CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP049133	Ralstonia mannitolilytica strain Guangzhou-RMAB10 chromosome 2	1 crisprs	csa3	1	2	1	0
NZ_CP049132	Ralstonia mannitolilytica strain Guangzhou-RMAB10 chromosome 1	0 crisprs	DEDDh,PD-DExK,DinG,csa3,WYL,cas3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049133_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049133_1

979391-979611

Orphan

Consensus_repeat	Method
CGGTGTACGNGTCGAACTTG	CRT

5 spacers

The CRISPR arrays of NZ_CP049133_1

>merge|NZ_CP049133|1|979391-979611|CRT
CGGTGTACGGGTTGAACTTGTCACCGACCTTGGCACCTTCGGTGTACGTGTCGAACTTGCCGGCACGGGCGAGCGCGCCTTCCGTGTACGGATCGAACTTGCTCCCGGCCTTGGCGCCTTCGGTGTAGGTGTCGAACTTGCCGGTGCGGGCCAGGGCGCCCTGGGTGTACGGGTCGAACTTGTCGCCGACCTTGGCGCCTTCGGTGTACGGGTCGAACTTG

>NZ_CP049133|1|1|979391-979611|CRT
CGGTGTACGGGTTGAACTTG	TCACCGACCTTGGCACCTT
CGGTGTACGTGTCGAACTTG	CCGGCACGGGCGAGCGCGCCTT
CCGTGTACGGATCGAACTTG	CTCCCGGCCTTGGCGCCTT
CGGTGTAGGTGTCGAACTTG	CCGGTGCGGGCCAGGGCGCCCT
GGGTGTACGGGTCGAACTTG	TCGCCGACCTTGGCGCCTT
CGGTGTACGGGTCGAACTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049133.1\|WP_045218641.1\|974522_975191_+\|phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|224837
NZ_CP049133.1\|WP_045220291.1\|980374_980944_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP049133.1\|WP_045220289.1\|978941_979247_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049133.1\|WP_045218634.1\|970920_971823_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|214854
NZ_CP049133.1\|WP_045218639.1\|973948_974509_+\|HdeD-family-acid-resistance-protein	unknown	unknown	gnl\|CDD\|225786
NZ_CP049133.1\|WP_045218667.1\|990354_990777_+\|organic-hydroperoxide-resistance-protein	unknown	unknown	gnl\|CDD\|274649
NZ_CP049133.1\|WP_164491372.1\|980217_980385_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049133.1\|WP_045218654.1\|984035_984500_-\|flagellar-export-protein-FliJ	unknown	unknown	gnl\|CDD\|225437
NZ_CP049133.1\|WP_045220286.1\|976882_977104_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049133.1\|WP_045218652.1\|982448_984002_-\|flagellar-hook-length-control-protein	unknown	unknown	gnl\|CDD\|225686
NZ_CP049133.1\|WP_045218646.1\|977170_978196_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP049133.1\|WP_045218664.1\|989856_990192_+\|flagellar-hook-basal-body-complex-protein-FliE	unknown	unknown	gnl\|CDD\|178948
NZ_CP049133.1\|WP_045218669.1\|990839_991283_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP049133.1\|WP_164491399.1\|978192_978759_-\|DUF1345-domain-containing-protein	unknown	unknown	gnl\|CDD\|377769
NZ_CP049133.1\|WP_045218657.1\|986035_986773_-\|flagellar-assembly-protein-FliH	unknown	unknown	gnl\|CDD\|235562
NZ_CP049133.1\|WP_045220284.1\|972194_973061_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP049133.1\|WP_164491373.1\|984606_986046_-\|flagellar-protein-export-ATPase-FliI	unknown	unknown	gnl\|CDD\|274607
NZ_CP049133.1\|WP_045218637.1\|973163_973790_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|273358
NZ_CP049133.1\|WP_045218661.1\|987795_989622_-\|flagellar-basal-body-M-ring-protein-FliF	unknown	unknown	gnl\|CDD\|235668
NZ_CP049133.1\|WP_045218635.1\|971922_972198_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP049133.1\|WP_045218641.1\|974522_975191_+\|phosphoribosyltransferase	gnl\|CDD\|224837	COG1926, COG1926, Predicted phosphoribosyltransferases [General function prediction only].	8.62443e-74
NZ_CP049133.1\|WP_045220291.1\|980374_980944_-\|N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.52746e-73
NZ_CP049133.1\|WP_164491399.1\|978192_978759_-\|DUF1345-domain-containing-protein	gnl\|CDD\|377769	pfam07077, DUF1345, Protein of unknown function (DUF1345). This family consists of several hypothetical bacterial proteins of around 230 residues in length. The function of this family is unknown.	5.63051e-72
NZ_CP049133.1\|WP_045218634.1\|970920_971823_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|214854	smart00849, Lactamase_B, Metallo-beta-lactamase superfamily. Apart from the beta-lactamases a number of other proteins contain this domain. These proteins include thiolesterases, members of the glyoxalase II family, that catalyse the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid and a competence protein that is essential for natural transformation in Neisseria gonorrhoeae and could be a transporter involved in DNA uptake. Except for the competence protein these proteins bind two zinc ions per molecule as cofactor.	2.47655e-13
NZ_CP049133.1\|WP_045218639.1\|973948_974509_+\|HdeD-family-acid-resistance-protein	gnl\|CDD\|225786	COG3247, HdeD, Uncharacterized conserved protein [Function unknown].	8.75782e-26
NZ_CP049133.1\|WP_045218667.1\|990354_990777_+\|organic-hydroperoxide-resistance-protein	gnl\|CDD\|274649	TIGR03561, organ_hyd_perox, peroxiredoxin, Ohr subfamily. pfam02566, OsmC-like protein, contains several deeply split clades of homologous proteins. The clade modeled here includes the protein Ohr, or organic hydroperoxide resistance protein. [Cellular processes, Detoxification].	9.59237e-69
NZ_CP049133.1\|WP_045218664.1\|989856_990192_+\|flagellar-hook-basal-body-complex-protein-FliE	gnl\|CDD\|178948	PRK00253, fliE, flagellar hook-basal body protein FliE; Reviewed.	3.43507e-35
NZ_CP049133.1\|WP_045218654.1\|984035_984500_-\|flagellar-export-protein-FliJ	gnl\|CDD\|225437	COG2882, FliJ, Flagellar biosynthesis chaperone [Cell motility and secretion / Intracellular trafficking and secretion / Posttranslational modification, protein turnover, chaperones].	6.65042e-32
NZ_CP049133.1\|WP_045218646.1\|977170_978196_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.08867e-18
NZ_CP049133.1\|WP_045218669.1\|990839_991283_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	5.17818e-22
NZ_CP049133.1\|WP_045218652.1\|982448_984002_-\|flagellar-hook-length-control-protein	gnl\|CDD\|225686	COG3144, FliK, Flagellar hook-length control protein [Cell motility and secretion].	3.65588e-24
NZ_CP049133.1\|WP_045220284.1\|972194_973061_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	8.37646e-81
NZ_CP049133.1\|WP_164491373.1\|984606_986046_-\|flagellar-protein-export-ATPase-FliI	gnl\|CDD\|274607	TIGR03496, FliI_clade1, flagellar protein export ATPase FliI. Members of this protein family are the FliI protein of bacterial flagellum systems. This protein acts to drive protein export for flagellar biosynthesis. The most closely related family is the YscN family of bacterial type III secretion systems. This model represents one (of three) segment of the FliI family tree. These have been modeled separately in order to exclude the type III secretion ATPases more effectively. [Cellular processes, Chemotaxis and motility].	0
NZ_CP049133.1\|WP_045218637.1\|973163_973790_+\|LysE-family-transporter	gnl\|CDD\|273358	TIGR00949, Uncharacterized_membrane_protein_YahN, The Resistance to Homoserine/Threonine (RhtB) Family protein. [Transport and binding proteins, Amino acids, peptides and amines].	5.15533e-36
NZ_CP049133.1\|WP_045218661.1\|987795_989622_-\|flagellar-basal-body-M-ring-protein-FliF	gnl\|CDD\|235668	PRK06007, fliF, flagellar basal body M-ring protein FliF.	0
NZ_CP049133.1\|WP_045218657.1\|986035_986773_-\|flagellar-assembly-protein-FliH	gnl\|CDD\|235562	PRK05687, fliH, flagellar assembly protein FliH.	1.19302e-64

>NZ_CP049133.1|WP_045220289.1|978941_979247_-|hypothetical-protein
MIRSRPAIRLLPHIALAVAAALLAGCATVTPGPFQITVRDADDTVLERFQFQAGSQSSLQTALIGMCRVYPDATVTADQLNTHERLQERCNRSFASMLAPS
>NZ_CP049133.1|WP_164491399.1|978192_978759_-|DUF1345-domain-containing-protein
MLPAQGWLARMLLGWDVAVWSYLILISVMMLRADPRRIRAVARREDERAAAVLAVVCLGVVASMVAIAFELATAKSAGQAQASHYALTGVTVVGAWLMVPMMFTVHYAHLYYRTPHQPPLLFPDRELEPNYWDFLYFSFTIAVASQTADIGIRSRAMRRAVLGQSLLSFFFNTSILALSINIAAGLFS
>NZ_CP049133.1|WP_045218646.1|977170_978196_-|AI-2E-family-transporter
MTMLPPHAHTRTIDAVSYALVTAMIAAVLWLHLLPAAIAGFLVYSLARKLEARLRARHAVSKRAKAIAVIGVVLMAALILAGLGLGIGRLVEHGHGLEGMLTRVADVLDNLRESLPAAVADYVPLSVTELRTRLVEMLKEHGHQVSTLGIDGLRASALTLVGLILGAMVAWSDTPDPARHKPLAAALMTRLARLAEAFDAVVFAQVKISALNTALAAVYLLGAVPLFGQHVPYSKSLVLLTFVAGLIPVAGNLISNTAVVVMSVTASLELAVASLIFLVVVHKLEYFVNARIIGSRIDARAWELILALILMEAVFGVGGVIAAPVLYAYLKRELTEAGLIG
>NZ_CP049133.1|WP_045220286.1|976882_977104_+|hypothetical-protein
MMILLTGTLCHAMGDLFYQALLDDRVVCCFVTSEAVDVTGSGMRPAPAASFPCTDPRLADVSRSAGYCAPLVP
>NZ_CP049133.1|WP_045218641.1|974522_975191_+|phosphoribosyltransferase
MSAPFRDRLDAGRQLADALASLKLGEPRVVLALPRGGVPVGHAIARAVQAVLGVLLVRKLGAPLQPELALGALADCGAGMPPHVEWNTALLRTLAPTQAYLDAVTTQELAEMERRRARYGVTPTPLAGATVIVTDDGVATGATVRAALGAVRVARPARLALAVPVAPDTTWQALRAEVDDGVCLIAAPDPSFQAVGQYYRNFDQTEDSEVIALLADARQRNH
>NZ_CP049133.1|WP_045218639.1|973948_974509_+|HdeD-family-acid-resistance-protein
MLHTLSRLWWVLALRGMCALLIGVGAFVVPAATLAALVLAFGAYALVEGCLLLATSFGSHTPSHDRWPLVLQGLLGVAVGVLTLIHPAVTALGLLLYIAAWLLAQGVLQIVVAVRLREELAGEWWLILGGIASVLLAGWLLWGPEAGVLAVLWWIGAWAIVWGIALILAALRVRNWGRSGSARAFA
>NZ_CP049133.1|WP_045218637.1|973163_973790_+|LysE-family-transporter
MAELVAVAVITLLAVISPGADFAMVTRNSLLYGRRAGVLCALGIALGVQVHVFYTMFGVGLLIAHAPALLHGIKLVGAAYLVWIGWKTLSATAPLPGENSAGPAAPRALSTVAALRLGFFTNALNPKTTLFVