMADNSGRRKRQKKLDIKVIMSNPPYSSGQKRQNDNNSNIPYHELDESIRSTYAQKSRSGLHKYLYDSYIRAIRWGSDRLGKSGVMAYVSGNAWIERSFADGMRKCLANEFTKIYVFNLRGDIRKNMLSKGRAKEGSNIFGSSSMTGIVITLLIKNPNATSFGNIFYYDIGEDLNSKEKLALISSFVSINGITEKKAWRTITPDDYGDWLNQRDKSFDEFISLGDKKNKTTATVFENYSLGVVTNRDAWCYNASKSELSRNISRMINYYNSEVDRYLAETLGQKQIKIDDFVHSDAKKISWSRSLKGDLKKRKLLEFQAECLVQSSYRPFSKQWVYFNRQLNEMVCQIPQIFPKAEIDNRVIIVTGVGARSGFSVLMINTLPNLHTMDTGQCFPLKLYEPVKKNATIDLVSKESSLLDEYTMRDGISDAGLSHFQIAYPGEKIRKEDIFYYLYGLLHSEDYYNRYANNISKQLPRIPCVKKAENFWAFAKAGKALAELHVNYETVEPYPVEYKGGRLLWDELTKDDFCVDKKWKFGGTSSKKDKSTVIYNHKITMTNIPVEAYDYIVNGKPALEWVMERQVVKKDKSSGIVNDANRYAIETMKDPSYPLKLFQRIITVSLQTLRIVKNLPRLDIN
>NZ_CP048878.1|WP_163833954.1|3436722_3437214_+|hypothetical-protein
MPIHYKTVSVKEPDKFTCDKCSKIYEMHTCVRIKHTFGYDAPPEWDMKAIDISLCETCLIDIGTFMKIIQGQANDHSEHKGSERLSHALECASSFSDEPPNFDSHPDNGKYGFWKVVGMRHQALVQTDHAQKARELAVNIVNDWELCSIEYLGPHLPKLMSIV
>NZ_CP048878.1|WP_163833953.1|3436125_3436314_-|hypothetical-protein
MSVTLAFELELVGRLFSCCAGAVDLIRLWCYHQGIDWCRETGTVRPFIQCHSAHDKLSGTKL
>NZ_CP048878.1|WP_163833952.1|3435833_3436088_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MKTVKPIHADFSVSITEFKQNPMAVVEQAEGEAVVVLNHNQPVFYCVPADAYELLMDKLEDVELGELIAARKGQNEVEISIDKL
>NZ_CP048878.1|WP_163833951.1|3433802_3435737_+|DNA-topoisomerase-III
MILYIAEKPSLGHAVAEVLPKPHQRKDGYIIVGNGDIVSWCIGHLLEQAEPDAYDPIYKQWKLEHLPIIPKKWKLVVSSKTKKQFLTLKKLINKADNLTHIGDPDRNGQLIIDEIINYCNVPIEKRNAVKRCLINDLNPNSIKKSLTSLRNNQEFIPLSTSALARARADWLYGINMSRVCSIQGRKAGYQGVLSVGRVQTPLLGLVVRRDQDIENFQPKPYFEVFALLETGKGEQFRAKWQPSEACQPYQDEEGRVLSKKLAETVVNRITGQPGLITAATKKRKQQVAPLPYNLSSLQIDSARHYGLNAQQVLSTCQDLYEKHKLITYPRSDCRYLPKEHLNQINTVTTAINQVCEPLQKAVAEADLSLKSKAWNDKKVEAHHAIIPTERKLDPSRLSKTELQIYELIARQYLAQFYPAWQYDDRRIEVEISGGLFVATARQTVDLGWKKIFSKSNENKGDDNNPNQEEQQKLPNLKKGDVVQCLKGELAERMTQPPKPFSDATLLSAMTGIARFVKDPEIKKILRETDGLGTEATRAGIIELLFKRQFLTRQGKQIRSTETGRQLIQSLPEVATTPDMTAQWESQLTSISNKEASYKSFIEPMINSLHYLLTQVDASAFSQLKGKGQTVKKQPKRNYKKRKKA
>NZ_CP048878.1|WP_163833950.1|3433329_3433794_+|hypothetical-protein
MSGKMNRSELTEIRLKEALQRLLDGKPINTPCDGRINLKRINDEAKLSSGGIYYYKDFITKARSIIDKDISNNKQYLNSSNAEEKISKLRKQRDKEKQLKVIYREQRDKMKQFADSVVEENARLSFAIHEAYTKINELEQQILQNKLVPIHKPD
>NZ_CP048878.1|WP_163836494.1|3431833_3433321_+|site-specific-integrase
MSKLHEKSFICRDIGNAEKLAIELAGHNLSVQQSMAIPERIAAKYFDYALKVITRYHPYRYAISRAYQNLFIEYKKSSSIWKTQANSKKYAVRNVEHNIPFSDFVLDLSGSWLSWLRGACYFVIAGFTGCRDGEIKSFNLASYEEKQYADVTIPIVYGEDSKPNHAGISRRISWVTIPAVKLAIELLWYSFEFARNEWREKGKNITHLDDRKKFLQKVDKIFLTLPHIATTHPSAGRQALSNSLENFAKSVDCRLTKEDIEEFNRLNPTRKGQLKVGDILIPHPHGFRRTFAVFLVRNRLGSLMELKYQFKHMNVAMTAWYSNQAEIAGYFDMMTDRDLINIIEEENHEFMTDTLYYIYNEAETLSGIEGKRILDARLSSPTTIYLSRDEISRQVKEGQMSIIEHPGGHCTNPSCNRICNMQTCRFKVVTKEKAINLVPERERLVKKFLTLKKWQVKQPNIMSKIYYDIKSIEQCFKDHDIPFTPFIDTIDVTML
>NZ_CP048878.1|WP_163833949.1|3429593_3431405_+|site-specific-integrase
MAFKRQKTRKTVKAKDNSSAEVYPISVESMVINDSYRTVHFKRLGYKGCPNLSPGSKNKSFKSKRPEDLVDMNRWDLVQSLYINIKGMDKSERTKTNIYQDLCKLIKACDEANISDIFSVPAIEKFVSTLKTKYTRGAKGKTQNSIQYSIKTLIAEMALPNERQVLDCFYKFPNDSTPTEPYTDDELKVILRNLYKILNSYKSHLLEKTTPDTFPLFNDKNTESNDKISRYIRFSSSRKISYKRNSSTWKQDLVICGYFITCFFTGVNQSSLLNLKHSDIKGCSFIESSKGKYLLQTTKGRQNYQRNLHGVGFTARGKDFFETWLRLSKLITSNSSGYVFPKVTNDVCSKMNNSHLYSGINTTFKMLGLPALSAKRFRKTKASIIMRATNSIFSVAESLNNSPSTVDKHYSDGDQVTNQITLAKALEVRERSAKGEPIREVIHNIRFQFKDPVREYNYQKNGLTTPPLSPCGLRCESPFGKKAEQLKKTLQEVSLATKRDRVACYKFLECFGCEHHAVIAEVEDIWMILSFRDVIDESLARPSVNSIPTSLLTKVLNTINYLLKRLEKDHNKTYMLALEQYNDEPHPLWSDYNDLGMLMEVWS
>NZ_CP048878.1|WP_163833948.1|3428235_3429579_+|site-specific-integrase
MEYILWDLPNLTIDKQPCFEIDLNGELKLRWSGTGNALGRLPLLYDERGKSIEVVNQWLIHLKANNHRKQVSTQAQALLHYFIFLDDLNLKWDEMPIPPRNRPTYRFKKHLKEVFKNGGIARTTANNYMGVVVNFYKYYLARRHPFSNPPFRYEEVKIKLTGNHQFMRQGFIHVDTTDLRLNLPKDTSFGGLSRKLIPLSEEEWSLVDDIYRNQGEAISYTNGEKKKVSISVEFKLILALARYTGMRREELATFRSNMVFKPNAEQLIKKYLIHNNGILISPAVGVNTKGAGARRVEIPTLLMLNLHKYINSPRYIERRNKYLKKNPDEPFGAPLFITQKGNKYSGKTFDARWGEIRNAARIKYKNFDHKFHNLRSTYAVFRLKSLLSNEKLTEGEALDYLQAVMGHKNRSSLLSYLKFSKFELEANEIYEQAVDVLLGSDNDFNLV
>NZ_CP048878.1|WP_163833947.1|3427820_3428183_+|DNA-topoisomerase-III
MRLFIAEKPSLGRAIAEVLPKPHQKGDGYIQVGNGDYVSWCIGHLLEQAQPDAYDPAYKQWKLEHLPIIPKQWQLTPKAKTKKQLGVLRKLIKQADQLIHAGDPDRALLRLKTEFHILHL
>NZ_CP048878.1|WP_163833956.1|3443219_3446594_+|hypothetical-protein
MNSNGQQEALKRIEAARLNESTELDLSSLNLAELPQAVADLTQLTELDCSGNQLKDLSALANLTQLTELVCSDNQLTDLSALVNLTQLTTLVCSRNQLTDLSALVNLTQLTELYCSDNPLTDLSGLAKLIQLTTLVCSGNPLNDLSALVNLTQLTELDCSGNQLTDLSGLAKLIQLTTLNCSFNQLTDLSTLAKLIQLTTLDCSRNQLTDLSGLAKLIQLTTLVCSGNPLNDLSALVNLTQLTELDCSGNQLTDLSGLAKLTQLTTLNCSFNQLTDLSGLAKLIQLTTLGCSGNQLKDLSALANLTQLTELVCSDNQLTDLSALVNLTQLTTLVCSRNQLTDLSALVNLTQLTELYCSGNQLTDLSGLAKLIQLTTLDCSRNQLTDLSGLAKLIQLTTLVCSGNPLNDLSALVNLTQLTELDCSGNQLTDLSGLAKLTQLTTLDCSHNQLTNSVEIQTIVENNPTLISVDFRYNPIQRIPKEFLDSLKILKGYFADLKQGAIENKQIKLLLLGNGRVGKTTLAYCLEHQQAPLEGTVFESTHGIIVKDITLPCHQGGNPWQLRLWDFAGQEIYHATHRLFYTSNALYLVLWAEETDEIDTEHDHELIYWLDLVQLHAEDAEIIVIKNQLNRRNELGLQINELQQPPYNHLQHYGISANVYQGVRVVEAAIVDALEQLVNNLPTLPITWHQVREALDNTKDHYISYDDYCALCKENQVGHPDVLLDYLHQTGSCFYFGSDFNNHIILDQNWAIKAIYRLFEKDNKGKGPRHIIHQKHGEITGNEALALFSGYSQSEVEIFFNFMRGSHLCFSQSQWSAFGKQQFVFPSLLPESHPELEAYTYNAKFEYKITYPWLHRLLVERFIIHARHLAPKKTWWRNGIAVIDRELKSAAALVADSETKSIHIYASGQNPTALLKRILKSLDELNLCQPIEHLIKEQGSEWVDIEEVKKAHQTRTPYVVAETGENVSAVSLFDALEYEDVKLLSEVPETTSEQIQHFTYYYIKEAKKVENTGNKVTIENSENIRFMIKGDINIGANNSDKQAKIGKLEELINLLQAAPPTTNSEDAIRYLKNTVDEVSKSEPNKTLVETYLNTASGFLNMIDKGSELFKKGKELFESFGFSLG
>NZ_CP048878.1|WP_163833957.1|3446917_3450736_-|hypothetical-protein
MQFIAHGPDIPDELLQAHEEGRVVFFCGAGISYPAGLPGFYGLVREIYRLCGTTPSDIEQEALDREQYDATLDLLERRLPGQRLAVRRALEQALKPKLRRKGATDTHAALLRLARSREGALRLVTTNFDRVFHTAAKRIGQTFRAYAAPMLPIPKNSRWDGLVYLHGLLPRKAEDTDLNSLVFTSGDFGLAYLTERWAARFVSELFRNYVVCFVGYSINDPVLRYMMDALAADRMLGEITPQAWALGDCAPGQEHCKTIEWEAKGVTPILYDVPASSHDHSALHRTLQAWAEIYRDGILGKERIVVSHALAQPSVSTQQDDFVGRMLWALSDNSGLPAKRFADFNPVPSLEWLLEAFIDERFQHSDLARFDVPPRDKVDAELRFSLIRRFAPYDRAPLMLLASNGINSSQWDKVMYHLARWLTRHLNDPELIIWVAKRGGQLHDPWPQLIENKLKEYALLEHDGKTTELNDIHAQAPNAIPSPLMRKLWRLLLSSRVKSPLREFNLYRWKDRLKREGLTIMLRLELRELLTPKVALKRPFRWSDQEESAAQATRLCQLVDWEVKLAAGDVYAVLHELTSEHCWTSALPQLLEDFQQLLRDALDLMHELGGADERSDRSFWDLPSITPHWQNRSFRDWVRLIELLRDAWLAVYSNDRVRATRIAQAWFELPYLTFKRLALFAASQEDCIDPDQWVDWLLADGAWWLWSTDTGREVFRLFVLQGCRLAGATQERLEAVILAGPPREMYREDLEPDRWQELVDRSVWLHLSKLDSSGISLSPTAQVRLQELSHAYPKWQLAANERDEFSHWMSGTGDPGYEDSRDVDIAPRKRHELVQWLKKQLPEQQSIYKDTWHDVCRTRFFHSLLALCDLAKASIWPTDRWCVALQVWSEEDMVLRSWRHAALLVKRMPDDTLQVIVHSVTSWIEIVSKSVNQQEDILLDLCRRVLELPLEALLNGEPVDPVNEAINHPVGHTTHALINFWLKQSPNDGDHLPADIKQFFTEICDVNVDRFRHGRVLLSSRLIALYRVDQTWTEQYLLPLYSWNNPKEAKAVWEGFLWSPRLYQPLLTALKTEFLECVKHYIELGEHRQQFAAFLTYAALDSLEGYTVDDFRSAIGELPQEGLEEAAQALFQALDGAGEQSEDYWRNRVKPFWQNVWPKSRDLATPRIAESLTRLTIAARSEFPSALAAMKDWLKPIEHPYYTLNLLKESELCKKFPLDSLDLLDIVISDQQQWVTQELGQCLDEIVQTAPLLAQDDRYRRLREYLRKSGVQ
>NZ_CP048878.1|WP_163836495.1|3450817_3451129_-|HigA-family-addiction-module-antidote-protein
MQQHNPIHPGEFIKRVYLDEFDIGSNELAKHLHVSSSIISRLLNGKSDVSPAMALKLSKVLGRSPESWLQMQNNYNLWQVKKLVNLDEFTPFDFASKNCGQQS
>NZ_CP048878.1|WP_163833958.1|3451410_3451767_+|hypothetical-protein
MDTPKAYFVIRSDLELNPAKLAVQIGHGTDMIWQHQMVDQASFKTWLSPEQGDRRKIVLKVNSFEKLTSLKEKLISNGFYCFDIVDSGYNFVEAYTQTGIVIFPTAVESKVIKRLRIL
>NZ_CP048878.1|WP_163833959.1|3452076_3453747_+|DNA-topoisomerase-III
MKSRVYIFSQKKTCNSDEEGQILVDEVINFIGVSTTKRASIQRCLINDLNPNSVRKALASLRDNRDFIPLATSALARARADWLYGINMSRVCSIQGRKAGYQGVLSVGRVQTPLLGLVVRRDQEIENFQPKPYFEVFALLETEKGEQFRAKWQPSEACQAYQDEEGRVLSKKLAETVVNRITGQPGLITAATKKRKQQVAPLPYNLSSLQIDSARHYGLNAQQVLSTCQDLYEKHKLITYPRSDCRYLPKEHLNQINTVTAAINQVCEPLRKAVVEADLSLKSKAWNDKKVEAHHAIIPTERKLDPSRLSKTELQIYELIARQYLAQFYPAWQYDDRRIEVEISGGLFVATARQTVALGWKKLFSKSNGNKGYDNNPNQEVQQKLPDLKKGDVVQCLKGELAERMTQPPKPFSDATLLSAMTGIARFVKDPEIKKILRETDGLGTEATRAGIIELLFKRQFLTRQGKQIRSTETGRQLIQSLPEVATTPDMTAQWESQLTSISNKETSYQRFMEPMTNTLHDLITQVDVSAFSKLKGQGQTFKKQPKRNYKKRKKS
>NZ_CP048878.1|WP_163833960.1|3453864_3455124_-|diaminobutyrate--2-oxoglutarate-transaminase
MKLFSDYESEVRSYIRSFPVIFDRADGAVIWDDQGNEYLDFFAGAGTLNYGHNPKAVNQALIDYLNNQGILHSLDKATVAKQNFIEKFFQTIIKPRGLDYKIQFTGPTGTNAVEAAIKLARRVTQRRNVIAFTQGYHGLTMGALMLTANNYYHNPSDGGRANVYHAPYDGYFGETVNTAKYLRKLIEDSSSGVSMPAAIVLETIQGEGGINTASKEWLQEIEKLCRENSIVLIVDDIQVGNGRSGEFFSFEFAGIKPDIVCISKSIGGGLPLAFTLIKPELDQWLPGEHTGTFRGNNLAFVAAAELLTYWDNDELSQTVLQKGHMIKSCLEQFVSDFPQLKMSVRGRGMIWGLEIPKAQAAKVLSQYLFKHKLLIETCGKNDSVIKIMPPLTIEHSYLDQGLRKIGDGIHDFLKSRYMD
>NZ_CP048878.1|WP_163830705.1|3455188_3456124_-|IS1595-family-transposase
MAINKVQFQKGLSLNEFLKQYGTEEQCFNTLYKLRWPEGFQCPNCGYDKCCQLTTRKLQQCYKCHQQTSVTAGTIFESTKLPLKTWFQGMYLISQDKKGISAIELHRHLGISYQAAWRMKHKLMKVMQEREGTKQLSGFIEIDDAYLGGERTGCKRGRGADGKIPFVAAVETTKQGQPTRIKLSILKGFNKEEITAWSRQNLAKGSTVISDGLACFNGVIEAGCLHDKIVCGGGRASVEEPEFYWVNTILGNLKSALRSTYHAIRAKYAQRYLAEFQYRFNRRFSLVEFIPRLAFVALRTPPLPGKLLNIA
>NZ_CP048878.1|WP_163833961.1|3456243_3457593_-|MFS-transporter
MHVLTEESECSDEQDKSIGFIRFLLLLVATLISVLGTMMTDFALGQWVYKETQSATAYGLIGFAALAPQLLMAPVIGALIDRHSRALLMIIGHAGAGICTLLLLFLYMNQSLEVWLIILLASISSVFNGLINQTFIVLTPVIVSKSQLVRVQGFIQGGMGIVEISVPAVAAFSLVTIGIEGIFAIDIISFLAAILLILVVLKQLSDCDGRIKDSKKDNRSIRSDVTFSLQYLRQNRNLLYLLIFMAVVNFSIGIVHVLFTPLVLSFSNVIELGKVLTAAGVGTLLGSIFLAIWGGPKDKVKGICMALLIIGILLMMSTLIFIKEVYAVLFLSAIALLITLSFVIVNGCDQVIWQTTVPSEIQGRVLSIQTIVSQGALPLAFLVAGPLADYIFEPMMAINGPLASSMVAVLGVGPGRGITLLYGICGLLIIASILLFYTISSKGNTKRVI
>NZ_CP048878.1|WP_163833962.1|3457921_3458734_-|hypothetical-protein
MKKDEASQLVIFSDEEQLPSLYCFPGLGGLSIGFSELSRALFNKVNIKAFDAQGLFNEAVVFNNFEDMIDHHALEIKRHLSTASCSLAGHSFGGRVAFEVGRRLENEGINVTLFMLDVVLSNNVFGIDEQENEEKIKMDFILALSEWLGISTEAELTLDSPAIDVFSKNISLAMQKMGLINNQSFSVDDFWKAYKSQKNMNDHYLPSGKFNGDVYFLYCEELKPYLPEVVLDYQQYCSKVNTYKVMGEHHSMLNHENVGSIVSLIQKKIS
>NZ_CP048878.1|WP_163830705.1|3458765_3459701_-|IS1595-family-transposase
MAINKVQFQKGLSLNEFLKQYGTEEQCFNTLYKLRWPEGFQCPNCGYDKCCQLTTRKLQQCYKCHQQTSVTAGTIFESTKLPLKTWFQGMYLISQDKKGISAIELHRHLGISYQAAWRMKHKLMKVMQEREGTKQLSGFIEIDDAYLGGERTGCKRGRGADGKIPFVAAVETTKQGQPTRIKLSILKGFNKEEITAWSRQNLAKGSTVISDGLACFNGVIEAGCLHDKIVCGGGRASVEEPEFYWVNTILGNLKSALRSTYHAIRAKYAQRYLAEFQYRFNRRFSLVEFIPRLAFVALRTPPLPGKLLNIA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048878_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048878_2

4635957-4636166

Orphan

Consensus_repeat	Method
TGGNTCCGGCTTAGGATC	CRT

4 spacers

The CRISPR arrays of NZ_CP048878_2

>merge|NZ_CP048878|2|4635957-4636166|CRT
TGGATCTGGCTTAGGATCGGGTTTTGGATCCGGCTTAGGATCGGGTTTTGGGTCCGGCTTAGGATCGGGTTTTGGATCCGGCTTAGGATCGGGTTTTGGGTCCGGCTTAGGATCGGGTTTTGGGTCCGGCTTCGGATCCGGCTTAGGATCTGGTTTAGGATCTGGTTTAGGATCTGGTTTAGGATCAGGTTTTGGGTCCGGCTTAGGATC

>NZ_CP048878|2|1|4635957-4636166|CRT
TGGATCTGGCTTAGGATC	GGGTTTTGGATCCGGCTTAGGATCGGGTTT
TGGGTCCGGCTTAGGATC	GGGTTTTGGATCCGGCTTAGGATCGGGTTT
TGGGTCCGGCTTAGGATC	GGGTTTTGGGTCCGGCTT
CGGATCCGGCTTAGGATC	TGGTTTAGGATCTGGTTTAGGATCTGGTTTAGGATCAGGTTT
TGGGTCCGGCTTAGGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048878.1\|WP_163834883.1\|4641683_4643819_-\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|273831
NZ_CP048878.1\|WP_163834878.1\|4632959_4633709_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP048878.1\|WP_163834882.1\|4638052_4640278_-\|type-I-secretion-system-permease/ATPase	unknown	unknown	gnl\|CDD\|273831
NZ_CP048878.1\|WP_163834886.1\|4645102_4645549_+\|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl\|CDD\|238385
NZ_CP048878.1\|WP_163834887.1\|4646339_4649282_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380078
NZ_CP048878.1\|WP_163834888.1\|4649994_4650984_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP048878.1\|WP_163836555.1\|4640279_4641662_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|130902
NZ_CP048878.1\|WP_163834879.1\|4633889_4634744_-\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580
NZ_CP048878.1\|WP_163834873.1\|4628319_4629138_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270422
NZ_CP048878.1\|WP_163834872.1\|4627038_4628166_-\|carboxypeptidase-family-protein	unknown	unknown	gnl\|CDD\|349453
NZ_CP048878.1\|WP_163834876.1\|4630764_4631346_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|179642
NZ_CP048878.1\|WP_163834874.1\|4629361_4629826_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163834871.1\|4626706_4626976_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163834875.1\|4630158_4630713_+\|cytochrome-b	unknown	unknown	gnl\|CDD\|225580
NZ_CP048878.1\|WP_163834881.1\|4637630_4637885_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048878.1\|WP_163834885.1\|4644853_4645099_+\|molybdopterin-synthase-sulfur-carrier-subunit	unknown	unknown	gnl\|CDD\|182985
NZ_CP048878.1\|WP_163834877.1\|4631467_4632997_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|270325
NZ_CP048878.1\|WP_163836556.1\|4649351_4649990_-\|maleylacetoacetate-isomerase	unknown	unknown	gnl\|CDD\|273527
NZ_CP048878.1\|WP_163834870.1\|4625352_4626069_-\|tRNA/rRNA-methyltransferase	unknown	unknown	gnl\|CDD\|236693
NZ_CP048878.1\|WP_163834884.1\|4644359_4644857_+\|cyclic-pyranopterin-monophosphate-synthase-MoaC	unknown	unknown	gnl\|CDD\|236483

Protein	Function_ID	Function_description	E-value
NZ_CP048878.1\|WP_163834883.1\|4641683_4643819_-\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|273831	TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP048878.1\|WP_163834878.1\|4632959_4633709_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	2.21035e-92
NZ_CP048878.1\|WP_163834886.1\|4645102_4645549_+\|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl\|CDD\|238385	cd00756, MoaE, MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), which carries the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase in the second major step in Moco biosynthesis. MPT synthase is a heterotetramer consisting of two large (MoaE) and two small (MoaD) subunits.	1.14655e-59
NZ_CP048878.1\|WP_163834887.1\|4646339_4649282_+\|hypothetical-protein	gnl\|CDD\|380078	pfam17963, Big_9, Bacterial Ig domain. This entry represents a wide variety of bacterial Ig domains.	3.45398e-05
NZ_CP048878.1\|WP_163834888.1\|4649994_4650984_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	9.88599e-50
NZ_CP048878.1\|WP_163836555.1\|4640279_4641662_-\|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit	gnl\|CDD\|130902	TIGR01843, Hemolysin_secretion_protein_D_plasmid, type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins. [Protein fate, Protein and peptide secretion and trafficking].	1.27515e-122
NZ_CP048878.1\|WP_163834873.1\|4628319_4629138_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270422	cd13704, PBP2_HisK, The periplasmic sensor domain of histidine kinase receptors; the type 2 periplasmic binding fold protein. This subfamily includes the periplasmic sensor domain of the histidine kinase receptors (HisK) which are elements of the two-component signal transduction systems commonly found in bacteria and lower eukaryotes. Typically, the two-component system consists of a membrane-spanning histidine kinase sensor and a cytoplasmic response regulator. The two-component systems serve as a stimulus-response coupling mechanism to enable microorganisms to sense and respond to changes in environmental conditions. Extracellular stimuli such as small molecule ligands and ions are detected by the N-terminal periplasmic sensing domain of the sensor kinase receptor, which regulate the catalytic activity of the cytoplasmic kinase domain and promote ATP-dependent autophosphorylation of a conserved histidine residue. The phosphate is then transferred to a conserved aspartate in the response regulator through a phospho-transfer mechanism, and the activity of the response regulator is in turn regulated. The sensor domain belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space through their function as an initial high-affinity binding component. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.50353e-07
NZ_CP048878.1\|WP_163834872.1\|4627038_4628166_-\|carboxypeptidase-family-protein	gnl\|CDD\|349453	cd06234, M14_PaCCP-like, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases similar to Pseudomonas aerugnosa CCP (PaCCP). A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins. This subgroup includes PaCCP from Pseudomonas aeruginosa, a carboxypeptidase homologous to M14D subfamily of human CCPs. Structural complexes with well-known inhibitors of metallocarboxypeptidases indicate that PaCCP might only possess C-terminal hydrolase activity against cellular substrates of particular specificity. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins (such as alpha-tubulin in eukaryotes) to remove a C-terminal tyrosine. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain.	7.65143e-149
NZ_CP048878.1\|WP_163834876.1\|4630764_4631346_+\|YceI-family-protein	gnl\|CDD\|179642	PRK03757, PRK03757, YceI family protein.	2.8125e-121
NZ_CP048878.1\|WP_163834885.1\|4644853_4645099_+\|molybdopterin-synthase-sulfur-carrier-subunit	gnl\|CDD\|182985	PRK11130, moaD, molybdopterin synthase small subunit; Provisional.	5.45027e-30
NZ_CP048878.1\|WP_163834882.1\|4638052_4640278_-\|type-I-secretion-system-permease/ATPase	gnl\|CDD\|273831	TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP048878.1\|WP_163834875.1\|4630158_4630713_+\|cytochrome-b	gnl\|CDD\|225580	COG3038, CybB, Cytochrome B561 [Energy production and conversion].	7.74053e-60
NZ_CP048878.1\|WP_163834879.1\|4633889_4634744_-\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	1.56795e-38
NZ_CP048878.1\|WP_163834877.1\|4631467_4632997_-\|ABC-transporter-permease-subunit	gnl\|CDD\|270325	cd13607, PBP2_AfProX_like, Substrate-binding protein ProX of ABC-type osmoregulatory transporter from Archaeoglobus fulgidus and its related proteins; the type 2 periplasmic-binding protein fold. This subfamily includes the periplasmic substrate-binding protein ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus and its related proteins. AfProX is involved in uptake of compatible solutes such as the trimethylammonium compound glycine betaine and the dimethylammonium compound proline betaine, but the relative substrate preference is not known. To counteract the efflux of water, many microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. AfProX belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.11979e-101
NZ_CP048878.1\|WP_163836556.1\|4649351_4649990_-\|maleylacetoacetate-isomerase	gnl\|CDD\|273527	TIGR01262, Maleylacetoacetate_isomerase, maleylacetoacetate isomerase. Maleylacetoacetate isomerase is an enzyme of tyrosine and phenylalanine catabolism. It requires glutathione and belongs by homology to the zeta family of glutathione S-transferases. The enzyme (EC 5.2.1.2) is described as active also on maleylpyruvate, and the example from a Ralstonia sp. catabolic plasmid is described as a maleylpyruvate isomerase involved in gentisate catabolism. [Energy metabolism, Amino acids and amines].	9.69752e-106
NZ_CP048878.1\|WP_163834870.1\|4625352_4626069_-\|tRNA/rRNA-methyltransferase	gnl\|CDD\|236693	PRK10433, PRK10433, putative RNA methyltransferase; Provisional.	2.26109e-93
NZ_CP048878.1\|WP_163834884.1\|4644359_4644857_+\|cyclic-pyranopterin-monophosphate-synthase-MoaC	gnl\|CDD\|236483	PRK09364, moaC, cyclic pyranopterin monophosphate synthase MoaC.	1.51487e-95

>NZ_CP048878.1|WP_163834879.1|4633889_4634744_-|phytanoyl-CoA-dioxygenase-family-protein
MQKYNELQQFTWNQQKGLTHDAWRFYHKNGFLVVNHFVAEQTCQKLKKQAFKIAQDQQQQETVVFSTTHRQHDKSRYFMESANDIRCFYEELAVAKDGALTKQKQQAINKIGHALHRFDPVFKQFVEGNSIKQLISQLPLVSPKMIQSMVIFKQPYIGGEVGCHQDATFLYTEPSSVIGLWFALEDATVDNGCLHAIPGGHQQGLAMRYCNQNGEMQMVELQNIQWELNAAIPLEVKQGSLIILHGLLPHFSEQNYSSRSRLALTFHLIDTQCNYLADNWLQSV
>NZ_CP048878.1|WP_163834878.1|4632959_4633709_-|ATP-binding-cassette-domain-containing-protein
MNTTKPGDELAVELSQISVKYQQLELFSRLDFALPQQQITAVIGESGCGKSTLLKLINGLVAPTSGSIRLFGQAQTQPFNNTTRRGIGYAVQQIGLFPHLNAFENIALLAKLDNWQQTEIEQRVSYLADCMGLTITLLERYPHQLSGGQAQRVGLCRSLMVKPAVLLLDEAFSAVDPITRKEVHDRFLQLHQEEPRAVLLVTHDMREAVKIADKIAVMQEGKIVQHGAVSTVTAQPANDYVARLIKDHI
>NZ_CP048878.1|WP_163834877.1|4631467_4632997_-|ABC-transporter-permease-subunit
MTMLHVLSRITFNMRLLLFIILLWTSQWAAGVTDRDNTTITVGSKAFNEGYLLGELVAQKLESDGYNVERKLGLGKTVITYEALRYGDIDVYVEYTGTLAQAIFKLKNTPAFEQLSRLAKQHELQVLPSLGFNNTYALVMDKNKANKLGIKTIADLTKHPQLNFGLTHEFMKREDGWEKLAVHYQLNQQPVGIEHGLAYEAIQAGKIDITDAYSTDGDINKFNLLLLEDNDGYFPRYDAVPLVREDADQAMVTSLKELAGILDEATMQRLNGEVVNNDKTFAEVAHQFLVTKKYKKASEVELEGPWQQLPGNILQHLKLTLIALGAACLLGIPLSVYCYRNRTISRVVIYTTGLLQTIPSIALLALFIPLFGIGWLPAVVALFLYSLMPIVRSTTTALLTIDPVLKQVAVGMGLTHKEQLKKIYLPLALPAMFTGIKTAAVINIGTATLAAFIGAGGLGEPIVTGLALNDFQLVLYGAIPAALLAVVTELFFELVEIRYIPAHLRDQWK
>NZ_CP048878.1|WP_163834876.1|4630764_4631346_+|YceI-family-protein
MRLNKVASVFMGLTLLASSQLWAADYKIDTKGAHAFIQFRVKHLGYSWLYGRFNTFDGSFSYDEKKPEATKINVTIDTASIDSNHAERDKHLRSDDFLDVKKFPKATFVSKKVMPKGSDKAVLVGDLTLHGVTKEVSIDVTKIGGGKDPWGGYRQGFQGSTSFKLKDFNIKKDLGPASQEVELILSIEGIRQS
>NZ_CP048878.1|WP_163834875.1|4630158_4630713_+|cytochrome-b
MHIKNTPKQYGLVSILLHWLTAITIIGLFALGLYMVELDYYDPWYKKGPDIHKSIGLLLLAVFIIRAGWRLFTNAPKPLETHQAWERLLAHLTHITLYLLILLVIFSGYLISTADGRSVSVFGWFEVPALITGIDQLESYAGAVHYYLAFILIGLASLHGLAAIKHHVLDKDDTLRRMLGTAKK
>NZ_CP048878.1|WP_163834874.1|4629361_4629826_+|hypothetical-protein
MKLKTMLLAATLSLTTLGNTSYARPDFQPLPLEEALKKLELTTEQQTKTNTIVTEDNKRYEELLAKHSLTDEQLTTLLKDTFNAKYTTIRSLKQVLTAAQMERLIRLMKPRHDGRPCKPKPDDQDVRPCNKPKPDPVPKPDDDVVIMNLLKHNS
>NZ_CP048878.1|WP_163834873.1|4628319_4629138_+|ABC-transporter-substrate-binding-protein
MAKLLFLVLLTIYSITINLACFAAPVIKIYTSEEPPLNFSIGPSKESAAGSDVSGFATDVVREILALTNNSSTPIVLLPWARAYQYTLYGENVFLFSMGRTKQREQLFQWIGPLAEKKAILYSTQKTKVTISSLDDAKTVTSIATVIDDSKEQYLKSQGFTNLSSSPIWKQAIQKLFINRAVLLAQTDLDIPFIVREAGYSIDQIKPVYELYKFQLFIGTSKQTSPQLVSHWQQALDTIKKNGRFKTLVKKWSDYYQLTNWQYQKGMLRVVY
>NZ_CP048878.1|WP_163834872.1|4627038_4628166_-|carboxypeptidase-family-protein
MHISDQFEGGNIAVVSLEDADDIQLEIKKDNQSDFYQWFYFRFVGEVGKKYQFHIMNAAEAAYAKGWEGYQVLASYDRENWFRMPSCYENGVLSVKFGLEEASVFFAYFEPYSYERHLDLLQAALVDERVSMHLLGQTLDGRDINLLQVGEVTATYKVWLIARQHPGETMAEWFIEGALEALLNPNLGVARQLLKQTVFYIVPNMNPDGSVRGHLRTNAAGINLNREWQNPSMEKSPEVLLVRNKMHEIGGDIFLDIHGDEVLPYNFVVTAEGVPNYNEHIANLEQRFKDVFLQVTPEFQVEHGYPIDSPGEANLSMAASYLANHFQTLSLTLEMPFKDNQLLADPLTGWSAERSKQLGKDILIPIWQTLELMEK
>NZ_CP048878.1|WP_163834871.1|4626706_4626976_+|hypothetical-protein
MKKLATIFSITLLTACGSNQTTTDTHSETTEPVSTQVEPVAPTPVDTEADKLRQLWERYCNHEPLTIEERQMIADSEMPEDLRGQCTQK
>NZ_CP048878.1|WP_163834870.1|4625352_4626069_-|tRNA/rRNA-methyltransferase
MSIYFILVEPKLPANVGAAARALQTMGFANLRIVNSQAHLAPEAQWVAHGAREVLTAAKHYNHLAEATVDLDFTVATTVKKRSTKRYYYSPEQVKQLLETKGATISKVGIVFGREESGLTSEEVHHCDIASSIPLANPQPSLNLGQSIMLYAYVLSSIDIEQEQEILAPEGQMKALKAKLALLFESLAISPTAVEYRWAMERLGVLTEKDIHFLHTFASDLLKLAPNGDNINPNSTGN
>NZ_CP048878.1|WP_163834881.1|4637630_4637885_-|hypothetical-protein
MIWLVVALLLLLLAMMVTLLKGAGKSQVAVEVSHMMGRIESARASSNEEKAKQEAEKLKQFLDQEGLKGGIFDRARELINEVLN
>NZ_CP048878.1|WP_163834882.1|4638052_4640278_-|type-I-secretion-system-permease/ATPase
MQQEQVQDQENTALEQVKTESAINCLVRVGQLFDIAIDSQQLLHRHGNYEAAYDELDISRCAGRYGFKSKWQTLDATALEKIPVPAILYWQGHYWVLEKNGAEETSWQLYNGKTQQVVNISVKALLIAEKLQVMLLNKSETVKVNQLPFGFQWFWQFIKKYRKQFRDVMIVSIFLQLFALVTPFLFQTVIDKVLVSRGLSSLHVLAIGMLSLALFEPIFTFVRSIVFSHLASRVNSELTSYVYQHLIGLPLAFFRTRQTGEIIARIREMDQVRSFMTGTALTLVLDLLFVGVFMAVMFSYAPLLAWLVIGSFVIYAGFWLCITPSLRNRVQRQYEKNAENTAFLTETVTGIETIKTSATEPQFNKQWDEKLANYVKSAFSTSLLGNIAGQGIGLIQKLFSALLLWFGVKLVLEGKLTVGELVAFNMLAGHVTMPVLRLAQVWQEFQQASISLRRVGDIMHHPSENNIQAGKTSQPSIEGEIELRKVTFRYHDDAPEALRRLDLTVQAGQMTGLTGRSGSGKSTITKLVQRLYVPQSGQVLVDGMDLALIDPALLRQNTGVVLQESFLFNGTIRENIVISKPSATEEDMIKAATLAGAHEFIGELQGGYDTPVGERGGNLSGGQRQRVAIARALINNPKILIMDEATSALDYESEQTILQNMPAIAKGRTVIVIAHRLNALQHCDNIIVLDKGEIAEQGTHSELVKSNGHYAELWQLQTTTNVPKAPVSSPTAFGLNASFKF
>NZ_CP048878.1|WP_163836555.1|4640279_4641662_-|HlyD-family-type-I-secretion-periplasmic-adaptor-subunit
MGSHLKTAAAAYQQLKNEPEPIKRQRHEYEFLPAYLEVTDKPPAPLSRKIAWGICGLLLLAVLWASLGHIDIIASATGKIMVSSRTKVIQPLETAVISAIHVRDGQSVKKGDVLIELNPTGAVADTQRLKEQLLFAQLDAARLRALLSDEPKQNFIPPKDALSNQVEEAEQLMMSQYGEKQAIKKTYASEIKQNQAQQSSTQTELTSRKKVLKSINKRLSAQHSLVKRDAFPKIQYLELEEEKLQLESDLAVLESRLLELKAAAVNIIDRRNQAVFERERQWRQQLSEAEKTISQSQQELIKAKERARLQTLVAPVTGVVQELAVHTIGGVVSPAQTLMVVVPEDALLEAEALVLNKDVGFVIPGQEVEIKIDSFPYTKYGTIRGVISNVSRDAVENEQLGLVFPARVEMETDQIMVDGHAINLAPGMTITAEIKTGERRVIEYLLSPLQEYQSEALKER
>NZ_CP048878.1|WP_163834883.1|4641683_4643819_-|type-I-secretion-system-permease/ATPase
MKYQPEAEANQTTLTALQGMLTISVLLQAVQDPKQYEAQLEKLAELPIKQATKQFARQLQLSIKLKTAKAEKIAGLELPLLFLSSAGEYCLLLKLNDKQALIQRPSVGRPEVLEITELQELWQGQIIAVSSKLVADGSKRKFDISWFIPEFIRHRKLLKEVIIAAFFLQVVALVSPLFFQVVMDKVLVHQALSTLDVLVIVLVIVAVFEIVLKGLREYLFAHTTTRIDAQLGSQLFKHLLNLPLIYFKSRSVGVTVMRIRELDTIREFITGAGLTLLVDLTFTVVFFAVMYYYSFFLATLVLLSVPLYIGLSVLITNPLQKRIENLFQCGAINNAFLTETVSGVETVKSLSLEPQLQRRWESQTHDYVKANYQVQWLQVLASQGVQIIQKVTMVLVLWFGARMVIDLELSIGQLIAFNMMANHVSQPVIRLAELWQQFVQARVSVDRLGDVLNTVPEQNNTSSQLLEKPKGRIDIDNVTFRYRPDLPPVINTMSLTIQPGELIGVVGPSGSGKSTLTKLIQRLYIPERGRVLLDGQDIRQLNPNSMRSHIGVVLQENYLFNRTVRDNIALSQPAATMDQVMNAAKLAGAHEFIIELPDGYDTVLAENGSSLSGGQRQRVAIARALLNDPAILIFDEATSALDDISQAVIQENMVDICKGRTVIVIAHRLSTVKACDRIIAVDKGQIVEAGSHSELMATNGCYAKLWSMQRV
>NZ_CP048878.1|WP_163834884.1|4644359_4644857_+|cyclic-pyranopterin-monophosphate-synthase-MoaC
MEKPNQALTHIDQQGNAQMVDVTDKPPTHRLARAQSVITMQPATLEMIMAGTHKKGDVLAVARIAGIQAAKRCSDIIPLCHPLMLTSVNVQLLPEPEQQQVRVIAECKVTGQTGVEMEALTAASAATLTLYDMCKAVDRGMVIQETKLLEKQGGRSGHWQAEESQ
>NZ_CP048878.1|WP_163834885.1|4644853_4645099_+|molybdopterin-synthase-sulfur-carrier-subunit
MIKVLFFGRLREQLAMDAIELTDEAQSLTAIIEQLKLRGDNWQKALSNPNLKAAVNQTMVPFSSPVKAGDEVAFFPPVTGG
>NZ_CP048878.1|WP_163834886.1|4645102_4645549_+|molybdenum-cofactor-biosynthesis-protein-MoaE
MISIQQAPFDINTFDQTLRENSPKVGAIATFCGLVRDFSERPDVTAIYLEHYPGMTEKVLDELIEEAKQRWSIIDAIICHRVGKLSLGESIVYVGVASAHRKAAFAACEFLIDKLKTTAPFWKKEITSDGEHWVDERDKDQQSAAEWD
>NZ_CP048878.1|WP_163834887.1|4646339_4649282_+|hypothetical-protein
MAKHVLPLTLALGLSHLTTAVWAANQAPITQGHSETISKPGMHNSWVWAQDVDKDALTYKVVNQPKFGQVKMDPNTGKFTYTPTSTVAYDEFYYQVTDTTGQNSNKSVVQLNFDHEGQTSQPTNTTDSSQNCKVSGTVTGLDPETTAKITIASDTTLKTKAVTGNGSFCFEQYSNSATIHAYAPGYEVQNSSRKVTSGNTNFNFVKTPACEDGYSSCFKWEDSEESTSEYQSYINKKQTITFSNQTIEIVDNSAANALLHDYNIALIDTPDNAWSLEHASRLLNTIRMIPQPKRNSYGEQKLTPSVWEITDKALTDDVEVITEGKTKKIRINEKTFVNAAPRLVEIDGVKGRFFSKRLHHALVNVVTDFGNDSAAVEKIMKERFGVSLKANISQLTAGTTNESDNYFQPFLPREKVKLINIFEDMPTGMHKIEGLTHLVRRKNGMENPLYPSLAAIAWHSGENSSGNGYIEFMEKAFAHNADDFVHRLIVHEKAHYIYGKVINGQTRSDWAEVGGWYVDPNDKDGWSTSKQTEFVSAYAHTKNPNEDMAESIAYYILNPDKLRSRSPKKFDFIQKRIMKGSQYLSIIDQDMTFEVLNLYPDYIYPGKIKNVEIGVTTENNGDKKVHVTVKLHAKDSQLEGATETNVRVYSQIGTFKDFSLKPVDQSGAPAKVSTILTGSFVLDKNAPQGYWRPDQIALNDLNGNERFSGANDFGWKLYIDNANSDTTPPAYVPNSLTLNVTQDHNSYAEPVNKITAEWRVAEAVGMAETDPCFGSMKHGSAKLYSIGKHGGFNETSNTCKLVYIMPNYMASGAYSMSEVVMKDKALNWGRFNFHGSERSRQVTLTSTNPDTQPPVLNLNQISVSATPVNPSNPNGETIVTINYQVSDNISGFDYARIKLRDPQGVTHEFFHQPNNDGRLFFEGNPNTAKVYTKKIHLPAGSAPGIWGVTEISVYDMASNYQNHNFAETVLVEPTFNVSNN
>NZ_CP048878.1|WP_163836556.1|4649351_4649990_-|maleylacetoacetate-isomerase
MNLYSYWRSSAAYRVRIALNWKGLPYKTIPVHLVKEGGQQHQSSYKELNPQELVPTIQLDGMTLGQSMAILEYLEEHYPERPLLPADNAERAAIRAFALAIACDIHPLNNLRVLQYLTNQIGVDEQTKQQWYSHWVINGFSALEAQLTNTAGTFCFGDEFSLADVVLIPQVYNAHRFNIALNDFPNISRIYDNGLSVPAVQNAAPEVQPDAE
>NZ_CP048878.1|WP_163834888.1|4649994_4650984_-|fumarylacetoacetate-hydrolase-family-protein
MKLASIKNNSRDGQLVVVNKQLTEAVAVPEIVNTLQQALDNWQQTEPALQEIYQALNKGSLKNTLLFDQRQALSPLPRAYQWADGSAYVNHVELVRKARGAEMPESFWTDPLMYQGGSDAFLAPYAPIEMADTNWGIDFEAEIAVVTDDVQMGVTPEQAAGHIKLFMLVNDVSLRNLIPGELAKGFGFFQSKPSSAFSPVAITPDELDDSWDGKKVHLPLHSKLNNEFFGAPEAGVDMTFDFPTLVAHAAKTRPLSAGAIIGSGTVSNYDRSKGSSCLAEKRMLEVIEQGKAVTPFMQYGDSIRIEMFDKSGQSIFGAIEQVVSPYKGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233650-3233679	0	1.0
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233722-3233751	0	1.0
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233770-3233799	0	1.0
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233794-3233823	0	1.0
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233818-3233847	0	1.0
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233650-3233679	0	1.0
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233722-3233751	0	1.0
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233770-3233799	0	1.0
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233794-3233823	0	1.0
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233818-3233847	0	1.0
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233638-3233655	0	1.0
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233710-3233727	0	1.0
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233602-3233631	1	0.967
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233674-3233703	1	0.967
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233746-3233775	1	0.967
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	4635951-4635980	1	0.967
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233602-3233631	1	0.967
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233674-3233703	1	0.967
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233746-3233775	1	0.967
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	4635951-4635980	1	0.967
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233614-3233631	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233662-3233679	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233686-3233703	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233734-3233751	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233758-3233775	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233782-3233799	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233806-3233823	1	0.944
NZ_CP048878_2	2.3\|4636071\|18\|NZ_CP048878\|CRT	4636071-4636088	18	NZ_CP048878.1	3233830-3233847	1	0.944
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233626-3233655	2	0.933
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP048878.1	3233698-3233727	2	0.933
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233626-3233655	2	0.933
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP048878.1	3233698-3233727	2	0.933

1. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233650-3233679, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

2. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233722-3233751, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

3. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233770-3233799, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

4. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233794-3233823, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

5. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233818-3233847, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

6. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233650-3233679, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

7. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233722-3233751, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

8. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233770-3233799, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

9. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233794-3233823, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

10. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233818-3233847, mismatch: 0, identity: 1.0

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttaggatcgggttt	Protospacer
******************************

11. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233638-3233655, mismatch: 0, identity: 1.0

gggttttgggtccggctt	CRISPR spacer
gggttttgggtccggctt	Protospacer
******************

12. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233710-3233727, mismatch: 0, identity: 1.0

gggttttgggtccggctt	CRISPR spacer
gggttttgggtccggctt	Protospacer
******************

13. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233602-3233631, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

14. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233674-3233703, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

15. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233746-3233775, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

16. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 4635951-4635980, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatctggcttaggatcgggttt	Protospacer
************.*****************

17. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233602-3233631, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

18. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233674-3233703, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

19. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233746-3233775, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatccggcttgggatcgggttt	Protospacer
******************.***********

20. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 4635951-4635980, mismatch: 1, identity: 0.967

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttggatctggcttaggatcgggttt	Protospacer
************.*****************

21. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233614-3233631, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

22. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233662-3233679, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

23. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233686-3233703, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

24. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233734-3233751, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

25. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233758-3233775, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

26. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233782-3233799, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

27. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233806-3233823, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

28. spacer 2.3|4636071|18|NZ_CP048878|CRT matches to position: 3233830-3233847, mismatch: 1, identity: 0.944

gggttttgggtccggctt	CRISPR spacer
gggttttggatccggctt	Protospacer
*********.********

29. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233626-3233655, mismatch: 2, identity: 0.933

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttgggtccggcttgggatcgggttt	Protospacer
*********.********.***********

30. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to position: 3233698-3233727, mismatch: 2, identity: 0.933

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttgggtccggcttgggatcgggttt	Protospacer
*********.********.***********

31. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233626-3233655, mismatch: 2, identity: 0.933

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttgggtccggcttgggatcgggttt	Protospacer
*********.********.***********

32. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to position: 3233698-3233727, mismatch: 2, identity: 0.933

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gggttttgggtccggcttgggatcgggttt	Protospacer
*********.********.***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	130506-130535	6	0.8
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	416330-416359	6	0.8
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP015038	Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence	130506-130535	6	0.8
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	416330-416359	6	0.8
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	AP013428	Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C57A-MedDCM-OCT-S39-C32	15102-15133	7	0.781
NZ_CP048878_2	2.1\|4635975\|30\|NZ_CP048878\|CRT	4635975-4636004	30	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	684668-684697	7	0.767
NZ_CP048878_2	2.2\|4636023\|30\|NZ_CP048878\|CRT	4636023-4636052	30	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	684668-684697	7	0.767
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	AJ629075	Cyanophage S-RSM88 partial x gene, ORF178, y gene, psbA gene and partial psbD gene	2370-2401	9	0.719
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	AJ630128	Bacteriophage S-PM2 complete genome	136676-136707	9	0.719
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	NC_006820	Synechococcus phage S-PM2, complete genome	136676-136707	9	0.719
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	LN828717	Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome	127132-127163	9	0.719
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	AY329638	Bacteriophage S-PM2 PsbA (psbA), endonucelase VII (g49), hypothetical protein, and PsbD (psbD) genes, complete cds	1499-1530	9	0.719
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	NZ_KX426229	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.1, complete sequence	81207-81238	10	0.688
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	CP019144	Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence	111618-111649	10	0.688
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	41410-41441	10	0.688
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	NZ_CP026426	Acinetobacter sp. ACNIH1 plasmid pACI-df08, complete sequence	43482-43513	10	0.688
NZ_CP048878_1	1.2\|3442966\|32\|NZ_CP048878\|PILER-CR	3442966-3442997	32	NZ_CP032290	Acinetobacter lwoffii strain ED9-5a plasmid pALWED3.6, complete sequence	138582-138613	10	0.688

1. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to NZ_CP015038 (Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence) position: , mismatch: 6, identity: 0.8

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gcgatcgggatccggcaaaggatcgggttt	Protospacer
* * *. *********  ************

2. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gcgatcgggatccggcaaaggatcgggttt	Protospacer
* * *. *********  ************

3. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to NZ_CP015038 (Burkholderia cenocepacia strain 895 plasmid pBcp895-1, complete sequence) position: , mismatch: 6, identity: 0.8

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gcgatcgggatccggcaaaggatcgggttt	Protospacer
* * *. *********  ************

4. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gggttttggatccggcttaggatcgggttt	CRISPR spacer
gcgatcgggatccggcaaaggatcgggttt	Protospacer
* * *. *********  ************

5. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to AP013428 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G16, isolate: uvMED-CGR-C57A-MedDCM-OCT-S39-C32) position: , mismatch: 7, identity: 0.781

caaagataatgactaaaaaatac--tctgattca	CRISPR spacer
caaaggtaatgacaaaaaaatacaagttgttt--	Protospacer
*****.******* *********   .** **

6. spacer 2.1|4635975|30|NZ_CP048878|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 7, identity: 0.767

gggttttggatccggcttaggatcgggttt	CRISPR spacer
tgtctttggatccggcttcggatcgaggat	Protospacer
 * .************** ******.*  *

7. spacer 2.2|4636023|30|NZ_CP048878|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 7, identity: 0.767

gggttttggatccggcttaggatcgggttt	CRISPR spacer
tgtctttggatccggcttcggatcgaggat	Protospacer
 * .************** ******.*  *

8. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to AJ629075 (Cyanophage S-RSM88 partial x gene, ORF178, y gene, psbA gene and partial psbD gene) position: , mismatch: 9, identity: 0.719

caaagataatgactaaaaaatactctgattca	CRISPR spacer
aaacacgaatgactaaactatactctgatttg	Protospacer
 ** .  **********  ***********..

9. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to AJ630128 (Bacteriophage S-PM2 complete genome) position: , mismatch: 9, identity: 0.719

caaagataatgactaaaaaatactctgattca	CRISPR spacer
aaacacgaatgactaaactatactctgatttg	Protospacer
 ** .  **********  ***********..

10. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to NC_006820 (Synechococcus phage S-PM2, complete genome) position: , mismatch: 9, identity: 0.719

caaagataatgactaaaaaatactctgattca	CRISPR spacer
aaacacgaatgactaaactatactctgatttg	Protospacer
 ** .  **********  ***********..

11. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to LN828717 (Synechococcus phage S-PM2 spontaneous deletion mutant, complete genome) position: , mismatch: 9, identity: 0.719

caaagataatgactaaaaaatactctgattca	CRISPR spacer
aaacacgaatgactaaactatactctgatttg	Protospacer
 ** .  **********  ***********..

12. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to AY329638 (Bacteriophage S-PM2 PsbA (psbA), endonucelase VII (g49), hypothetical protein, and PsbD (psbD) genes, complete cds) position: , mismatch: 9, identity: 0.719

caaagataatgactaaaaaatactctgattca	CRISPR spacer
aaacacgaatgactaaactatactctgatttg	Protospacer
 ** .  **********  ***********..

13. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to NZ_KX426229 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.1, complete sequence) position: , mismatch: 10, identity: 0.688

caaagataatgactaaaaaatactctgattca	CRISPR spacer
agattttaatgacaaaaaaataccctgatggt	Protospacer
 .*   ******* *********.*****

14. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to CP019144 (Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence) position: , mismatch: 10, identity: 0.688

caaagataatgactaaaaaatactctgattca	CRISPR spacer
agattttaatgacaaaaaaataccctgatggt	Protospacer
 .*   ******* *********.*****

15. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

caaagataatgactaaaaaatactctgattca	CRISPR spacer
agattttaatgacaaaaaaataccctgatggt	Protospacer
 .*   ******* *********.*****

16. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to NZ_CP026426 (Acinetobacter sp. ACNIH1 plasmid pACI-df08, complete sequence) position: , mismatch: 10, identity: 0.688

caaagataatgactaaaaaatactctgattca	CRISPR spacer
agattttaatgacaaaaaaataccctgatggt	Protospacer
 .*   ******* *********.*****

17. spacer 1.2|3442966|32|NZ_CP048878|PILER-CR matches to NZ_CP032290 (Acinetobacter lwoffii strain ED9-5a plasmid pALWED3.6, complete sequence) position: , mismatch: 10, identity: 0.688

caaagataatgactaaaaaatactctgattca	CRISPR spacer
agattttaatgacaaaaaaataccctgatggt	Protospacer
 .*   ******* *********.*****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

68672 : 134902

Vibrio_phage(11.43%)

tRNA,integrase,capsid,tail,head,terminase,transposase,plate,protease,portal

attL 70595:70613|attR 133938:133956

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163830697.1\|68672_69647_-\|tRNA	methionyl-tRNA formyltransferase	M4QRX9	Synechococcus_phage	6.2e-05	29.0
WP_163830698.1\|69745_70255_-	peptide deformylase	E3SLL2	Synechococcus_phage	4.7e-20	43.4
70595:70613	attL	NA	NA	NA	NA
WP_163830699.1\|70853_71882_+	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	3.7e-08	61.4
WP_163836340.1\|71957_73130_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	1.1e-32	37.9
WP_163830700.1\|73251_73758_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.5e-22	40.4
WP_163830701.1\|73770_74325_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_163830702.1\|74560_75469_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_163830703.1\|75485_76304_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_163830704.1\|76709_77951_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163830705.1\|78664_79600_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163830706.1\|79797_80685_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_163830707.1\|80791_80980_+	hypothetical protein	NA	NA	NA	NA
WP_163830708.1\|80958_81330_+	hypothetical protein	NA	NA	NA	NA
WP_163830709.1\|81390_81699_+	hypothetical protein	NA	NA	NA	NA
WP_163830710.1\|81978_83220_-	restriction endonuclease	NA	NA	NA	NA
WP_163830711.1\|83316_83901_-	hypothetical protein	NA	NA	NA	NA
WP_163830712.1\|84023_85067_-	hypothetical protein	NA	NA	NA	NA
WP_163830713.1\|85313_86246_-	hypothetical protein	D4HTW7	Vibrio_phage	5.5e-51	38.5
WP_163830714.1\|86415_86883_-\|tail	tail fiber domain-containing protein	A4ZRC7	Synechococcus_virus	9.2e-07	35.5
WP_163830715.1\|87097_87301_-\|tail	phage tail protein	A0A193GYC8	Enterobacter_phage	6.8e-07	49.1
WP_163830716.1\|87269_87677_-\|tail	phage tail protein	E5E3U5	Burkholderia_phage	1.4e-14	33.1
WP_163830717.1\|87673_89674_-	hypothetical protein	A0A1J0GWA6	Alteromonas_phage	2.1e-31	40.2
WP_163830718.1\|89900_90173_-\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	1.5e-09	35.1
WP_163830719.1\|90233_90737_-\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	8.9e-32	41.1
WP_163830720.1\|90726_91887_-\|tail	phage tail protein	D4HTW1	Vibrio_phage	2.3e-131	58.7
WP_163830721.1\|91951_92722_-	hypothetical protein	K7R2Q5	Vibrio_phage	3.1e-07	25.0
WP_163830722.1\|92721_93252_-\|tail	phage tail protein	A2I2X8	Vibrio_virus	4.4e-21	38.3
WP_163830723.1\|93260_93872_-\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	2.0e-30	41.8
WP_163830724.1\|93899_94796_-\|plate	baseplate assembly protein	A0A088FQL4	Escherichia_phage	3.6e-76	52.2
WP_163830725.1\|94792_95128_-\|plate	phage baseplate protein	A0A088FV58	Escherichia_phage	3.2e-33	64.0
WP_163830726.1\|95198_95456_-	hypothetical protein	NA	NA	NA	NA
WP_163830727.1\|95542_96115_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	2.7e-24	41.2
WP_163830728.1\|96089_96950_-	hypothetical protein	NA	NA	NA	NA
WP_163830729.1\|96942_97353_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_163830730.1\|97342_97663_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	7.7e-13	40.6
WP_163830731.1\|97659_97968_-\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	4.6e-15	39.4
WP_163830732.1\|98112_98304_+	hypothetical protein	NA	NA	NA	NA
WP_163830733.1\|98350_99562_-\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	5.5e-112	52.1
WP_163830734.1\|99566_100217_-\|head,protease	HK97 family phage prohead protease	Q8HAD3	Salmonella_phage	5.9e-60	58.0
WP_163830735.1\|100203_101412_-\|portal	phage portal protein	Q8HAD4	Salmonella_phage	3.6e-111	50.1
WP_163830736.1\|101408_103103_-\|terminase	terminase large subunit	G3EN96	Psychrobacter_phage	9.3e-182	54.7
WP_163830737.1\|103099_103558_-\|terminase	phage terminase small subunit P27 family	A0A0R6PKJ2	Moraxella_phage	1.1e-39	50.7
WP_163830738.1\|103719_104085_-	HNH endonuclease	Q8W6N0	Burkholderia_virus	1.6e-22	44.4
WP_163830739.1\|104239_104974_-	phage repressor protein/antirepressor Ant	A0A0A8WIE3	Clostridium_phage	4.8e-34	37.9
WP_163830740.1\|105045_105267_-	hypothetical protein	NA	NA	NA	NA
WP_163830741.1\|105583_106741_+	hypothetical protein	NA	NA	NA	NA
WP_163830742.1\|106812_107205_-	hypothetical protein	NA	NA	NA	NA
WP_163830743.1\|107173_107353_-	hypothetical protein	NA	NA	NA	NA
WP_163830744.1\|107336_107759_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	9.8e-40	58.1
WP_163830745.1\|107761_107935_-	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_163830746.1\|108109_108430_-	XRE family transcriptional regulator	A0A0D5BHH6	Escherichia_phage	1.8e-09	35.7
WP_163830747.1\|108583_108973_-	hypothetical protein	NA	NA	NA	NA
WP_163830748.1\|109068_109626_-	hypothetical protein	NA	NA	NA	NA
WP_163836341.1\|109865_110183_-	hypothetical protein	R9TNL4	Vibrio_phage	2.1e-26	53.9
WP_163830749.1\|110358_110622_-	hypothetical protein	NA	NA	NA	NA
WP_163830750.1\|110618_110978_-	recombinase	NA	NA	NA	NA
WP_163830751.1\|111762_112173_-	hypothetical protein	NA	NA	NA	NA
WP_163830752.1\|112297_113026_-	Replication protein P	B5WZY0	Pseudomonas_phage	4.9e-39	45.5
WP_163830753.1\|113028_113340_-	hypothetical protein	NA	NA	NA	NA
WP_163830754.1\|113344_113875_-	winged helix-turn-helix transcriptional regulator	H9C164	Pectobacterium_phage	3.7e-12	39.0
WP_163830755.1\|114465_114885_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163830756.1\|115130_115571_+	hypothetical protein	NA	NA	NA	NA
WP_163830757.1\|115540_116047_+	recombination-associated protein RdgC	NA	NA	NA	NA
WP_163830758.1\|116049_116250_+	hypothetical protein	NA	NA	NA	NA
WP_163830759.1\|116357_116573_+	hypothetical protein	NA	NA	NA	NA
WP_163830760.1\|116593_116995_+	hypothetical protein	NA	NA	NA	NA
WP_163830761.1\|116997_117333_+	carbon storage regulator	NA	NA	NA	NA
WP_163830762.1\|117349_117754_+	hypothetical protein	NA	NA	NA	NA
WP_163830763.1\|117789_118710_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_163836342.1\|119071_119464_+	cytochrome c5 family protein	NA	NA	NA	NA
WP_163830764.1\|125368_126412_+	ADP-ribosylglycohydrolase family protein	G3M9X5	Bacillus_virus	4.3e-12	26.4
WP_163830765.1\|126516_127008_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163830766.1\|127035_128355_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_163830767.1\|128369_129071_-	response regulator transcription factor	NA	NA	NA	NA
WP_163830768.1\|129342_129696_+	VOC family protein	NA	NA	NA	NA
WP_163830769.1\|129682_130345_-	DUF4360 domain-containing protein	NA	NA	NA	NA
WP_163830770.1\|130697_131834_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163830771.1\|131948_132368_-	hypothetical protein	NA	NA	NA	NA
WP_163836343.1\|133212_133944_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_163836344.1\|134119_134902_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.3e-10	28.0
133938:133956	attR	NA	NA	NA	NA

DBSCAN-SWA_2

395384 : 428497

Morganella_phage(33.33%)

transposase,integrase,protease

attL 410018:410077|attR 428663:428730

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163830705.1\|395384_396320_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163831092.1\|396428_396677_+	hypothetical protein	NA	NA	NA	NA
WP_163831093.1\|396832_397396_+	cysteine hydrolase	NA	NA	NA	NA
WP_163831095.1\|397411_397855_+	hypothetical protein	NA	NA	NA	NA
WP_163830996.1\|397917_399063_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_163831097.1\|399322_400123_+	hypothetical protein	NA	NA	NA	NA
WP_163831099.1\|400202_400814_-	hypothetical protein	NA	NA	NA	NA
WP_163831101.1\|401375_401630_-	hypothetical protein	NA	NA	NA	NA
WP_163831103.1\|401795_402350_+	ribosomal protein S5-alanine N-acetyltransferase	NA	NA	NA	NA
WP_163831105.1\|402409_402976_+	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_163831107.1\|403065_404007_+	hypothetical protein	NA	NA	NA	NA
WP_163831109.1\|404165_404807_+	hypothetical protein	NA	NA	NA	NA
WP_163831111.1\|404902_406030_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_163831113.1\|406153_408382_+	AsmA family protein	NA	NA	NA	NA
WP_163831115.1\|408381_409443_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_163831117.1\|409483_409762_+	oxidative damage protection protein	NA	NA	NA	NA
410018:410077	attL	NA	NA	NA	NA
WP_163831119.1\|410542_411454_-	hypothetical protein	NA	NA	NA	NA
WP_163831121.1\|411619_412126_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163836355.1\|412164_412677_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163831123.1\|413575_413950_-	hypothetical protein	NA	NA	NA	NA
WP_163831124.1\|414183_414525_-	hypothetical protein	NA	NA	NA	NA
WP_163831126.1\|414538_414835_-	Bro-N domain-containing protein	NA	NA	NA	NA
WP_163831128.1\|416804_417215_-	hypothetical protein	NA	NA	NA	NA
WP_163831130.1\|417411_418119_-	hypothetical protein	A0A1W6JP13	Morganella_phage	9.0e-30	44.4
WP_163831132.1\|418381_419167_-	hypothetical protein	A0A0A8WIG2	Clostridium_phage	9.4e-28	36.6
WP_163831134.1\|419367_419988_-	PEP-CTERM sorting domain-containing protein	NA	NA	NA	NA
WP_163831136.1\|420217_420430_-	hypothetical protein	NA	NA	NA	NA
WP_163831138.1\|420537_420774_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163831140.1\|420872_421433_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	3.1e-41	71.5
WP_163831143.1\|421973_422981_-\|protease	serine protease	NA	NA	NA	NA
WP_163831145.1\|423340_425248_+	hypothetical protein	NA	NA	NA	NA
WP_163831147.1\|425256_425643_+	hypothetical protein	NA	NA	NA	NA
WP_163831148.1\|425685_426198_+	hypothetical protein	NA	NA	NA	NA
WP_163831150.1\|426485_427145_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_163831151.1\|427219_428497_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
428663:428730	attR	NA	NA	NA	NA

DBSCAN-SWA_3

901002 : 1010503

113

Pseudomonas_phage(43.33%)

integrase,capsid,tail,head,terminase,transposase,plate,protease,portal

attL 900925:900984|attR 1002684:1003716

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
900925:900984	attL	NA	NA	NA	NA
WP_163830705.1\|901002_901938_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163831816.1\|902303_904064_-	sulfatase-like hydrolase/transferase	A0A2K9L1A5	Tupanvirus	6.2e-120	41.6
WP_163831817.1\|904571_904727_+	hypothetical protein	NA	NA	NA	NA
WP_163831818.1\|905305_905737_+	flavin reductase	NA	NA	NA	NA
WP_163836380.1\|905869_906157_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163831819.1\|906506_907523_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_163831820.1\|907741_908740_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_163831821.1\|908764_909310_+	redoxin family protein	NA	NA	NA	NA
WP_163831822.1\|911209_911395_+	hypothetical protein	NA	NA	NA	NA
WP_163836381.1\|911706_911970_-	hypothetical protein	NA	NA	NA	NA
WP_163831823.1\|912488_912665_-	hypothetical protein	NA	NA	NA	NA
WP_163831824.1\|913273_913534_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|914446_915382_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163831825.1\|916058_916631_-	hypothetical protein	NA	NA	NA	NA
WP_163831826.1\|916638_917205_-	hypothetical protein	NA	NA	NA	NA
WP_163831827.1\|917494_917920_-	hypothetical protein	NA	NA	NA	NA
WP_163831828.1\|917916_918576_-	hypothetical protein	NA	NA	NA	NA
WP_163831829.1\|918585_920418_-	hypothetical protein	NA	NA	NA	NA
WP_163831830.1\|921095_921578_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163831831.1\|921834_922317_-	ester cyclase	NA	NA	NA	NA
WP_163831832.1\|922564_922987_-	response regulator	NA	NA	NA	NA
WP_163831833.1\|923614_924247_+	hypothetical protein	NA	NA	NA	NA
WP_163831834.1\|924342_924663_+	hypothetical protein	NA	NA	NA	NA
WP_163831835.1\|924729_925146_+	NUDIX hydrolase	NA	NA	NA	NA
WP_163831836.1\|925217_925589_+	hypothetical protein	NA	NA	NA	NA
WP_163831837.1\|925641_925938_+	hypothetical protein	NA	NA	NA	NA
WP_163836382.1\|926021_926294_+	hypothetical protein	NA	NA	NA	NA
WP_163831838.1\|926323_926581_+	hypothetical protein	NA	NA	NA	NA
WP_163831839.1\|926676_927048_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	2.9e-11	36.4
WP_163831840.1\|927066_927624_-	hypothetical protein	NA	NA	NA	NA
WP_163831841.1\|928527_929007_+	hypothetical protein	NA	NA	NA	NA
WP_163831842.1\|929074_929407_+	hypothetical protein	NA	NA	NA	NA
WP_163831843.1\|929478_930036_+	hypothetical protein	NA	NA	NA	NA
WP_163831844.1\|930113_930515_+	DUF4259 domain-containing protein	NA	NA	NA	NA
WP_163831845.1\|931059_931230_+	hypothetical protein	NA	NA	NA	NA
WP_163831846.1\|931237_931609_+	hypothetical protein	NA	NA	NA	NA
WP_163831847.1\|931734_932025_+	hypothetical protein	NA	NA	NA	NA
WP_163836383.1\|932309_933110_+	hypothetical protein	NA	NA	NA	NA
WP_163831848.1\|933113_933593_+	hypothetical protein	NA	NA	NA	NA
WP_163831849.1\|934054_934633_+	hypothetical protein	B5TRA6	Bacteroides_phage	1.9e-09	28.2
WP_163831850.1\|934638_934968_+	hypothetical protein	NA	NA	NA	NA
WP_163831851.1\|935495_935867_-	hypothetical protein	NA	NA	NA	NA
WP_163836384.1\|936113_937481_-	sodium:proton antiporter	NA	NA	NA	NA
WP_163831852.1\|937816_939001_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_163831853.1\|939000_939624_-	helix-turn-helix domain-containing protein	A0SML1	Pseudomonas_virus	4.8e-11	26.2
WP_163831854.1\|939790_940054_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163831855.1\|940070_942752_+	hypothetical protein	A0A0U3TH43	Pseudomonas_phage	4.9e-161	37.6
WP_163831856.1\|943143_943446_+	hypothetical protein	NA	NA	NA	NA
WP_163831857.1\|943459_943735_+	hypothetical protein	NA	NA	NA	NA
WP_163831858.1\|943767_943995_+	hypothetical protein	NA	NA	NA	NA
WP_163831859.1\|944385_944910_+	hypothetical protein	NA	NA	NA	NA
WP_163831860.1\|945245_945587_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163831861.1\|945843_946071_+	hypothetical protein	NA	NA	NA	NA
WP_163836385.1\|946089_946344_-	ogr/Delta-like zinc finger family protein	A5X9H0	Aeromonas_virus	1.4e-12	46.2
WP_163831862.1\|946431_947439_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	2.5e-73	43.7
WP_163831863.1\|947444_949196_-\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	3.9e-167	52.5
WP_163831864.1\|949203_949401_-	hypothetical protein	NA	NA	NA	NA
WP_163831865.1\|949399_950233_+\|capsid	capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	4.2e-26	38.8
WP_163831866.1\|950232_951243_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	7.4e-86	49.5
WP_163831867.1\|951308_951926_+	hypothetical protein	A0A0U4JEJ1	Pseudomonas_phage	3.4e-25	33.7
WP_163831868.1\|952043_952502_+\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_163831869.1\|952498_952954_+	hypothetical protein	NA	NA	NA	NA
WP_163831870.1\|952937_953600_+	virion morphogenesis protein	NA	NA	NA	NA
WP_163831871.1\|953604_954720_+	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	3.5e-113	55.2
WP_163831872.1\|954723_955182_+	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	9.6e-49	62.8
WP_163831873.1\|955215_955614_+	DUF882 domain-containing protein	A0A1D9C9S9	Salinivibrio_phage	7.1e-32	50.7
WP_163836386.1\|955639_956095_+	hypothetical protein	A0A2I7R241	Vibrio_phage	7.1e-36	51.7
WP_163831874.1\|956084_956351_+	hypothetical protein	NA	NA	NA	NA
WP_163831875.1\|956343_956628_+	hypothetical protein	NA	NA	NA	NA
WP_163831876.1\|956835_959007_+\|tail	phage tail tape measure protein	U3PFL8	Vibrio_phage	1.8e-121	55.8
WP_163831877.1\|959006_959333_+	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	3.4e-24	57.0
WP_163831878.1\|959316_960489_+	hypothetical protein	A0A0U4JJ14	Pseudomonas_phage	1.2e-127	57.0
WP_163831879.1\|960481_961078_+\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	1.2e-59	61.5
WP_163831880.1\|961108_962824_+\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	2.0e-59	45.5
WP_163831881.1\|962826_963705_+	hypothetical protein	NA	NA	NA	NA
WP_163831882.1\|963701_964280_+	DNA-binding protein	A0A0U4J942	Pseudomonas_phage	1.4e-28	44.1
WP_163831883.1\|964221_964905_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	8.7e-46	40.2
WP_163831884.1\|964898_965849_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	2.7e-61	42.0
WP_163831885.1\|965989_966412_-	hypothetical protein	NA	NA	NA	NA
WP_163831886.1\|966841_967453_-	hypothetical protein	NA	NA	NA	NA
WP_163831887.1\|968219_969263_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_163831888.1\|969259_970252_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_163831889.1\|972311_972599_-	hypothetical protein	NA	NA	NA	NA
WP_163831890.1\|972805_973138_+	hypothetical protein	NA	NA	NA	NA
WP_163831891.1\|973235_973673_+	hypothetical protein	NA	NA	NA	NA
WP_163831892.1\|974137_974716_+	hypothetical protein	B5TRA6	Bacteroides_phage	2.5e-09	28.3
WP_163831893.1\|974721_975051_+	hypothetical protein	NA	NA	NA	NA
WP_163831894.1\|976186_978310_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_163831895.1\|978313_978811_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_163831896.1\|978878_980216_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_163831897.1\|980231_981218_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_163831898.1\|981263_984806_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_163831899.1\|984882_985638_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_163831900.1\|985647_986403_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_163831901.1\|986485_989140_+	serine/threonine protein kinase	A0A1M7XUH0	Cedratvirus	4.0e-14	25.8
WP_163831902.1\|989235_990063_-\|protease	serine protease	G9E4M4	Emiliania_huxleyi_virus	1.1e-07	27.6
WP_163831903.1\|990736_991252_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_163831904.1\|991331_992126_-	hypothetical protein	NA	NA	NA	NA
WP_163831905.1\|992457_994533_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.7e-39	26.1
WP_163831906.1\|994567_995500_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_163831907.1\|995709_999831_+	RHS repeat protein	A0A2H4JFP5	uncultured_Caudovirales_phage	1.9e-34	42.5
WP_163831908.1\|999832_1000240_+	hypothetical protein	NA	NA	NA	NA
WP_163836387.1\|1000387_1000786_+	hypothetical protein	M1PY53	Moumouvirus	2.3e-06	33.0
WP_163831909.1\|1001037_1002018_+	DUF2156 domain-containing protein	NA	NA	NA	NA
WP_163831910.1\|1002030_1002495_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163830705.1\|1002761_1003697_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163831911.1\|1003769_1004030_-	hypothetical protein	NA	NA	NA	NA
1002684:1003716	attR	NA	NA	NA	NA
WP_163831912.1\|1004223_1006071_+	EAL domain-containing protein	NA	NA	NA	NA
WP_163831913.1\|1006258_1007011_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163831914.1\|1007101_1007440_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_163830641.1\|1007700_1007886_+	hypothetical protein	NA	NA	NA	NA
WP_163831915.1\|1008000_1009344_-	VWA domain-containing protein	A0A2D1GNA9	Pseudoalteromonas_phage	1.2e-14	30.3
WP_163830996.1\|1009357_1010503_-\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1038762 : 1113090

Diachasmimorpha_longicaudata_entomopoxvirus(20.0%)

tRNA,integrase,protease,transposase

attL 1046613:1046628|attR 1120093:1120108

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836388.1\|1038762_1039494_+\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
WP_163831942.1\|1039486_1040860_-	hypothetical protein	NA	NA	NA	NA
WP_163831943.1\|1040887_1041460_-\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_163831944.1\|1041643_1041931_-	hypothetical protein	NA	NA	NA	NA
WP_163831945.1\|1042069_1042813_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163831946.1\|1043025_1044810_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-51	33.1
WP_163831947.1\|1044964_1046209_-	hypothetical protein	NA	NA	NA	NA
1046613:1046628	attL	NA	NA	NA	NA
WP_163831948.1\|1046749_1047094_-	hypothetical protein	NA	NA	NA	NA
WP_163830996.1\|1047147_1048293_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_163830996.1\|1049639_1050785_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_163831949.1\|1051074_1051620_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_163831950.1\|1051775_1054118_+	phosphoenolpyruvate synthase	NA	NA	NA	NA
WP_163831951.1\|1054089_1055565_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_163831952.1\|1055538_1056156_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_163831953.1\|1056326_1056578_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_163831954.1\|1056588_1057311_-	GGDEF domain-containing protein	NA	NA	NA	NA
WP_163831955.1\|1057359_1057788_-	hypothetical protein	NA	NA	NA	NA
WP_163831956.1\|1059630_1060266_+	VCBS repeat-containing protein	NA	NA	NA	NA
WP_163831957.1\|1060469_1061456_-	YHYH protein	NA	NA	NA	NA
WP_163831958.1\|1061707_1063294_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_163831959.1\|1063905_1065474_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_163831960.1\|1065952_1067473_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_163831961.1\|1067801_1069169_+	HlyD family secretion protein	NA	NA	NA	NA
WP_163831962.1\|1069165_1072264_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_163831963.1\|1072542_1074984_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.2e-19	33.1
WP_163831964.1\|1074996_1075743_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163831965.1\|1075912_1079050_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_163831966.1\|1079088_1080252_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_163831967.1\|1080486_1080969_+	hypothetical protein	NA	NA	NA	NA
WP_163831968.1\|1081102_1081909_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163831969.1\|1081999_1082401_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_163831970.1\|1082448_1083174_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_163831971.1\|1083293_1083989_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_163831972.1\|1084384_1085038_+	RNA ligase family protein	A0A292GKV8	Xanthomonas_phage	3.5e-60	51.5
WP_163831973.1\|1085040_1085865_+	HD domain-containing protein	NA	NA	NA	NA
WP_163836389.1\|1085952_1087023_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163831974.1\|1087259_1088693_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_163831975.1\|1089017_1090043_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
WP_163831976.1\|1090108_1091611_-	DUF4173 domain-containing protein	NA	NA	NA	NA
WP_163831977.1\|1091753_1094591_-	hypothetical protein	NA	NA	NA	NA
WP_163831978.1\|1095067_1095700_+	hypothetical protein	NA	NA	NA	NA
WP_163831979.1\|1097873_1099157_-	OprD family porin	NA	NA	NA	NA
WP_163831980.1\|1099459_1099897_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_163831981.1\|1100133_1101228_-	peptidase M42	NA	NA	NA	NA
WP_163831982.1\|1101375_1102737_-	dicarboxylate/amino acid:cation symporter	NA	NA	NA	NA
WP_163831983.1\|1102893_1103916_-	DUF21 domain-containing protein	NA	NA	NA	NA
WP_163831984.1\|1104204_1105830_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_163831985.1\|1105834_1106752_-	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	6.5e-12	33.6
WP_163831986.1\|1106779_1107592_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_163831987.1\|1107624_1108506_-	hypothetical protein	NA	NA	NA	NA
WP_163831988.1\|1108757_1110161_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_163831989.1\|1110242_1110662_+	GFA family protein	NA	NA	NA	NA
WP_163831990.1\|1110769_1112101_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_163831991.1\|1112097_1113090_-\|integrase	site-specific integrase	M1HMA3	Pelagibacter_phage	4.4e-30	33.9
1120093:1120108	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1129636 : 1144167

Ralstonia_phage(40.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832013.1\|1129636_1130092_-	hypothetical protein	A0A2R2ZGD5	Ralstonia_phage	6.9e-15	32.4
WP_163832014.1\|1130188_1130506_+	STAS domain-containing protein	NA	NA	NA	NA
WP_163832015.1\|1130818_1130959_-	hypothetical protein	NA	NA	NA	NA
WP_163832016.1\|1131007_1131331_+	STAS domain-containing protein	NA	NA	NA	NA
WP_163832017.1\|1131335_1134101_-	hypothetical protein	L7TLW2	Rhizobium_phage	1.0e-145	33.5
WP_163832018.1\|1134100_1134631_-	hypothetical protein	A0A076YQK3	Mesorhizobium_phage	8.3e-20	37.6
WP_163832019.1\|1134715_1134943_+	hypothetical protein	NA	NA	NA	NA
WP_163832020.1\|1134983_1136021_-	hypothetical protein	M1HMB6	Pelagibacter_phage	2.2e-32	30.5
WP_163832021.1\|1136086_1136767_-	hypothetical protein	E3SQM5	Cyanophage	3.3e-21	36.3
WP_163832022.1\|1136770_1138315_-\|tail	phage tail protein	A0A2R2ZGG8	Ralstonia_phage	5.0e-126	49.4
WP_163832023.1\|1138318_1138552_-	hypothetical protein	NA	NA	NA	NA
WP_163832024.1\|1138551_1138737_-	hypothetical protein	NA	NA	NA	NA
WP_163832025.1\|1138736_1138874_-	hypothetical protein	NA	NA	NA	NA
WP_163832026.1\|1138873_1139032_-	hypothetical protein	NA	NA	NA	NA
WP_163832027.1\|1139024_1139564_-	DUF3310 domain-containing protein	A0A1D8KUM9	Synechococcus_phage	2.7e-10	38.4
WP_163832028.1\|1139650_1140487_-	exonuclease	A0A2R2ZGE9	Ralstonia_phage	5.3e-53	43.4
WP_163832029.1\|1140476_1140656_-	hypothetical protein	NA	NA	NA	NA
WP_163832030.1\|1140670_1140865_-	M20 family metallo-hydrolase	NA	NA	NA	NA
WP_163832031.1\|1141045_1141417_-	hypothetical protein	NA	NA	NA	NA
WP_163832032.1\|1141596_1142025_-	cell wall hydrolase	A0A218MLD1	uncultured_virus	5.5e-22	42.8
WP_163832033.1\|1142071_1142293_+	hypothetical protein	NA	NA	NA	NA
WP_163832034.1\|1142289_1144167_-	DNA polymerase	A0A2R2ZGG6	Ralstonia_phage	4.2e-151	45.2

DBSCAN-SWA_6

1213313 : 1239698

Synechococcus_phage(50.0%)

transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836393.1\|1213313_1213721_-\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	5.2e-14	47.2
WP_163832098.1\|1215401_1217045_-	hypothetical protein	NA	NA	NA	NA
WP_163832099.1\|1217650_1218433_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832100.1\|1218626_1219493_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832101.1\|1220252_1221458_+	ricin-type beta-trefoil lectin domain protein	NA	NA	NA	NA
WP_163832102.1\|1222018_1222357_+	hypothetical protein	NA	NA	NA	NA
WP_163832103.1\|1222420_1223227_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_163832104.1\|1223623_1224352_+	DsbC family protein	NA	NA	NA	NA
WP_163832105.1\|1224937_1225438_+	DUF4234 domain-containing protein	NA	NA	NA	NA
WP_163832106.1\|1225512_1225665_-	hypothetical protein	NA	NA	NA	NA
WP_163832107.1\|1225928_1226186_-	hypothetical protein	NA	NA	NA	NA
WP_163832108.1\|1226230_1226425_-	hypothetical protein	NA	NA	NA	NA
WP_163832109.1\|1227075_1227678_-	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_163832110.1\|1227789_1227942_-	hypothetical protein	NA	NA	NA	NA
WP_163832111.1\|1228265_1228433_+	hypothetical protein	NA	NA	NA	NA
WP_163832112.1\|1228972_1229740_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163832113.1\|1229726_1230515_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163832114.1\|1230810_1231119_-	hypothetical protein	NA	NA	NA	NA
WP_163832115.1\|1231261_1231741_-\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	1.3e-16	48.1
WP_163832116.1\|1232747_1233230_-	hypothetical protein	NA	NA	NA	NA
WP_163836389.1\|1233679_1234750_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163832117.1\|1235493_1236054_+	hypothetical protein	NA	NA	NA	NA
WP_163832118.1\|1236228_1236993_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832119.1\|1237467_1237665_-	hypothetical protein	NA	NA	NA	NA
WP_163832120.1\|1238022_1238334_-	hypothetical protein	NA	NA	NA	NA
WP_163832121.1\|1238553_1239000_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.2e-33	50.0
WP_163836394.1\|1238972_1239368_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	5.6e-13	37.6
WP_163832122.1\|1239518_1239698_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1244348 : 1329070

106

Vibrio_phage(15.38%)

integrase,capsid,tail,head,terminase,transposase,plate,portal

attL 1258736:1258759|attR 1329272:1329295

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832128.1\|1244348_1244672_+\|transposase	transposase	NA	NA	NA	NA
WP_163836395.1\|1245166_1245475_+	DUF2007 domain-containing protein	NA	NA	NA	NA
WP_163832129.1\|1245763_1247572_+	hypothetical protein	NA	NA	NA	NA
WP_163832130.1\|1247586_1248249_+	hypothetical protein	NA	NA	NA	NA
WP_163832131.1\|1248700_1249066_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_163832132.1\|1249148_1250984_+	DUF1631 domain-containing protein	NA	NA	NA	NA
WP_163832133.1\|1252172_1253072_-	DUF2167 domain-containing protein	NA	NA	NA	NA
WP_163836355.1\|1253097_1253610_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163831121.1\|1253648_1254155_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163832134.1\|1254637_1254913_-	RNA-binding protein	NA	NA	NA	NA
WP_163832135.1\|1255344_1255848_+	DUF4234 domain-containing protein	NA	NA	NA	NA
WP_163832136.1\|1256339_1257026_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832137.1\|1257185_1258337_-\|integrase	tyrosine-type recombinase/integrase	I6PDJ1	Cronobacter_phage	5.6e-45	33.1
WP_163836396.1\|1258343_1258535_-	excisionase	NA	NA	NA	NA
1258736:1258759	attL	NA	NA	NA	NA
WP_163832138.1\|1258740_1259076_-	hypothetical protein	NA	NA	NA	NA
WP_163832139.1\|1259174_1259645_+	hypothetical protein	W6MVG8	Pseudomonas_phage	2.4e-23	46.7
WP_163832140.1\|1259669_1260149_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	1.4e-18	43.2
WP_163832141.1\|1260417_1260642_+	hypothetical protein	NA	NA	NA	NA
WP_163832142.1\|1260720_1261218_-	hypothetical protein	NA	NA	NA	NA
WP_163832143.1\|1261487_1262012_-	hypothetical protein	NA	NA	NA	NA
WP_163832144.1\|1262696_1263752_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|1263998_1264934_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163836355.1\|1265105_1265618_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163832145.1\|1265656_1266163_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163830705.1\|1266945_1267881_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163832146.1\|1268170_1268395_+	hypothetical protein	NA	NA	NA	NA
WP_163832147.1\|1268802_1269048_+	hypothetical protein	NA	NA	NA	NA
WP_163832145.1\|1269101_1269608_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163836397.1\|1269646_1270159_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163832148.1\|1270359_1271232_-	PDZ domain-containing protein	NA	NA	NA	NA
WP_163832149.1\|1271563_1272292_+	DsbC family protein	NA	NA	NA	NA
WP_163832150.1\|1272325_1272463_-	hypothetical protein	NA	NA	NA	NA
WP_163832151.1\|1272873_1275564_+	hypothetical protein	NA	NA	NA	NA
WP_163832152.1\|1276026_1276794_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832153.1\|1277076_1277313_+	hypothetical protein	NA	NA	NA	NA
WP_163832154.1\|1277853_1278198_+	hypothetical protein	NA	NA	NA	NA
WP_163832155.1\|1278235_1278475_+	hypothetical protein	NA	NA	NA	NA
WP_163832156.1\|1278588_1278951_+	hypothetical protein	NA	NA	NA	NA
WP_163832157.1\|1279073_1279604_+	RHS repeat-associated core domain-containing protein	NA	NA	NA	NA
WP_163832158.1\|1279603_1280254_+	hypothetical protein	NA	NA	NA	NA
WP_163832159.1\|1280572_1280956_-	hypothetical protein	NA	NA	NA	NA
WP_163832160.1\|1281020_1281410_-	DUF3574 domain-containing protein	M1PJL2	Synechococcus_phage	3.1e-08	35.6
WP_163832161.1\|1281476_1282412_-	hypothetical protein	D4HTW7	Vibrio_phage	1.1e-51	39.0
WP_163832162.1\|1282494_1283274_+	hypothetical protein	A0A2I7SAB9	Vibrio_phage	5.9e-06	28.0
WP_163832163.1\|1283262_1283466_-\|tail	phage tail protein	R9TR63	Vibrio_phage	2.0e-11	52.9
WP_163832164.1\|1283434_1283842_-\|tail	phage tail protein	E5E3U5	Burkholderia_phage	1.0e-14	32.8
WP_163832165.1\|1283838_1285839_-	hypothetical protein	A0A1J0GWA6	Alteromonas_phage	5.5e-32	40.2
WP_163832166.1\|1285942_1286215_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_163830719.1\|1286273_1286777_-\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	8.9e-32	41.1
WP_163832167.1\|1286766_1287963_-\|tail	phage tail protein	D4HTW1	Vibrio_phage	8.4e-129	57.8
WP_163832168.1\|1288023_1289340_-\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	4.4e-38	48.6
WP_163832169.1\|1289342_1290038_-\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	6.3e-36	42.0
WP_163832170.1\|1290042_1290939_-\|plate	baseplate assembly protein	A0A088FQL4	Escherichia_phage	3.3e-77	52.5
WP_163832171.1\|1290935_1291271_-	hypothetical protein	A0A088FV58	Escherichia_phage	4.1e-33	64.0
WP_163832172.1\|1291329_1291701_-	hypothetical protein	NA	NA	NA	NA
WP_163832173.1\|1291788_1292361_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.6e-24	41.2
WP_163832174.1\|1292335_1292863_-	hypothetical protein	Q8H9N6	Vibrio_phage	4.5e-10	24.2
WP_163832175.1\|1292855_1293383_-	hypothetical protein	NA	NA	NA	NA
WP_163832176.1\|1293379_1293706_-	hypothetical protein	NA	NA	NA	NA
WP_163832177.1\|1293702_1294725_-\|capsid	major capsid protein	Q6UYI3	Burkholderia_phage	8.7e-50	36.4
WP_163832178.1\|1294813_1295182_-\|head	head decoration protein	NA	NA	NA	NA
WP_163832179.1\|1295181_1296444_-	S49 family peptidase	A0A1I9KF73	Aeromonas_phage	1.3e-68	38.9
WP_163832180.1\|1296776_1296953_+	hypothetical protein	NA	NA	NA	NA
WP_163832181.1\|1297177_1298680_-\|portal	phage portal protein	A0A2D1GMV5	Marinobacter_phage	1.1e-114	48.1
WP_163832182.1\|1298679_1298880_-	hypothetical protein	NA	NA	NA	NA
WP_163832183.1\|1298876_1300343_-	hypothetical protein	A5LH27	Enterobacteria_phage	3.5e-129	49.0
WP_163830705.1\|1300367_1301303_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163832184.1\|1301376_1302006_-\|terminase	phage terminase large subunit family protein	A5LH27	Enterobacteria_phage	3.9e-61	51.3
WP_163832185.1\|1301968_1302139_-	DUF1441 family protein	NA	NA	NA	NA
WP_163832186.1\|1302092_1302422_-	DUF1441 family protein	A5LH26	Enterobacteria_phage	1.8e-09	37.4
WP_163832187.1\|1302742_1303462_-	phage antirepressor Ant	A0A0C5AEJ9	Bacteriophage	1.0e-36	39.7
WP_163832188.1\|1303729_1304020_+	hypothetical protein	NA	NA	NA	NA
WP_163832189.1\|1304008_1304251_-	hypothetical protein	NA	NA	NA	NA
WP_163832190.1\|1304262_1304670_-	hypothetical protein	A0A218MKV5	uncultured_virus	6.6e-09	43.8
WP_163832191.1\|1304737_1305199_-\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	7.0e-15	45.5
WP_163832192.1\|1305263_1305656_-\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	1.4e-16	50.0
WP_163832193.1\|1305837_1306230_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	5.1e-43	57.5
WP_163832194.1\|1306432_1306915_+	hypothetical protein	NA	NA	NA	NA
WP_163832195.1\|1306986_1307622_-	hypothetical protein	NA	NA	NA	NA
WP_163832196.1\|1307689_1308025_-	hypothetical protein	NA	NA	NA	NA
WP_163832197.1\|1308272_1308866_-	hypothetical protein	NA	NA	NA	NA
WP_163832198.1\|1308873_1309254_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	8.5e-27	51.6
WP_163832199.1\|1309260_1309431_-	hypothetical protein	NA	NA	NA	NA
WP_163832200.1\|1309789_1312012_-	DUF3987 domain-containing protein	A0A173H0P8	Pseudoalteromonas_phage	6.9e-84	38.7
WP_163832201.1\|1312356_1312794_+	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	3.5e-08	47.5
WP_163832202.1\|1312938_1313328_+	hypothetical protein	NA	NA	NA	NA
WP_163832203.1\|1313339_1314254_+	recombination-associated protein RdgC	M4MHA9	Vibrio_phage	1.6e-15	23.7
WP_163832204.1\|1314250_1314460_+	hypothetical protein	NA	NA	NA	NA
WP_163832205.1\|1314543_1314960_+	hypothetical protein	NA	NA	NA	NA
WP_163832206.1\|1314962_1315715_+	ATP-binding protein	B4UTW5	Rhizobium_phage	2.4e-41	39.5
WP_163832207.1\|1315726_1316305_+	DUF669 domain-containing protein	A0A2H4GYE1	Pseudomonas_phage	1.5e-19	33.8
WP_163832208.1\|1316502_1317543_+	oxidoreductase	A0A173H0P7	Pseudoalteromonas_phage	8.5e-85	48.2
WP_163832209.1\|1317539_1319165_+	DEAD/DEAH box helicase family protein	A0A172PZU9	Pseudomonas_phage	2.7e-98	38.8
WP_163832210.1\|1319154_1319388_+	hypothetical protein	NA	NA	NA	NA
WP_163832211.1\|1319397_1319703_+	hypothetical protein	NA	NA	NA	NA
WP_163832212.1\|1319713_1319908_+	excisionase	NA	NA	NA	NA
WP_163832213.1\|1319907_1321089_+	DUF3596 domain-containing protein	I6PDJ1	Cronobacter_phage	3.2e-64	37.2
WP_163832214.1\|1321081_1321276_+	hypothetical protein	NA	NA	NA	NA
WP_163832215.1\|1321652_1322294_+	GTP cyclohydrolase	A0A1V0SE20	Indivirus	4.5e-20	41.6
WP_163836398.1\|1322535_1323114_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_163832216.1\|1323110_1323686_-	hypothetical protein	NA	NA	NA	NA
WP_163832217.1\|1324518_1325022_+	YcxB family protein	NA	NA	NA	NA
WP_163832218.1\|1325710_1326103_+	hypothetical protein	NA	NA	NA	NA
WP_163832219.1\|1326156_1326486_+	hypothetical protein	NA	NA	NA	NA
WP_163832220.1\|1327324_1327876_+	hypothetical protein	NA	NA	NA	NA
WP_163832221.1\|1327915_1329070_-\|integrase	site-specific integrase	I6PDJ1	Cronobacter_phage	3.2e-69	39.0
1329272:1329295	attR	NA	NA	NA	NA

DBSCAN-SWA_8

1333113 : 1368304

Pseudomonas_phage(48.0%)

integrase,capsid,tail,head,terminase,portal

attL 1329674:1329687|attR 1369521:1369534

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1329674:1329687	attL	NA	NA	NA	NA
WP_163832230.1\|1333113_1334028_+	replication protein	S4TNJ9	Salmonella_phage	7.1e-11	39.6
WP_163832231.1\|1334038_1334782_+	Replication protein P	A0A1J0GUU6	Halomonas_phage	3.7e-18	31.0
WP_163832232.1\|1334778_1335006_+	hypothetical protein	NA	NA	NA	NA
WP_163832233.1\|1335244_1335580_-	bacteriophage CI repressor	NA	NA	NA	NA
WP_163832234.1\|1335819_1336020_+	hypothetical protein	NA	NA	NA	NA
WP_163832235.1\|1336043_1336298_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_163836399.1\|1336359_1337298_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	2.5e-72	44.2
WP_163832236.1\|1337387_1339136_-\|terminase	terminase	A0A0U4JIZ9	Pseudomonas_phage	1.5e-171	52.7
WP_163832237.1\|1339237_1339384_-	hypothetical protein	NA	NA	NA	NA
WP_163832238.1\|1339382_1340219_+\|capsid	capsid scaffolding protein	F1BUM4	Cronobacter_phage	5.1e-24	44.2
WP_163832239.1\|1340218_1341232_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	6.1e-88	48.9
WP_163832240.1\|1341231_1341906_+	hypothetical protein	A0A0U4JEJ1	Pseudomonas_phage	9.8e-26	35.0
WP_163832241.1\|1342018_1342477_+\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	5.9e-06	24.1
WP_163832242.1\|1342473_1342926_+	hypothetical protein	A0A0U4IBS7	Pseudomonas_phage	2.3e-18	34.7
WP_163832243.1\|1342909_1343572_+	virion morphogenesis protein	NA	NA	NA	NA
WP_163832244.1\|1343577_1344693_+	DUF2586 family protein	A0A0U4KLE6	Pseudomonas_phage	1.8e-112	54.4
WP_163832245.1\|1344696_1345143_+	DUF2597 family protein	A0A0U3TH58	Pseudomonas_phage	7.6e-51	64.4
WP_163832246.1\|1345145_1345520_+	peptidase M15	A0A218MM71	uncultured_virus	2.5e-31	51.6
WP_163832247.1\|1345523_1346006_+	hypothetical protein	A0A2I7R2B5	Vibrio_phage	1.5e-36	49.7
WP_163832248.1\|1345992_1346289_+	hypothetical protein	NA	NA	NA	NA
WP_163832249.1\|1346285_1346570_+	hypothetical protein	NA	NA	NA	NA
WP_163830642.1\|1346584_1346734_+	hypothetical protein	NA	NA	NA	NA
WP_163832250.1\|1346745_1348758_+\|tail	phage tail tape measure protein	A0A2I7RNI7	Vibrio_phage	4.0e-115	48.1
WP_163832251.1\|1348757_1349084_+	DUF2590 family protein	A0A0U4B0N5	Pseudomonas_phage	2.4e-22	56.0
WP_163832252.1\|1349067_1350240_+	hypothetical protein	A0A0U4JJ14	Pseudomonas_phage	1.0e-123	55.7
WP_163832253.1\|1350232_1350829_+\|tail	phage tail protein	A0A0U4JVX3	Pseudomonas_phage	3.5e-59	62.1
WP_163832254.1\|1350859_1352575_+\|tail	phage tail protein	A0A0U4K5K2	Pseudomonas_phage	1.1e-57	44.0
WP_163832255.1\|1352577_1353456_+	hypothetical protein	NA	NA	NA	NA
WP_163832256.1\|1353452_1354031_+	DNA-binding protein	A0A0U4J942	Pseudomonas_phage	4.8e-29	43.5
WP_163832257.1\|1353972_1354656_+	hypothetical protein	A0A2I7RNK1	Vibrio_phage	1.3e-46	40.7
WP_163832258.1\|1354649_1355600_+	hypothetical protein	A0A0U4IBV2	Pseudomonas_phage	1.8e-70	47.0
WP_163832259.1\|1355882_1356374_-	hypothetical protein	NA	NA	NA	NA
WP_163832260.1\|1356798_1357263_+	Hsp20 family protein	M4QDP7	Prochlorococcus_phage	1.3e-16	35.4
WP_163832261.1\|1357475_1358063_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_163832262.1\|1359807_1360029_+	hypothetical protein	NA	NA	NA	NA
WP_163832263.1\|1360151_1361024_+	hypothetical protein	NA	NA	NA	NA
WP_163832264.1\|1361020_1361254_+	hypothetical protein	NA	NA	NA	NA
WP_163832265.1\|1361246_1363007_+	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_163832266.1\|1363183_1363459_+	RNA-binding protein	NA	NA	NA	NA
WP_163832267.1\|1363978_1364254_-	RNA-binding protein	NA	NA	NA	NA
WP_163832268.1\|1364660_1365155_+	DUF4234 domain-containing protein	NA	NA	NA	NA
WP_163832269.1\|1365581_1366640_+	N-acetyltransferase	Q6SE88	Lactobacillus_prophage	1.1e-68	43.0
WP_163832270.1\|1366611_1366986_+	ASCH domain-containing protein	Q6SE87	Lactobacillus_prophage	2.2e-27	47.6
WP_163832271.1\|1367050_1368304_-\|integrase	tyrosine-type recombinase/integrase	I6PDJ1	Cronobacter_phage	2.2e-55	36.1
1369521:1369534	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1377853 : 1426751

Vibrio_phage(14.29%)

capsid,tail,head,terminase,plate,protease,portal,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832288.1\|1377853_1378171_+	hypothetical protein	R9TNL4	Vibrio_phage	7.9e-26	52.9
WP_163832289.1\|1378410_1378983_+	hypothetical protein	NA	NA	NA	NA
WP_163832290.1\|1379143_1379317_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_163832291.1\|1379319_1379742_+	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	5.4e-38	55.6
WP_163832292.1\|1379725_1379896_+	hypothetical protein	NA	NA	NA	NA
WP_163832293.1\|1379867_1380260_+	hypothetical protein	NA	NA	NA	NA
WP_163832294.1\|1380280_1380502_+\|holin	holin	NA	NA	NA	NA
WP_163832295.1\|1380574_1381306_+	phage repressor protein/antirepressor Ant	A0A067ZIN2	Vibrio_phage	1.7e-31	51.4
WP_163832296.1\|1381460_1381826_+	HNH endonuclease	Q8W6N0	Burkholderia_virus	2.5e-23	44.4
WP_163832297.1\|1381987_1382440_+\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	9.5e-41	52.1
WP_163832298.1\|1382436_1384134_+\|terminase	terminase large subunit	U5P0Q5	Shigella_phage	2.4e-185	55.6
WP_163832299.1\|1384130_1385339_+\|portal	phage portal protein	Q8HAD4	Salmonella_phage	1.2e-111	50.4
WP_163832300.1\|1385325_1385976_+\|head,protease	HK97 family phage prohead protease	Q8HAD3	Salmonella_phage	7.7e-60	57.5
WP_163832301.1\|1385980_1387192_+\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	2.5e-112	52.1
WP_163832302.1\|1387231_1387531_-	hypothetical protein	NA	NA	NA	NA
WP_163832303.1\|1387703_1388012_+\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	8.5e-17	42.3
WP_163832304.1\|1388008_1388329_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	2.5e-11	38.5
WP_163832305.1\|1388318_1388729_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_163832306.1\|1388721_1389582_+	hypothetical protein	NA	NA	NA	NA
WP_163832307.1\|1389556_1390129_+\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.9e-25	42.0
WP_163836400.1\|1390205_1390901_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.5e-08	35.7
WP_163832308.1\|1390937_1391273_+	hypothetical protein	A0A088FV58	Escherichia_phage	4.9e-34	64.9
WP_163832309.1\|1391269_1392166_+\|plate	baseplate assembly protein	A0A088FQL4	Escherichia_phage	2.8e-76	51.5
WP_163832310.1\|1392170_1392866_+\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	4.9e-36	42.0
WP_163832311.1\|1392868_1394185_+\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	7.5e-38	48.6
WP_163832312.1\|1394244_1395441_+\|tail	phage tail protein	D4HTW1	Vibrio_phage	8.4e-129	57.8
WP_163832313.1\|1395430_1395934_+\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	4.0e-32	41.8
WP_163832314.1\|1395993_1396266_+\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	3.4e-09	36.0
WP_163832315.1\|1396492_1398493_+	hypothetical protein	A0A1J0GWA6	Alteromonas_phage	5.5e-32	40.2
WP_163832316.1\|1398489_1398897_+\|tail	phage tail protein	E5E3U5	Burkholderia_phage	4.0e-14	33.1
WP_163832317.1\|1398865_1399069_+\|tail	phage tail protein	NA	NA	NA	NA
WP_163832318.1\|1399315_1400248_+	hypothetical protein	D4HTW7	Vibrio_phage	4.2e-51	38.5
WP_163832319.1\|1400643_1401240_+	two pore domain potassium channel family protein	NA	NA	NA	NA
WP_163832320.1\|1401347_1402193_+	hypothetical protein	NA	NA	NA	NA
WP_163832321.1\|1402741_1404139_-	PAAR domain-containing protein	NA	NA	NA	NA
WP_163832322.1\|1404246_1405125_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_163832323.1\|1405232_1405547_+	cupin domain-containing protein	NA	NA	NA	NA
WP_163832324.1\|1405762_1406002_-	hypothetical protein	NA	NA	NA	NA
WP_163832325.1\|1406346_1406706_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163832326.1\|1407388_1407865_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.5e-23	43.2
WP_163832327.1\|1408041_1409412_+	sodium-dependent transporter	NA	NA	NA	NA
WP_163832328.1\|1409458_1409890_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_163832329.1\|1409882_1410197_+	RnfH family protein	NA	NA	NA	NA
WP_163832330.1\|1410286_1410751_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_163832331.1\|1410842_1411244_+	ferric iron uptake transcriptional regulator	NA	NA	NA	NA
WP_163832332.1\|1411318_1413001_-	DNA repair protein RecN	NA	NA	NA	NA
WP_163832333.1\|1413268_1413901_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_163832334.1\|1414050_1415970_+	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	8.7e-152	53.5
WP_163832335.1\|1416102_1417254_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.7e-28	37.6
WP_163832336.1\|1417265_1418069_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_163832337.1\|1418388_1419519_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	8.1e-49	35.4
WP_163832338.1\|1419583_1422808_+	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
WP_163832339.1\|1422800_1423277_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_163832340.1\|1423334_1423640_-	ribosome assembly RNA-binding protein YhbY	NA	NA	NA	NA
WP_163832341.1\|1423927_1424548_+	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_163832342.1\|1424813_1426751_+\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	8.3e-118	43.4

DBSCAN-SWA_10

1480113 : 1489206

Vibrio_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832381.1\|1480113_1481943_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.3e-35	32.8
WP_163832382.1\|1482070_1483882_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	5.5e-63	33.1
WP_163832383.1\|1483991_1484441_-	GatB/YqeY domain-containing protein	A0A2I7SAL1	Vibrio_phage	2.9e-05	29.7
WP_163832384.1\|1484489_1484705_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_163832385.1\|1484924_1485956_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	4.0e-103	56.7
WP_163832386.1\|1486006_1486369_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_163832387.1\|1486383_1486881_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_163832388.1\|1486881_1488039_-\|tRNA	multifunctional CCA tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase	A0A2I7SAR1	Vibrio_phage	1.5e-58	56.0
WP_163832389.1\|1488058_1488388_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_163832390.1\|1488384_1489206_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	A0A291L9W7	Bordetella_phage	3.0e-08	30.4

DBSCAN-SWA_11

1659136 : 1726843

Bacillus_phage(37.5%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832512.1\|1659136_1660501_+\|protease	metalloprotease PmbA	NA	NA	NA	NA
WP_163832513.1\|1660807_1661680_-	TIGR02285 family protein	NA	NA	NA	NA
WP_163832514.1\|1661965_1662127_+	hypothetical protein	NA	NA	NA	NA
WP_163832515.1\|1662204_1663329_+	hypothetical protein	NA	NA	NA	NA
WP_163832516.1\|1663511_1664201_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163832517.1\|1664438_1664723_-	hypothetical protein	NA	NA	NA	NA
WP_163832518.1\|1665033_1665444_+	hypothetical protein	NA	NA	NA	NA
WP_163832519.1\|1665538_1666249_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163832520.1\|1666649_1666904_-	hypothetical protein	NA	NA	NA	NA
WP_163832521.1\|1667310_1668219_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_163832522.1\|1668529_1669006_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_163832523.1\|1669002_1669827_-	hypothetical protein	NA	NA	NA	NA
WP_163832524.1\|1670001_1670883_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_163832525.1\|1670892_1673016_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_163832526.1\|1673052_1674255_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_163832527.1\|1674268_1676269_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.4e-27	24.3
WP_163832528.1\|1676413_1676809_-	hypothetical protein	NA	NA	NA	NA
WP_163832529.1\|1676897_1677362_-	hypothetical protein	NA	NA	NA	NA
WP_163832530.1\|1678054_1678399_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_163832531.1\|1678454_1680923_-	DUF1631 domain-containing protein	NA	NA	NA	NA
WP_163832532.1\|1681703_1681895_-	DUF3094 family protein	NA	NA	NA	NA
WP_163832533.1\|1681976_1683158_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_163832534.1\|1683359_1685003_+	fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.2e-29	24.7
WP_163832535.1\|1685195_1686377_+	hypothetical protein	NA	NA	NA	NA
WP_163836410.1\|1686726_1687374_+	OmpA family protein	NA	NA	NA	NA
WP_163832536.1\|1687438_1687831_-	hypothetical protein	NA	NA	NA	NA
WP_163832537.1\|1687914_1688700_-	anti-sigma factor	NA	NA	NA	NA
WP_163832538.1\|1688696_1689203_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_163832539.1\|1689227_1689602_-	hypothetical protein	NA	NA	NA	NA
WP_163832540.1\|1690018_1690438_-	hypothetical protein	NA	NA	NA	NA
WP_163832541.1\|1690741_1691416_-	response regulator	W8CYM9	Bacillus_phage	8.0e-28	32.4
WP_163832542.1\|1691435_1692854_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.1e-22	26.4
WP_163832543.1\|1693407_1695225_+	hypothetical protein	NA	NA	NA	NA
WP_163832544.1\|1695287_1696199_-	acyltransferase	NA	NA	NA	NA
WP_163832545.1\|1696597_1698706_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_163832546.1\|1698714_1699929_-	acetate kinase	NA	NA	NA	NA
WP_163832547.1\|1700286_1700820_-	hypothetical protein	NA	NA	NA	NA
WP_163832548.1\|1700866_1701859_-	YHYH protein	NA	NA	NA	NA
WP_163832549.1\|1702209_1703769_-	hypothetical protein	NA	NA	NA	NA
WP_163832550.1\|1704323_1705592_+	hypothetical protein	NA	NA	NA	NA
WP_163832551.1\|1705678_1706524_+	hypothetical protein	NA	NA	NA	NA
WP_163832552.1\|1706835_1707477_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_163832553.1\|1707586_1707913_-	M23 family metallopeptidase	NA	NA	NA	NA
WP_163832554.1\|1708703_1709165_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_163832555.1\|1709218_1711015_-	EAL domain-containing protein	G3MA91	Bacillus_virus	9.0e-18	37.7
WP_163832556.1\|1711043_1711793_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|1711976_1712912_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163832557.1\|1712978_1713104_+	hypothetical protein	NA	NA	NA	NA
WP_163832558.1\|1713322_1714042_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_163832559.1\|1714390_1714597_+	hypothetical protein	NA	NA	NA	NA
WP_163832560.1\|1714659_1715435_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_163832561.1\|1716521_1718588_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	9.4e-11	21.7
WP_163832562.1\|1718588_1718990_+	GHKL domain-containing protein	W8CYF6	Bacillus_phage	3.1e-11	36.6
WP_163832563.1\|1718934_1719390_+	response regulator	NA	NA	NA	NA
WP_163832564.1\|1719402_1720080_-	arylesterase	NA	NA	NA	NA
WP_163832565.1\|1720078_1720795_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-30	38.2
WP_163832566.1\|1720787_1723286_+	ABC transporter permease	NA	NA	NA	NA
WP_163836411.1\|1723400_1724006_+	YIP1 family protein	NA	NA	NA	NA
WP_163831647.1\|1724482_1725784_-\|transposase	transposase	NA	NA	NA	NA
WP_163830705.1\|1725907_1726843_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1941155 : 1959874

Synechococcus_phage(100.0%)

transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163832560.1\|1941155_1941930_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_163832737.1\|1942023_1942536_-	hypothetical protein	NA	NA	NA	NA
WP_163832738.1\|1942538_1943225_-	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_163832739.1\|1944237_1944795_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_163832740.1\|1945109_1945466_-	hypothetical protein	NA	NA	NA	NA
WP_163832741.1\|1945910_1946456_+	hypothetical protein	NA	NA	NA	NA
WP_163832742.1\|1946474_1946774_-	TonB-dependent receptor	NA	NA	NA	NA
WP_163836424.1\|1946763_1947363_-	TonB-dependent receptor	NA	NA	NA	NA
WP_163832743.1\|1947428_1948208_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163832744.1\|1948656_1948839_+	sporulation protein	NA	NA	NA	NA
WP_163832668.1\|1948860_1949652_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_163832745.1\|1949864_1950011_+	hypothetical protein	NA	NA	NA	NA
WP_163832746.1\|1950196_1950982_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163832747.1\|1951467_1953072_-	oleate hydratase	NA	NA	NA	NA
WP_163832748.1\|1953626_1953827_-	hypothetical protein	NA	NA	NA	NA
WP_163832749.1\|1953877_1954117_-	hypothetical protein	NA	NA	NA	NA
WP_163832750.1\|1954257_1954857_+	hypothetical protein	NA	NA	NA	NA
WP_163832751.1\|1955050_1955182_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_163832752.1\|1955212_1955323_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_163836425.1\|1955406_1955907_-	RDD family protein	NA	NA	NA	NA
WP_163832753.1\|1955974_1956130_-	hypothetical protein	NA	NA	NA	NA
WP_163836426.1\|1956415_1956499_-\|transposase	transposase	NA	NA	NA	NA
WP_163832754.1\|1956769_1957573_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163832755.1\|1957607_1958207_-	hypothetical protein	NA	NA	NA	NA
WP_163832756.1\|1959445_1959874_+\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	5.5e-14	43.0

DBSCAN-SWA_13

2496221 : 2551890

uncultured_Caudovirales_phage(15.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163833196.1\|2496221_2497367_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_163833197.1\|2497905_2498958_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.2e-39	42.5
WP_163833198.1\|2499000_2499708_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_163833199.1\|2499766_2500531_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163833200.1\|2500755_2503086_+	response regulator	A0A1V0SGX0	Hokovirus	2.0e-73	32.8
WP_163833201.1\|2503107_2503923_-	hypothetical protein	NA	NA	NA	NA
WP_163833202.1\|2503919_2504936_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_163833203.1\|2504907_2506086_-	cupin domain-containing protein	NA	NA	NA	NA
WP_163833204.1\|2506082_2507453_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.7e-114	48.2
WP_163833205.1\|2507546_2508170_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_163833206.1\|2508199_2509297_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_163833207.1\|2509336_2509783_-	NUDIX hydrolase	NA	NA	NA	NA
WP_163833208.1\|2510170_2511430_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	2.3e-20	88.9
WP_163833209.1\|2511686_2511980_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-16	56.7
WP_163833210.1\|2512213_2512576_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.5e-12	44.4
WP_163833211.1\|2512602_2514867_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	3.5e-168	43.0
WP_027706826.1\|2514918_2515137_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_163833212.1\|2515454_2516162_-	arginyltransferase	NA	NA	NA	NA
WP_163833213.1\|2516158_2516875_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_163833214.1\|2517155_2519540_+	cell division protein FtsK	A0A218M9A2	Mycobacterium_phage	1.9e-87	49.7
WP_163833215.1\|2519566_2520199_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_163833216.1\|2520202_2521525_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	7.2e-81	42.0
WP_163836452.1\|2521551_2521935_+	fluoride efflux transporter CrcB	NA	NA	NA	NA
WP_163833217.1\|2521972_2523259_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-90	41.7
WP_163836453.1\|2523340_2524735_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_163833218.1\|2524768_2525104_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	2.5e-30	57.3
WP_163833219.1\|2525105_2525399_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_163833220.1\|2525403_2525760_-	sulfurtransferase complex subunit TusC	NA	NA	NA	NA
WP_163833221.1\|2525785_2526178_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	3.5e-31	50.4
WP_163833222.1\|2526264_2526936_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	6.3e-41	46.9
WP_163833223.1\|2527576_2528965_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_163833224.1\|2529245_2529968_+	VWA domain-containing protein	NA	NA	NA	NA
WP_163833225.1\|2530059_2530839_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_163833226.1\|2530857_2531211_+	hypothetical protein	NA	NA	NA	NA
WP_163833227.1\|2531228_2531711_+	CreA family protein	NA	NA	NA	NA
WP_163833228.1\|2531982_2532591_+	TerD family protein	A0A2I7QY07	Vibrio_phage	7.2e-36	41.1
WP_163833229.1\|2532663_2533749_+	hypothetical protein	NA	NA	NA	NA
WP_163833230.1\|2533760_2534219_+	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_163833231.1\|2534237_2535266_+	TerC/Alx family metal homeostasis membrane protein	A0A1D7XFL1	Escherichia_phage	3.6e-80	50.3
WP_163833232.1\|2535324_2535897_+	TerD family protein	K4JRX3	Caulobacter_phage	4.6e-32	41.7
WP_163833233.1\|2535948_2536527_+	TerD family protein	K4JRX3	Caulobacter_phage	5.6e-30	37.5
WP_163833234.1\|2536608_2537745_+	hypothetical protein	A0A172Q0Y1	Acinetobacter_phage	4.5e-23	27.7
WP_163833235.1\|2537747_2538506_+	hypothetical protein	NA	NA	NA	NA
WP_163833236.1\|2538507_2539617_+\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	3.1e-45	32.4
WP_163833237.1\|2539613_2540489_+	HpcH/HpaI aldolase/citrate lyase family protein	NA	NA	NA	NA
WP_163833238.1\|2540495_2540774_+	hypothetical protein	NA	NA	NA	NA
WP_163833239.1\|2540825_2541152_+	hypothetical protein	NA	NA	NA	NA
WP_163833240.1\|2541442_2541907_+	hypothetical protein	NA	NA	NA	NA
WP_163833241.1\|2541908_2542448_-	hypothetical protein	NA	NA	NA	NA
WP_163836454.1\|2542717_2543050_+	multidrug efflux SMR transporter	NA	NA	NA	NA
WP_163833242.1\|2543212_2543950_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	8.0e-29	33.8
WP_163833243.1\|2544122_2547191_-	ExeM/NucH family extracellular endonuclease	NA	NA	NA	NA
WP_163830705.1\|2548254_2549190_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163833244.1\|2549436_2550282_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_163832675.1\|2550744_2551890_+\|transposase	IS4 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2558232 : 2692239

171

Vibrio_virus(14.67%)

tRNA,integrase,capsid,tail,head,terminase,transposase,plate,protease,portal

attL 2621037:2621057|attR 2647106:2647126

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163833251.1\|2558232_2559231_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_163833252.1\|2559363_2560413_+\|integrase	site-specific integrase	S5MDN5	Escherichia_phage	7.2e-84	46.8
WP_163833253.1\|2560423_2560657_-	pyocin activator protein PrtN	A0A1D9C9N7	Salinivibrio_phage	1.8e-11	38.2
WP_163830705.1\|2560699_2561635_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163833254.1\|2561755_2561929_-	hypothetical protein	NA	NA	NA	NA
WP_163833255.1\|2561963_2562194_-	hypothetical protein	NA	NA	NA	NA
WP_163833256.1\|2562262_2562601_-	hypothetical protein	NA	NA	NA	NA
WP_163833257.1\|2562658_2563525_-	recombination protein RecT	Q858E1	Salmonella_phage	6.0e-68	53.3
WP_163833258.1\|2563585_2564587_-	hypothetical protein	A6XMH8	Bacillus_virus	5.9e-43	36.3
WP_163833259.1\|2564588_2564915_-	hypothetical protein	NA	NA	NA	NA
WP_163833260.1\|2565287_2565914_-	helix-turn-helix domain-containing protein	Q8W648	Enterobacteria_phage	5.0e-24	38.4
WP_163833261.1\|2566033_2566285_+	Cro/Cl family transcriptional regulator	NA	NA	NA	NA
WP_163833262.1\|2566241_2566838_+	hypothetical protein	H2BD67	Pseudomonas_phage	2.2e-08	34.1
WP_163833263.1\|2566894_2567887_+	replication protein	I6PDJ3	Cronobacter_phage	1.2e-11	43.8
WP_163833264.1\|2567897_2568626_+	Replication protein P	NA	NA	NA	NA
WP_163833265.1\|2568798_2569125_+	hypothetical protein	R9TNL4	Vibrio_phage	4.7e-26	55.1
WP_163833266.1\|2569595_2570015_+	hypothetical protein	NA	NA	NA	NA
WP_163833267.1\|2570069_2570708_-	nuclease	A0A0R6PHV6	Moraxella_phage	5.8e-36	37.6
WP_163833268.1\|2570736_2571564_+	hypothetical protein	NA	NA	NA	NA
WP_163833269.1\|2571637_2572063_+	M15 family metallopeptidase	A0A0F7L8C4	uncultured_marine_virus	3.2e-22	41.6
WP_163833270.1\|2572052_2572244_+	hypothetical protein	NA	NA	NA	NA
WP_163833271.1\|2572240_2572636_+	hypothetical protein	A0A1B1ITB4	uncultured_Mediterranean_phage	2.2e-17	44.8
WP_163833272.1\|2572635_2573211_+\|terminase	terminase small subunit	A0A0A0RSW5	Bacillus_phage	1.7e-31	44.0
WP_163833273.1\|2573213_2574722_+\|terminase	phage terminase large subunit	A8ATG0	Listeria_phage	5.4e-64	35.7
WP_163833274.1\|2574721_2576266_+	DUF935 domain-containing protein	A0A2P9JZI9	Alteromonadaceae_phage	2.4e-115	45.7
WP_163833275.1\|2576265_2577051_+	hypothetical protein	M4M9M5	Vibrio_phage	2.7e-67	46.6
WP_163833276.1\|2577052_2577277_-	hypothetical protein	NA	NA	NA	NA
WP_163833277.1\|2577412_2578027_-	PAS domain-containing protein	NA	NA	NA	NA
WP_163833278.1\|2578357_2578531_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_163836455.1\|2578749_2579244_+	hypothetical protein	Q7Y5W2	Haemophilus_phage	9.1e-21	46.0
WP_163833279.1\|2579397_2579793_+	hypothetical protein	NA	NA	NA	NA
WP_163833280.1\|2579835_2580813_+	hypothetical protein	A0A2P9JZJ0	Alteromonadaceae_phage	4.5e-72	45.9
WP_163833281.1\|2580869_2581205_+	hypothetical protein	A0A0A1IWZ9	Pseudomonas_phage	1.2e-32	67.3
WP_163833282.1\|2582984_2583590_+	hypothetical protein	A0A0C4UQR9	Shigella_phage	1.4e-52	49.5
WP_163833283.1\|2583666_2584050_+	hypothetical protein	X5IGC7	Pseudomonas_phage	8.4e-06	33.3
WP_163833284.1\|2584046_2584463_+	DUF1320 domain-containing protein	A0A2P9JZJ4	Alteromonadaceae_phage	9.4e-19	40.5
WP_163833285.1\|2584462_2584969_+	phage virion morphogenesis protein	M1NVQ9	Vibrio_phage	1.8e-27	42.9
WP_163833286.1\|2585018_2585786_+	hypothetical protein	NA	NA	NA	NA
WP_163833287.1\|2585829_2586366_+	hypothetical protein	A0A2P9JZJ6	Alteromonadaceae_phage	3.5e-18	35.5
WP_163836456.1\|2586358_2586931_+\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	1.2e-27	42.6
WP_163833288.1\|2586930_2587266_+\|plate	phage baseplate protein	V5YTB2	Pseudomonas_phage	6.3e-34	60.4
WP_163833289.1\|2587262_2588153_+\|plate	baseplate assembly protein	D5LGZ3	Escherichia_phage	5.4e-80	53.8
WP_163833290.1\|2588145_2588853_+\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	3.5e-34	42.0
WP_163833291.1\|2588849_2590166_+\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	2.4e-36	49.4
WP_163833292.1\|2590238_2591402_+\|tail	phage tail protein	A0A193GYC3	Enterobacter_phage	8.4e-134	53.6
WP_163833293.1\|2591398_2591902_+\|tail	phage major tail tube protein	K4I1G5	Acidithiobacillus_phage	1.1e-40	50.9
WP_163833294.1\|2591973_2592246_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_163836457.1\|2592218_2592362_+\|tail	GpE family phage tail protein	O80316	Escherichia_phage	1.8e-06	60.0
WP_163833295.1\|2592354_2594610_+\|tail	phage tail tape measure protein	A0A1B2LRQ0	Wolbachia_phage	6.1e-104	41.7
WP_163833296.1\|2595010_2595493_+	hypothetical protein	NA	NA	NA	NA
WP_163833297.1\|2595528_2596116_-	hypothetical protein	B6SCX2	Bacteriophage	6.3e-21	51.0
WP_163833298.1\|2596421_2597834_-	DUF4041 domain-containing protein	X5JAC1	Clostridium_phage	1.2e-44	44.0
WP_163833299.1\|2597859_2598141_-	hypothetical protein	NA	NA	NA	NA
WP_163833300.1\|2598418_2599036_-	hypothetical protein	NA	NA	NA	NA
WP_163833301.1\|2599624_2600083_-	hypothetical protein	NA	NA	NA	NA
WP_163833302.1\|2600104_2606101_-	hypothetical protein	S5WIG9	Leptospira_phage	5.5e-27	24.8
WP_163833303.1\|2606334_2606754_+\|tail	phage tail protein	A0A088FQM4	Escherichia_phage	1.2e-26	46.6
WP_163833304.1\|2606740_2606947_+\|tail	phage tail protein	S4TTA0	Salmonella_phage	1.3e-10	46.9
WP_163833305.1\|2606937_2607933_+	late control protein	D4HTW7	Vibrio_phage	1.2e-64	42.4
WP_163833306.1\|2608239_2608566_+	hypothetical protein	I6NSG1	Burkholderia_phage	3.1e-09	40.7
WP_163833307.1\|2608593_2608791_+\|integrase	tyrosine-type recombinase/integrase	A0A1L5C291	Pseudoalteromonas_phage	7.5e-11	56.4
WP_163833308.1\|2609453_2610251_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163833309.1\|2610273_2611002_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163833310.1\|2611160_2611487_+	M15 family metallopeptidase	A0A0F7L8C4	uncultured_marine_virus	4.3e-11	37.3
WP_163833311.1\|2612526_2612985_+	hypothetical protein	NA	NA	NA	NA
WP_163833312.1\|2613034_2613484_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163836458.1\|2613837_2613978_-	hypothetical protein	NA	NA	NA	NA
WP_163833313.1\|2614127_2614220_-	hypothetical protein	NA	NA	NA	NA
WP_163833314.1\|2614292_2614865_+	hypothetical protein	NA	NA	NA	NA
WP_163833315.1\|2615244_2615445_+	hypothetical protein	NA	NA	NA	NA
WP_163833316.1\|2615530_2616154_-	hypothetical protein	NA	NA	NA	NA
WP_163833317.1\|2616510_2616795_+	hypothetical protein	NA	NA	NA	NA
WP_163833318.1\|2617142_2617520_+	PH domain-containing protein	A6N235	Microbacterium_phage	2.1e-09	36.8
WP_163836355.1\|2617567_2618080_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163832145.1\|2618118_2618625_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163833319.1\|2618697_2618874_-	hypothetical protein	NA	NA	NA	NA
WP_163833320.1\|2619015_2619417_-	hypothetical protein	NA	NA	NA	NA
WP_163833321.1\|2619676_2620243_-	hypothetical protein	NA	NA	NA	NA
WP_163833322.1\|2620634_2620829_+	hypothetical protein	NA	NA	NA	NA
WP_163833323.1\|2620919_2621060_+	hypothetical protein	NA	NA	NA	NA
WP_163832560.1\|2621036_2621812_-\|transposase	IS5 family transposase	NA	NA	NA	NA
2621037:2621057	attL	NA	NA	NA	NA
WP_163833324.1\|2621833_2622031_+\|tail	phage tail protein	S4TTA0	Salmonella_phage	1.4e-09	53.7
WP_163833325.1\|2622035_2622302_+	hypothetical protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.6e-06	39.7
WP_163830705.1\|2622738_2623674_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163833326.1\|2623747_2624059_-	hypothetical protein	NA	NA	NA	NA
WP_163836389.1\|2624240_2625311_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163833327.1\|2625550_2626429_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163833328.1\|2626655_2627390_-	hypothetical protein	NA	NA	NA	NA
WP_163833329.1\|2627769_2628843_-	hypothetical protein	NA	NA	NA	NA
WP_163833330.1\|2629018_2629240_+	hypothetical protein	NA	NA	NA	NA
WP_163833331.1\|2629281_2629656_-	hypothetical protein	NA	NA	NA	NA
WP_163833332.1\|2629873_2630290_+	VOC family protein	NA	NA	NA	NA
WP_163833333.1\|2630313_2631969_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
WP_163833334.1\|2632415_2633171_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_163833335.1\|2633171_2634101_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_163833336.1\|2634417_2635065_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_163833337.1\|2635231_2637076_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_163833338.1\|2637159_2637747_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_163833339.1\|2638254_2639289_-\|integrase	tyrosine-type recombinase/integrase	H9C152	Pectobacterium_phage	4.5e-94	52.2
WP_163833340.1\|2639292_2639517_-	DUF4224 domain-containing protein	Q8HAA9	Salmonella_phage	5.6e-10	50.0
WP_163833341.1\|2639526_2639862_-	hypothetical protein	NA	NA	NA	NA
WP_163833342.1\|2639864_2640266_-	hypothetical protein	NA	NA	NA	NA
WP_163833343.1\|2640365_2641154_-	DUF2303 family protein	NA	NA	NA	NA
WP_163833344.1\|2641191_2641542_-	hypothetical protein	NA	NA	NA	NA
WP_163833345.1\|2641618_2641819_-	hypothetical protein	NA	NA	NA	NA
WP_163833346.1\|2641821_2642328_-	recombination-associated protein RdgC	NA	NA	NA	NA
WP_163833347.1\|2642297_2642732_-	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	5.6e-06	43.2
WP_163833348.1\|2642897_2643311_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_163833349.1\|2643942_2644812_+	helix-turn-helix domain-containing protein	A0A1W6JP36	Morganella_phage	3.4e-10	39.1
WP_163833350.1\|2644808_2645522_+	Replication protein P	W6MVG8	Pseudomonas_phage	1.3e-36	38.4
WP_163833351.1\|2645734_2645914_-	hypothetical protein	NA	NA	NA	NA
WP_163833352.1\|2645976_2646294_-	hypothetical protein	NA	NA	NA	NA
WP_163833353.1\|2646960_2647119_+	hypothetical protein	NA	NA	NA	NA
WP_163833354.1\|2647143_2647918_+\|transposase	IS5 family transposase	NA	NA	NA	NA
2647106:2647126	attR	NA	NA	NA	NA
WP_163833355.1\|2648180_2649470_-\|protease	serine protease	V5LS29	Emiliania_huxleyi_virus	8.2e-05	43.1
WP_163833356.1\|2649761_2650124_+	recombinase	NA	NA	NA	NA
WP_163833357.1\|2650120_2650381_+	hypothetical protein	NA	NA	NA	NA
WP_163833358.1\|2651094_2651673_+	hypothetical protein	NA	NA	NA	NA
WP_163833359.1\|2651925_2652546_+	hypothetical protein	NA	NA	NA	NA
WP_163833360.1\|2652616_2652790_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_163833361.1\|2652793_2653186_+	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	1.1e-42	58.5
WP_163833362.1\|2653330_2653804_+\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	7.9e-14	43.7
WP_163836459.1\|2654444_2654639_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-09	52.4
WP_163833363.1\|2654680_2655073_+	hypothetical protein	NA	NA	NA	NA
WP_163833364.1\|2655094_2655367_+	hypothetical protein	NA	NA	NA	NA
WP_163833365.1\|2655407_2656298_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163833366.1\|2656470_2657199_+	phage repressor protein/antirepressor Ant	A0A2P1N2N7	Gordonia_phage	2.1e-34	35.4
WP_163833367.1\|2657259_2657550_+	hypothetical protein	NA	NA	NA	NA
WP_163833368.1\|2657978_2658470_+	DUF1441 family protein	A0A2H4EYX7	Aeromonas_phage	4.3e-31	45.5
WP_163836460.1\|2658462_2660496_+\|terminase	phage terminase large subunit family protein	A0A219YAX2	Aeromonas_phage	8.2e-217	54.5
WP_163833369.1\|2660524_2660932_-	hypothetical protein	NA	NA	NA	NA
WP_163833370.1\|2661057_2661264_+	hypothetical protein	A0A219Y9T2	Aeromonas_phage	5.7e-09	51.5
WP_163833371.1\|2661263_2662769_+\|portal	phage portal protein	A0A219Y9V7	Aeromonas_phage	3.9e-131	47.3
WP_163833372.1\|2662825_2663437_+	DUF1131 family protein	NA	NA	NA	NA
WP_163833373.1\|2663526_2664543_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	4.6e-27	30.7
WP_163833374.1\|2664539_2664893_+\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	1.6e-11	39.1
WP_163833375.1\|2664991_2665987_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	4.3e-78	46.4
WP_163833376.1\|2665989_2666355_+	hypothetical protein	NA	NA	NA	NA
WP_163833377.1\|2666329_2666908_+	hypothetical protein	B0ZSF5	Halomonas_phage	4.8e-29	42.4
WP_163833378.1\|2666891_2667425_+	hypothetical protein	NA	NA	NA	NA
WP_163833379.1\|2667405_2667951_+\|plate	phage baseplate assembly protein V	A2I2X5	Vibrio_virus	4.2e-43	57.3
WP_163833380.1\|2667983_2668271_+	PaaR repeat-containing protein	G4KK81	Yersinia_phage	2.9e-11	40.0
WP_163833381.1\|2668275_2668596_-	hypothetical protein	NA	NA	NA	NA
WP_163833382.1\|2668641_2668986_+\|plate	phage baseplate protein	A2I2X7	Vibrio_virus	3.7e-21	49.1
WP_163833383.1\|2668982_2669975_+\|plate	baseplate assembly protein	Q6R4V6	Vibrio_virus	1.7e-71	41.9
WP_163833384.1\|2669971_2670601_+\|tail	phage tail protein I	Q6R4V7	Vibrio_virus	7.3e-31	44.7
WP_163833385.1\|2670593_2672003_+\|tail	phage tail protein	F1BUP1	Erwinia_phage	3.9e-24	34.7
WP_163830644.1\|2672014_2672212_+	hypothetical protein	NA	NA	NA	NA
WP_163833386.1\|2672195_2673362_+\|tail	phage tail protein	Q6R4W2	Vibrio_virus	3.9e-163	71.6
WP_163833387.1\|2673361_2673868_+\|tail	phage tail protein	Q6R4W3	Vibrio_virus	3.7e-62	66.7
WP_163833388.1\|2673870_2674146_-	hypothetical protein	NA	NA	NA	NA
WP_163833389.1\|2674280_2674859_+\|tail	phage tail assembly protein	Q6R4W4	Vibrio_virus	4.9e-50	50.0
WP_163833390.1\|2674958_2677544_+\|tail	phage tail tape measure protein	A2I2Y1	Vibrio_virus	2.3e-123	50.2
WP_163833391.1\|2677543_2677945_+\|tail	phage tail protein	A2I2Y2	Vibrio_virus	2.9e-33	52.4
WP_163833392.1\|2677919_2678126_+\|tail	phage tail protein	A2I2Y3	Vibrio_virus	8.2e-08	42.4
WP_163833393.1\|2678116_2679127_+	phage late control D family protein	A2I2Y5	Vibrio_virus	3.9e-103	54.6
WP_163833394.1\|2679360_2679645_+	hypothetical protein	NA	NA	NA	NA
WP_163833395.1\|2679839_2680559_+	DUF4339 domain-containing protein	NA	NA	NA	NA
WP_163833396.1\|2680612_2681113_+	hypothetical protein	NA	NA	NA	NA
WP_163833397.1\|2681293_2681629_+	hypothetical protein	NA	NA	NA	NA
WP_163833398.1\|2681729_2682422_+	nucleotide-binding protein	NA	NA	NA	NA
WP_163833399.1\|2684237_2684450_+	nucleotide-binding protein	NA	NA	NA	NA
WP_163833400.1\|2684545_2685148_+	SLATT domain-containing protein	NA	NA	NA	NA
WP_163833401.1\|2685187_2685802_+	hypothetical protein	NA	NA	NA	NA
WP_163833402.1\|2685851_2686463_+	hypothetical protein	NA	NA	NA	NA
WP_163833403.1\|2687339_2687612_-	hypothetical protein	NA	NA	NA	NA
WP_163833404.1\|2687872_2688247_+	hypothetical protein	NA	NA	NA	NA
WP_163833405.1\|2688934_2689291_+	hypothetical protein	NA	NA	NA	NA
WP_163833406.1\|2690054_2691185_+	hypothetical protein	NA	NA	NA	NA
WP_163836355.1\|2691181_2691694_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163832145.1\|2691732_2692239_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

3428235 : 3486029

Streptococcus_phage(33.33%)

integrase,transposase

attL 3429499:3429516|attR 3489360:3489377

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163833948.1\|3428235_3429579_+\|integrase	site-specific integrase	NA	NA	NA	NA
3429499:3429516	attL	NA	NA	NA	NA
WP_163833949.1\|3429593_3431405_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_163836494.1\|3431833_3433321_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_163833950.1\|3433329_3433794_+	hypothetical protein	NA	NA	NA	NA
WP_163833951.1\|3433802_3435737_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	5.9e-39	30.0
WP_163833952.1\|3435833_3436088_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_163833953.1\|3436125_3436314_-	hypothetical protein	NA	NA	NA	NA
WP_163833954.1\|3436722_3437214_+	hypothetical protein	NA	NA	NA	NA
WP_163833955.1\|3437759_3442661_+	DEAD/DEAH box helicase	A0A2H4UVA3	Bodo_saltans_virus	7.6e-35	25.0
WP_163833956.1\|3443219_3446594_+	hypothetical protein	NA	NA	NA	NA
WP_163833957.1\|3446917_3450736_-	hypothetical protein	NA	NA	NA	NA
WP_163836495.1\|3450817_3451129_-	HigA family addiction module antidote protein	I6ZVM3	Aeromonas_phage	5.0e-17	49.5
WP_163833958.1\|3451410_3451767_+	hypothetical protein	NA	NA	NA	NA
WP_163833959.1\|3452076_3453747_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	7.3e-38	30.0
WP_163833960.1\|3453864_3455124_-	diaminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_163830705.1\|3455188_3456124_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163833961.1\|3456243_3457593_-	MFS transporter	NA	NA	NA	NA
WP_163833962.1\|3457921_3458734_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|3458765_3459701_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163836496.1\|3459832_3459979_-	hypothetical protein	NA	NA	NA	NA
WP_163836497.1\|3460273_3460549_+	hypothetical protein	NA	NA	NA	NA
WP_163833963.1\|3460719_3461268_-	hypothetical protein	NA	NA	NA	NA
WP_163833964.1\|3461410_3462667_+	cytochrome P450	NA	NA	NA	NA
WP_163833965.1\|3462756_3463083_-	hypothetical protein	NA	NA	NA	NA
WP_163833966.1\|3463619_3464654_-	hypothetical protein	NA	NA	NA	NA
WP_163833967.1\|3464879_3467780_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	3.0e-273	52.9
WP_163833968.1\|3467908_3468301_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_163833969.1\|3468374_3469673_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.8e-100	52.9
WP_163833970.1\|3469740_3471120_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_163833971.1\|3471542_3472160_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_163833972.1\|3473170_3474544_+	sodium:alanine symporter family protein	NA	NA	NA	NA
WP_163833973.1\|3474590_3475715_+	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_163833974.1\|3476060_3477902_+	hypothetical protein	NA	NA	NA	NA
WP_163833975.1\|3477974_3478910_-	hypothetical protein	NA	NA	NA	NA
WP_163833976.1\|3479128_3479551_-	DUF393 domain-containing protein	NA	NA	NA	NA
WP_163833977.1\|3479547_3480726_-	VWA domain-containing protein	NA	NA	NA	NA
WP_163833978.1\|3480732_3481575_-	MoxR family ATPase	NA	NA	NA	NA
WP_163833979.1\|3481950_3484998_+	NACHT domain-containing protein	NA	NA	NA	NA
WP_163830705.1\|3485093_3486029_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
3489360:3489377	attR	NA	NA	NA	NA

DBSCAN-SWA_16

3616653 : 3667692

Tetraselmis_virus(20.0%)

tRNA,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163834074.1\|3616653_3617565_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA
WP_163834075.1\|3617586_3618348_-	glycosyltransferase	A0A2P0VNH9	Tetraselmis_virus	6.3e-45	40.8
WP_163834076.1\|3618535_3620269_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163834077.1\|3620674_3622834_+	flagellin	NA	NA	NA	NA
WP_163834078.1\|3623033_3624647_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_163834079.1\|3624691_3626677_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_163834080.1\|3626699_3627938_-	flagellar hook-associated protein 3	NA	NA	NA	NA
WP_163834081.1\|3627969_3630753_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_163834082.1\|3630841_3631921_-	flagellar assembly peptidoglycan hydrolase FlgJ	D6PHK9	uncultured_phage	1.0e-08	36.3
WP_163836503.1\|3631981_3633076_-	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_163834083.1\|3633134_3633827_-	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_163834084.1\|3634110_3634896_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_163834085.1\|3634976_3635723_-	flagellar basal-body rod protein FlgF	NA	NA	NA	NA
WP_163834086.1\|3635973_3637986_-	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_163834087.1\|3638146_3638842_-	flagellar hook assembly protein FlgD	NA	NA	NA	NA
WP_163834088.1\|3638908_3639355_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_163834089.1\|3639357_3639762_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_163834090.1\|3639971_3641087_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-15	38.8
WP_163834091.1\|3641236_3641653_-	hypothetical protein	NA	NA	NA	NA
WP_163834092.1\|3641812_3643987_-\|tRNA	tRNA(Met) cytidine acetyltransferase	NA	NA	NA	NA
WP_163834093.1\|3644007_3644556_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.1e-18	33.5
WP_163834094.1\|3644786_3645209_+	hypothetical protein	NA	NA	NA	NA
WP_163834095.1\|3645637_3646504_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163834096.1\|3646652_3646871_-	hypothetical protein	NA	NA	NA	NA
WP_163834097.1\|3646864_3647080_+	hypothetical protein	NA	NA	NA	NA
WP_163834098.1\|3647151_3647331_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|3647698_3648634_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163834099.1\|3648658_3648940_+	hypothetical protein	NA	NA	NA	NA
WP_163834100.1\|3649029_3649344_-	hypothetical protein	NA	NA	NA	NA
WP_163834101.1\|3649713_3651312_-	hypothetical protein	NA	NA	NA	NA
WP_163836355.1\|3651893_3652406_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163831121.1\|3652444_3652951_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163834102.1\|3653717_3654014_-	hypothetical protein	NA	NA	NA	NA
WP_163834103.1\|3654435_3655029_+	hypothetical protein	NA	NA	NA	NA
WP_163834104.1\|3655095_3655290_+	hypothetical protein	NA	NA	NA	NA
WP_163834105.1\|3655738_3657118_+	hypothetical protein	NA	NA	NA	NA
WP_163834106.1\|3657416_3661202_+	hypothetical protein	NA	NA	NA	NA
WP_163834107.1\|3661665_3662526_-	hypothetical protein	NA	NA	NA	NA
WP_163836504.1\|3662513_3663584_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163834108.1\|3663652_3665728_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|3666093_3667029_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163834109.1\|3667242_3667692_-\|tail	tail fiber domain-containing protein	A0A192Y7K3	Salmonella_phage	5.6e-09	39.4

DBSCAN-SWA_17

4381701 : 4447586

Vibrio_phage(14.29%)

tRNA,integrase,capsid,tail,head,terminase,transposase,plate,protease,portal,holin

attL 4409572:4409596|attR 4444085:4444109

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163834641.1\|4381701_4383195_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_163834642.1\|4383818_4387310_+	indolepyruvate ferredoxin oxidoreductase family protein	NA	NA	NA	NA
WP_163834643.1\|4387506_4387746_-	hypothetical protein	NA	NA	NA	NA
WP_163834644.1\|4388127_4388697_-	RICIN domain-containing protein	NA	NA	NA	NA
WP_163834645.1\|4388860_4390012_-	DUF1176 domain-containing protein	NA	NA	NA	NA
WP_163834646.1\|4390067_4390433_+	hypothetical protein	NA	NA	NA	NA
WP_163834647.1\|4390736_4391576_+	hypothetical protein	NA	NA	NA	NA
WP_163834648.1\|4391851_4392628_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163834649.1\|4394122_4395007_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163834650.1\|4395082_4395262_-\|tail	tail fiber domain-containing protein	NA	NA	NA	NA
WP_163834651.1\|4395524_4395758_-	hypothetical protein	NA	NA	NA	NA
WP_163836546.1\|4396024_4396123_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_163834652.1\|4396112_4396238_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_163834653.1\|4396260_4396872_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-30	38.0
WP_163832145.1\|4397106_4397613_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163836355.1\|4397806_4398319_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163831121.1\|4398357_4398864_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163834654.1\|4398949_4399273_+	hypothetical protein	NA	NA	NA	NA
WP_163834655.1\|4399306_4399435_-\|transposase	transposase	NA	NA	NA	NA
WP_163834656.1\|4399403_4399757_-	hypothetical protein	NA	NA	NA	NA
WP_163834657.1\|4399818_4400223_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	2.9e-41	54.0
WP_163830705.1\|4400365_4401301_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163834658.1\|4401479_4401776_+	hypothetical protein	NA	NA	NA	NA
WP_163834659.1\|4401828_4402245_-	hypothetical protein	NA	NA	NA	NA
WP_163834660.1\|4402505_4402847_-	hypothetical protein	NA	NA	NA	NA
WP_163834661.1\|4403044_4403722_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.8e-39	39.2
WP_163832199.1\|4404073_4404244_+	hypothetical protein	NA	NA	NA	NA
WP_163834662.1\|4404250_4404631_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	1.2e-28	53.2
WP_163834663.1\|4404638_4405226_+	hypothetical protein	NA	NA	NA	NA
WP_163834664.1\|4405445_4405673_-	hypothetical protein	NA	NA	NA	NA
WP_163834665.1\|4405755_4405944_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_163834666.1\|4405954_4406323_+	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	1.6e-38	55.9
WP_163834667.1\|4406608_4407061_+\|tail	tail fiber domain-containing protein	A0A0E3HHC2	Synechococcus_phage	8.9e-15	50.0
WP_163834668.1\|4407128_4407536_+	hypothetical protein	A0A218MKV5	uncultured_virus	6.6e-09	43.8
WP_163834669.1\|4407547_4407766_+\|holin	holin	NA	NA	NA	NA
WP_163834670.1\|4407802_4408462_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163834671.1\|4408837_4409557_+	phage antirepressor Ant	A0A0C5AEJ9	Bacteriophage	2.7e-37	40.5
4409572:4409596	attL	NA	NA	NA	NA
WP_163834661.1\|4409737_4410415_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.8e-39	39.2
WP_163834672.1\|4410612_4411776_+\|integrase	tyrosine-type recombinase/integrase	A0A2D1GN00	Marinobacter_phage	6.6e-78	43.7
WP_163834673.1\|4412500_4412722_+	hypothetical protein	NA	NA	NA	NA
WP_163834674.1\|4413076_4414621_+	RHS repeat protein	NA	NA	NA	NA
WP_163834675.1\|4414697_4417604_+	hypothetical protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.7e-21	40.2
WP_163834676.1\|4417606_4417924_+	hypothetical protein	NA	NA	NA	NA
WP_163834677.1\|4418219_4418636_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_163834678.1\|4418966_4419614_-	hypothetical protein	NA	NA	NA	NA
WP_163834679.1\|4419597_4421397_-	glycosyltransferase	NA	NA	NA	NA
WP_163834680.1\|4421396_4422572_-	HAD family hydrolase	NA	NA	NA	NA
WP_163834681.1\|4422654_4423464_-	FRG domain-containing protein	A0A1S6KZX9	Salmonella_phage	3.0e-05	26.7
WP_163834682.1\|4423651_4424587_-	hypothetical protein	D4HTW7	Vibrio_phage	1.5e-53	39.8
WP_163834683.1\|4424729_4425023_+	hypothetical protein	NA	NA	NA	NA
WP_163834684.1\|4425067_4425271_-\|tail	phage tail protein	NA	NA	NA	NA
WP_163834685.1\|4425239_4425647_-\|tail	phage tail protein	E5E3U5	Burkholderia_phage	6.8e-14	33.1
WP_163834686.1\|4425643_4427644_-	hypothetical protein	A0A1J0GWA6	Alteromonas_phage	5.5e-32	40.2
WP_163834687.1\|4427747_4428020_-\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	1.2e-09	36.0
WP_163834688.1\|4428080_4428584_-\|tail	phage major tail tube protein	A0A1B2LRS4	Wolbachia_phage	5.2e-32	41.1
WP_163834689.1\|4428573_4429770_-\|tail	phage tail protein	D4HTW1	Vibrio_phage	1.4e-128	57.8
WP_163834690.1\|4429829_4431146_-\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	7.5e-38	48.6
WP_163832310.1\|4431148_4431844_-\|tail	phage tail protein I	D5LGZ2	Escherichia_phage	4.9e-36	42.0
WP_163834691.1\|4431848_4432520_-\|plate	baseplate assembly protein	A0A088FQL4	Escherichia_phage	3.5e-47	45.7
WP_163834692.1\|4434272_4434545_-	hypothetical protein	A0A193GYM8	Enterobacter_phage	1.0e-18	68.8
WP_163834693.1\|4434541_4434877_-\|plate	phage baseplate protein	A0A088FV58	Escherichia_phage	1.4e-33	64.9
WP_163834694.1\|4434944_4435364_-	hypothetical protein	NA	NA	NA	NA
WP_163834695.1\|4435441_4436014_-\|plate	phage baseplate assembly protein V	A0A1B2LRU5	Wolbachia_phage	1.2e-24	42.0
WP_163834696.1\|4435988_4436849_-	hypothetical protein	NA	NA	NA	NA
WP_163830729.1\|4436841_4437252_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_163830730.1\|4437241_4437562_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	7.7e-13	40.6
WP_163830731.1\|4437558_4437867_-\|head,tail	phage gp6-like head-tail connector protein	A0A2D1GNK0	Pseudomonas_phage	4.6e-15	39.4
WP_163830732.1\|4438011_4438203_+	hypothetical protein	NA	NA	NA	NA
WP_163830733.1\|4438249_4439461_-\|capsid	phage major capsid protein	M1FPN2	Enterobacteria_phage	5.5e-112	52.1
WP_163834697.1\|4439465_4440116_-\|head,protease	HK97 family phage prohead protease	Q8HAD3	Salmonella_phage	4.5e-60	57.5
WP_163834698.1\|4440102_4441311_-\|portal	phage portal protein	Q8HAD4	Salmonella_phage	5.5e-112	50.4
WP_163836547.1\|4441307_4443002_-\|terminase	terminase large subunit	U5P0Q5	Shigella_phage	1.8e-185	55.8
WP_163834699.1\|4443001_4443454_-\|terminase	phage terminase small subunit P27 family	A0A2D1GNP3	Pseudomonas_phage	2.5e-41	52.7
WP_163834700.1\|4443615_4443981_-	HNH endonuclease	A0A1V0E8A5	Vibrio_phage	2.4e-26	49.1
WP_163832295.1\|4444135_4444867_-	phage repressor protein/antirepressor Ant	A0A067ZIN2	Vibrio_phage	1.7e-31	51.4
4444085:4444109	attR	NA	NA	NA	NA
WP_163834701.1\|4444937_4445159_-	hypothetical protein	NA	NA	NA	NA
WP_163834702.1\|4445179_4445572_-	hypothetical protein	NA	NA	NA	NA
WP_163834703.1\|4445543_4445714_-	hypothetical protein	NA	NA	NA	NA
WP_163834704.1\|4445697_4446120_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	1.7e-39	58.1
WP_163834705.1\|4446122_4446236_-	hypothetical protein	NA	NA	NA	NA
WP_163834706.1\|4446450_4447029_-	hypothetical protein	NA	NA	NA	NA
WP_163834707.1\|4447268_4447586_-	hypothetical protein	R9TNL4	Vibrio_phage	2.4e-27	54.9

DBSCAN-SWA_18

4456939 : 4491619

Vibrio_virus(50.0%)

integrase,tail,terminase,plate,protease,portal,holin

attL 4453157:4453176|attR 4496255:4496274

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4453157:4453176	attL	NA	NA	NA	NA
WP_163834723.1\|4456939_4458055_+\|integrase	tyrosine-type recombinase/integrase	A0A2D1GN00	Marinobacter_phage	5.9e-84	45.7
WP_163834724.1\|4458138_4458909_-	hypothetical protein	NA	NA	NA	NA
WP_163834673.1\|4459783_4460005_+	hypothetical protein	NA	NA	NA	NA
WP_163834725.1\|4460359_4461904_+	RHS repeat protein	NA	NA	NA	NA
WP_163834726.1\|4461980_4464611_+	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	3.0e-17	40.5
WP_163834727.1\|4465548_4468209_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_163834728.1\|4468276_4469257_-	hypothetical protein	NA	NA	NA	NA
WP_163834729.1\|4469304_4470312_-	phage late control D family protein	A2I2Y5	Vibrio_virus	4.8e-101	54.2
WP_163834730.1\|4470302_4470509_-\|tail	phage tail protein	NA	NA	NA	NA
WP_163834731.1\|4470483_4470885_-\|tail	phage tail protein	A2I2Y2	Vibrio_virus	2.9e-33	52.4
WP_163834732.1\|4470884_4473470_-\|tail	phage tail tape measure protein	A2I2Y1	Vibrio_virus	7.9e-116	54.5
WP_163834733.1\|4473569_4474148_-\|tail	phage tail assembly protein	Q6R4W4	Vibrio_virus	9.9e-51	50.5
WP_163833388.1\|4474282_4474558_+	hypothetical protein	NA	NA	NA	NA
WP_163833387.1\|4474560_4475067_-\|tail	phage tail protein	Q6R4W3	Vibrio_virus	3.7e-62	66.7
WP_163834734.1\|4475066_4476233_-\|tail	phage tail protein	Q6R4W2	Vibrio_virus	1.7e-163	71.9
WP_163834735.1\|4476216_4476402_-	hypothetical protein	NA	NA	NA	NA
WP_163834736.1\|4476421_4478158_-\|tail	phage tail protein	F1BUP1	Erwinia_phage	4.3e-25	35.2
WP_163834737.1\|4478150_4478780_-\|tail	phage tail protein I	Q6R4V7	Vibrio_virus	3.8e-32	44.2
WP_163834738.1\|4478776_4479769_-\|plate	baseplate assembly protein	Q6R4V6	Vibrio_virus	2.2e-74	43.6
WP_163834739.1\|4479765_4480104_-\|plate	phage baseplate protein	A2I2X7	Vibrio_virus	2.8e-21	47.7
WP_163834740.1\|4480103_4480391_-	PaaR repeat-containing protein	K4ICQ1	Acidithiobacillus_phage	8.2e-14	48.9
WP_163834741.1\|4480423_4480969_-\|plate	phage baseplate assembly protein V	A2I2X5	Vibrio_virus	1.4e-43	56.9
WP_163834742.1\|4480949_4481486_-	hypothetical protein	NA	NA	NA	NA
WP_163834743.1\|4481472_4482045_-	hypothetical protein	B0ZSF5	Halomonas_phage	1.3e-26	40.6
WP_163834744.1\|4482019_4482397_-	hypothetical protein	NA	NA	NA	NA
WP_163834745.1\|4482396_4482714_-	DUF2190 family protein	A0A1W6JT93	Pseudomonas_phage	3.0e-09	35.9
WP_163834746.1\|4482779_4484786_-\|protease	Clp protease ClpP	A0A1W6JT88	Pseudomonas_phage	2.2e-145	43.7
WP_163834747.1\|4484791_4486273_-\|portal	phage portal protein	A0A1B0YZU4	Pseudomonas_phage	4.0e-128	48.1
WP_163836548.1\|4486269_4486479_-	hypothetical protein	A0A1B0YZU1	Pseudomonas_phage	2.3e-05	46.5
WP_163834748.1\|4486475_4488506_-\|terminase	terminase	A2I2W6	Vibrio_virus	7.1e-237	60.9
WP_163834749.1\|4488357_4488942_-\|terminase	terminase small subunit	B0ZSE9	Halomonas_phage	1.7e-29	41.1
WP_163834750.1\|4489609_4490425_+	hypothetical protein	NA	NA	NA	NA
WP_163834751.1\|4490439_4490658_-\|holin	holin	NA	NA	NA	NA
WP_163834752.1\|4490678_4491071_-	hypothetical protein	NA	NA	NA	NA
WP_163834753.1\|4491196_4491619_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	1.8e-41	54.0
4496255:4496274	attR	NA	NA	NA	NA

DBSCAN-SWA_19

4497445 : 4505407

Pseudomonas_phage(33.33%)

integrase

attL 4496603:4496615|attR 4508090:4508102

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4496603:4496615	attL	NA	NA	NA	NA
WP_163834759.1\|4497445_4498360_+	recombination-associated protein RdgC	M4MHA9	Vibrio_phage	1.3e-15	24.0
WP_163834760.1\|4498356_4498566_+	hypothetical protein	NA	NA	NA	NA
WP_163834761.1\|4498649_4499066_+	hypothetical protein	NA	NA	NA	NA
WP_163832206.1\|4499068_4499821_+	ATP-binding protein	B4UTW5	Rhizobium_phage	2.4e-41	39.5
WP_163834762.1\|4499832_4500402_+	DUF669 domain-containing protein	A0A2H4GYE1	Pseudomonas_phage	4.0e-20	33.8
WP_163834763.1\|4500456_4500675_+	hypothetical protein	NA	NA	NA	NA
WP_163834764.1\|4500859_4501900_+	oxidoreductase	A0A173H0P7	Pseudoalteromonas_phage	4.2e-84	47.9
WP_163834765.1\|4501896_4503522_+	DEAD/DEAH box helicase family protein	A0A172PZU9	Pseudomonas_phage	3.6e-98	39.0
WP_163832210.1\|4503511_4503745_+	hypothetical protein	NA	NA	NA	NA
WP_163834766.1\|4503754_4504060_+	carbon storage regulator	NA	NA	NA	NA
WP_163834767.1\|4504070_4504283_+	DNA-binding protein	NA	NA	NA	NA
WP_163834768.1\|4504279_4505407_+\|integrase	tyrosine-type recombinase/integrase	A0A2D1GN00	Marinobacter_phage	2.3e-72	41.6
4508090:4508102	attR	NA	NA	NA	NA

DBSCAN-SWA_20

5783600 : 5812406

uncultured_Caudovirales_phage(25.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163830705.1\|5783600_5784536_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_163835888.1\|5785001_5785391_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_163835889.1\|5785638_5787897_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_163835890.1\|5788107_5789469_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.2e-64	40.8
WP_163835891.1\|5789543_5789741_+	hypothetical protein	NA	NA	NA	NA
WP_163835892.1\|5789995_5790910_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.6e-17	37.9
WP_163835893.1\|5791118_5791886_+	hypothetical protein	NA	NA	NA	NA
WP_163835894.1\|5792574_5792901_-	hypothetical protein	NA	NA	NA	NA
WP_163835895.1\|5793448_5794906_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_163835896.1\|5794919_5796665_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	2.1e-59	29.9
WP_163835897.1\|5796719_5798996_+	CehA/McbA family metallohydrolase	NA	NA	NA	NA
WP_163835898.1\|5799180_5800320_+	BCCT family transporter	NA	NA	NA	NA
WP_163835899.1\|5800606_5802838_+	FAD-binding protein	A0A2K9L3G7	Tupanvirus	1.7e-50	28.6
WP_163835900.1\|5803336_5803675_+	hypothetical protein	NA	NA	NA	NA
WP_163836607.1\|5803730_5804849_-	hypothetical protein	NA	NA	NA	NA
WP_163835901.1\|5804938_5806057_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_163835902.1\|5806175_5806967_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_163835903.1\|5807121_5809068_-	hypothetical protein	NA	NA	NA	NA
WP_163836389.1\|5809250_5810321_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163835904.1\|5810490_5811177_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_163836355.1\|5811348_5811861_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_163831121.1\|5811899_5812406_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

5962331 : 6013991

Salicola_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836037.1\|5962331_5963033_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_163836038.1\|5963114_5963492_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_163836039.1\|5963843_5964062_-	hypothetical protein	NA	NA	NA	NA
WP_163836040.1\|5964806_5965661_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	5.6e-42	38.8
WP_163836041.1\|5966007_5967021_-	ABC transporter permease	NA	NA	NA	NA
WP_163836042.1\|5967013_5967685_-	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.5e-29	37.5
WP_163836618.1\|5967865_5968225_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_163836043.1\|5968420_5969146_-	hydrogenase	NA	NA	NA	NA
WP_163836044.1\|5969278_5969716_+	cytochrome c	NA	NA	NA	NA
WP_163836045.1\|5970146_5970608_-	hypothetical protein	NA	NA	NA	NA
WP_163836046.1\|5970692_5971139_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_163836047.1\|5971492_5972065_+	hypothetical protein	NA	NA	NA	NA
WP_163836048.1\|5972067_5973846_+	OmpA family protein	NA	NA	NA	NA
WP_163836049.1\|5973850_5974390_+	GTP-binding protein	NA	NA	NA	NA
WP_163836050.1\|5974367_5976566_+	EAL domain-containing protein	NA	NA	NA	NA
WP_163836051.1\|5976635_5979680_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.6e-19	20.4
WP_163836052.1\|5979679_5980768_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_163836053.1\|5981168_5981378_-	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
WP_163836054.1\|5981733_5983113_-	hypothetical protein	NA	NA	NA	NA
WP_163836055.1\|5983226_5984012_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_163836056.1\|5984159_5985359_+	MFS transporter	NA	NA	NA	NA
WP_163836057.1\|5985856_5986045_-	hypothetical protein	NA	NA	NA	NA
WP_163836619.1\|5986185_5987505_-	sulfatase-like hydrolase/transferase	NA	NA	NA	NA
WP_163836058.1\|5989284_5990133_+	alpha-L-glutamate ligase	NA	NA	NA	NA
WP_163836059.1\|5990332_5991952_-	hypothetical protein	NA	NA	NA	NA
WP_163836060.1\|5991964_5992678_-	hypothetical protein	NA	NA	NA	NA
WP_163836061.1\|5993153_5994272_-	agmatine deiminase family protein	A7IVE6	Paramecium_bursaria_Chlorella_virus	5.4e-53	35.3
WP_163836062.1\|5994544_5995234_+	hypothetical protein	NA	NA	NA	NA
WP_163836063.1\|5995419_5996157_+	PAS domain S-box protein	NA	NA	NA	NA
WP_163836064.1\|5996268_5996706_+	GHKL domain-containing protein	NA	NA	NA	NA
WP_163836065.1\|5996642_5997524_-\|transposase	transposase	NA	NA	NA	NA
WP_163836066.1\|5997498_5998779_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836067.1\|5998779_5998977_+	hypothetical protein	NA	NA	NA	NA
WP_163836068.1\|5999119_5999965_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836069.1\|5999987_6000758_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836070.1\|6000913_6001621_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836066.1\|6001693_6002974_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836071.1\|6002990_6003431_-	hypothetical protein	NA	NA	NA	NA
WP_163836072.1\|6003848_6004871_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_163836620.1\|6004913_6005330_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163836073.1\|6005333_6005564_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836621.1\|6005577_6006144_-	putative 4-mercaptohistidine N1-methyltransferase	NA	NA	NA	NA
WP_163836074.1\|6006241_6006406_+	hypothetical protein	NA	NA	NA	NA
WP_163836075.1\|6006377_6006707_+	hypothetical protein	Q1MVF0	Enterobacteria_phage	2.2e-18	38.9
WP_163836076.1\|6008648_6009440_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_163836622.1\|6009481_6009958_+\|transposase	transposase	NA	NA	NA	NA
WP_163836077.1\|6010018_6011707_-	phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase family protein	NA	NA	NA	NA
WP_163836078.1\|6011767_6012181_-	hypothetical protein	NA	NA	NA	NA
WP_163836066.1\|6012710_6013991_-\|transposase	ISL3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

6019060 : 6064091

Bacillus_virus(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836081.1\|6019060_6019288_-\|transposase	transposase	A4JX31	Burkholderia_virus	1.3e-06	41.9
WP_163836082.1\|6019338_6020229_-	hypothetical protein	NA	NA	NA	NA
WP_163836083.1\|6020459_6020996_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_163836066.1\|6021126_6022407_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836065.1\|6022381_6023263_+\|transposase	transposase	NA	NA	NA	NA
WP_163836084.1\|6023338_6024148_-	hypothetical protein	NA	NA	NA	NA
WP_163836085.1\|6024238_6026590_-	hypothetical protein	NA	NA	NA	NA
WP_163836066.1\|6027151_6028432_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836086.1\|6028750_6029587_+	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_163836066.1\|6029916_6031197_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836087.1\|6031292_6032063_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836088.1\|6032085_6032931_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836066.1\|6033073_6034354_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836089.1\|6034594_6034915_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_163836090.1\|6034930_6035281_-	hypothetical protein	NA	NA	NA	NA
WP_163836091.1\|6035495_6035687_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_163836092.1\|6035686_6036100_+	PIN domain nuclease	NA	NA	NA	NA
WP_163836093.1\|6036055_6036457_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_163836094.1\|6036446_6036713_-	hypothetical protein	NA	NA	NA	NA
WP_163836095.1\|6036894_6037218_+	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
WP_163836096.1\|6037327_6037582_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_163836097.1\|6037578_6037833_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_163836066.1\|6038075_6039356_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836098.1\|6039487_6039868_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_163836099.1\|6039857_6040124_-	hypothetical protein	NA	NA	NA	NA
WP_163836100.1\|6040562_6040817_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_163836097.1\|6040813_6041068_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_163836101.1\|6041178_6041835_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_163836102.1\|6041862_6042045_-	hypothetical protein	NA	NA	NA	NA
WP_163836103.1\|6042074_6042488_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_163836104.1\|6042487_6042721_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_163836105.1\|6042834_6043074_+	hypothetical protein	NA	NA	NA	NA
WP_163836066.1\|6043090_6044371_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836088.1\|6044513_6045359_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836069.1\|6045381_6046152_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836106.1\|6046405_6047014_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836107.1\|6047086_6047749_-\|transposase	transposase	NA	NA	NA	NA
WP_163836108.1\|6047837_6050945_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_163836109.1\|6051135_6051726_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-41	49.2
WP_163836110.1\|6051848_6052463_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_163836086.1\|6052792_6053629_-	5'-nucleotidase, lipoprotein e(P4) family	NA	NA	NA	NA
WP_163836066.1\|6053947_6055228_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_163836111.1\|6055444_6057229_+	EAL domain-containing protein	W8CYM9	Bacillus_phage	7.1e-07	33.8
WP_163836112.1\|6057390_6058809_-	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_163836113.1\|6059021_6060374_+	insulinase family protein	G3MBJ8	Bacillus_virus	7.3e-20	23.1
WP_163836114.1\|6060370_6062479_+	hypothetical protein	G3MBJ8	Bacillus_virus	4.9e-23	22.0
WP_163836115.1\|6062789_6063089_-	hypothetical protein	NA	NA	NA	NA
WP_163830705.1\|6063155_6064091_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

6254450 : 6317125

Tupanvirus(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836389.1\|6254450_6255521_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_163836260.1\|6255423_6256575_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_163836261.1\|6257117_6258782_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_163836262.1\|6259007_6262655_+	DUF2339 domain-containing protein	NA	NA	NA	NA
WP_163836263.1\|6262717_6263449_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163836264.1\|6263507_6263924_-	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	1.8e-38	55.8
WP_163836265.1\|6264038_6264404_-	hypothetical protein	NA	NA	NA	NA
WP_163836266.1\|6264645_6264897_-	hypothetical protein	NA	NA	NA	NA
WP_163836267.1\|6265947_6266853_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_163836268.1\|6266810_6267008_+	hypothetical protein	NA	NA	NA	NA
WP_163836269.1\|6267462_6268284_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_163836270.1\|6268379_6269045_+	LysE family transporter	NA	NA	NA	NA
WP_163836271.1\|6269114_6269984_-	hypothetical protein	NA	NA	NA	NA
WP_163836272.1\|6270125_6270575_-	hypothetical protein	NA	NA	NA	NA
WP_163836273.1\|6270803_6271865_-	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_163836274.1\|6271882_6272788_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	1.8e-35	33.3
WP_163836275.1\|6272796_6273258_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_163836276.1\|6273274_6274189_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_163836277.1\|6274438_6275860_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_163836278.1\|6275964_6276861_+	EamA family transporter	NA	NA	NA	NA
WP_163836279.1\|6276894_6278331_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_163836280.1\|6278528_6278699_+	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_163836281.1\|6278763_6279375_+	LysE family translocator	NA	NA	NA	NA
WP_163836282.1\|6279610_6281182_+	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	1.5e-104	48.2
WP_163836283.1\|6281197_6282319_+	hypothetical protein	NA	NA	NA	NA
WP_163836284.1\|6282603_6282882_-	hypothetical protein	NA	NA	NA	NA
WP_163836285.1\|6283213_6283855_+	hypothetical protein	NA	NA	NA	NA
WP_163836286.1\|6283881_6285435_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.7e-41	44.5
WP_163836287.1\|6285703_6287683_-	pilin	NA	NA	NA	NA
WP_163836288.1\|6288199_6289570_-	YjiH family protein	NA	NA	NA	NA
WP_163836289.1\|6290104_6290806_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_163836290.1\|6291701_6292061_-	hypothetical protein	NA	NA	NA	NA
WP_163836291.1\|6292320_6292785_+	hypothetical protein	NA	NA	NA	NA
WP_163836638.1\|6292817_6293387_+\|transposase	transposase	NA	NA	NA	NA
WP_163836292.1\|6294504_6295389_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_163836293.1\|6295415_6295787_+	VOC family protein	NA	NA	NA	NA
WP_163836294.1\|6295804_6298831_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	5.7e-57	28.4
WP_163836295.1\|6298796_6299843_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_163836296.1\|6299864_6300887_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_163836297.1\|6300887_6307301_+	FkbM family methyltransferase	A0A2K9KZV5	Tupanvirus	8.8e-31	25.5
WP_163836298.1\|6307467_6308028_+	cytochrome b	NA	NA	NA	NA
WP_163836299.1\|6308227_6309385_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_163836300.1\|6309446_6311039_-	hypothetical protein	NA	NA	NA	NA
WP_163836301.1\|6311028_6312570_-\|transposase	transposase	NA	NA	NA	NA
WP_163836302.1\|6312572_6314207_-	ATP-binding protein	NA	NA	NA	NA
WP_163836303.1\|6314199_6316308_-\|transposase	transposase	NA	NA	NA	NA
WP_163836639.1\|6316294_6317125_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP048881

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

10905 : 53838

Aeromonas_phage(26.32%)

capsid,portal,transposase,plate,terminase,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_163836926.1\|10905_11265_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	5.1e-21	47.8
WP_163836927.1\|11280_11787_+	hypothetical protein	NA	NA	NA	NA
WP_163836928.1\|11796_12228_+	GIY-YIG nuclease family protein	Q94MV0	Myxococcus_phage	1.3e-10	37.5
WP_163836929.1\|12480_12735_+	hypothetical protein	NA	NA	NA	NA
WP_163836930.1\|12963_13380_+	hypothetical protein	NA	NA	NA	NA
WP_163836931.1\|13735_14119_+	N-acetylmuramoyl-L-alanine amidase	I6R9Z4	Marinomonas_phage	8.9e-40	55.8
WP_163836932.1\|14115_14721_+	hypothetical protein	NA	NA	NA	NA
WP_163836933.1\|15001_15196_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.4e-09	55.6
WP_163836934.1\|15272_16031_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_163836935.1\|16045_16450_+	hypothetical protein	A0A1B1INP1	uncultured_Mediterranean_phage	1.4e-06	31.6
WP_163836936.1\|16451_17168_+	hypothetical protein	A0A067ZIN2	Vibrio_phage	7.5e-32	49.3
WP_163836937.1\|17193_17442_+	hypothetical protein	NA	NA	NA	NA
WP_163836938.1\|17443_18208_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_163836939.1\|18326_18593_-	hypothetical protein	NA	NA	NA	NA
WP_163836940.1\|18831_19338_+	DUF1441 family protein	A0A219Y9R8	Aeromonas_phage	9.3e-29	44.2
WP_163836941.1\|19307_21305_+\|terminase	phage terminase large subunit family protein	A0A219YAX2	Aeromonas_phage	3.2e-205	53.0
WP_163836942.1\|21509_22976_+\|portal	phage portal protein	A0A219YAY2	Aeromonas_phage	6.3e-118	46.1
WP_163836943.1\|22972_24253_+	S49 family peptidase	A0A219YAK4	Aeromonas_phage	1.0e-71	39.0
WP_163836944.1\|24256_24610_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	9.7e-09	33.1
WP_163836945.1\|24606_24975_-	PilZ domain-containing protein	NA	NA	NA	NA
WP_163836946.1\|25060_26062_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	7.9e-72	42.3
WP_163836947.1\|26061_26412_+	hypothetical protein	NA	NA	NA	NA
WP_163836948.1\|26395_26995_+	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.1e-12	29.7
WP_163836949.1\|26975_27467_+	hypothetical protein	A0A219Y9U4	Aeromonas_phage	1.6e-22	39.0
WP_163836950.1\|27459_28053_+\|plate	phage baseplate assembly protein V	A0A219YA41	Aeromonas_phage	1.3e-26	44.2
WP_163836951.1\|28065_28419_+\|plate	baseplate assembly protein W	Q75QM0	Wolbachia_phage	2.7e-19	44.6
WP_163836952.1\|28408_29254_+	hypothetical protein	A0A219YA42	Aeromonas_phage	1.4e-45	38.5
WP_163836953.1\|29240_29873_+\|tail	phage tail protein I	D4HTV4	Vibrio_phage	6.6e-32	43.1
WP_163836954.1\|29879_30815_+\|tail	phage tail protein	A0A2H4J039	uncultured_Caudovirales_phage	5.7e-32	43.0
WP_163836955.1\|30814_31348_+	hypothetical protein	A0A1Y0T1B3	Pseudomonas_phage	3.7e-12	28.3
WP_163836956.1\|31334_31820_+	hypothetical protein	NA	NA	NA	NA
WP_163836957.1\|31826_32312_+	hypothetical protein	NA	NA	NA	NA
WP_163836958.1\|32312_33470_+\|tail	phage tail protein	A0A219YA67	Aeromonas_phage	6.7e-107	55.1
WP_163836959.1\|33484_33994_+\|tail	phage major tail tube protein	A0A219YB36	Aeromonas_phage	1.6e-36	44.6
WP_163836960.1\|33996_34254_+\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	5.6e-14	52.5
WP_163836961.1\|34259_34418_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_163836962.1\|34428_36909_+\|tail	phage tail tape measure protein	H7BVM4	unidentified_phage	3.6e-65	35.2
WP_163836963.1\|36901_37324_+\|tail	phage tail protein	K4I406	Acidithiobacillus_phage	1.3e-15	34.6
WP_163837013.1\|37347_37524_+\|tail	phage tail protein	Q94MF6	Enterobacteria_phage	9.1e-08	45.6
WP_163836964.1\|37848_38805_+	hypothetical protein	A0A219YA20	Aeromonas_phage	4.6e-61	40.7
WP_163836965.1\|39037_40279_+	MFS transporter	Q6JIH2	Burkholderia_virus	5.8e-24	27.8
WP_163836108.1\|40380_43488_-\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_163836109.1\|43678_44269_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	5.6e-41	49.2
WP_163836966.1\|44423_44618_+	hypothetical protein	NA	NA	NA	NA
WP_163837014.1\|44690_45698_+\|capsid	major capsid protein	D4HTU6	Vibrio_phage	1.2e-104	57.2
WP_163836967.1\|45681_46053_+	hypothetical protein	NA	NA	NA	NA
WP_163836968.1\|46027_46624_+	hypothetical protein	B0ZSF5	Halomonas_phage	8.7e-18	31.2
WP_163836969.1\|46616_47114_+	hypothetical protein	NA	NA	NA	NA
WP_163836970.1\|47097_47706_+\|plate	phage baseplate assembly protein V	A2I2X5	Vibrio_virus	1.2e-30	44.4
WP_163836971.1\|47702_48038_+\|plate	phage baseplate protein	A2I2X7	Vibrio_virus	7.8e-24	49.1
WP_163836972.1\|48034_49069_+\|plate	baseplate assembly protein	Q6R4V6	Vibrio_virus	8.7e-82	45.6
WP_163836973.1\|49065_49698_+\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	1.0e-24	36.7
WP_163836974.1\|49694_51002_+\|tail	phage tail protein	A0A2H4J931	uncultured_Caudovirales_phage	9.5e-25	35.3
WP_163836975.1\|51001_51535_+	hypothetical protein	A0A1Y0T1B3	Pseudomonas_phage	8.3e-12	28.8
WP_163836976.1\|51521_52007_+	hypothetical protein	NA	NA	NA	NA
WP_163836977.1\|52013_52505_+	hypothetical protein	NA	NA	NA	NA
WP_163836978.1\|52498_52669_+	hypothetical protein	NA	NA	NA	NA
WP_163836979.1\|52668_53838_+\|tail	phage tail protein	Q6R4W2	Vibrio_virus	1.5e-138	63.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048879

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP048880

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP048878

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP048881

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection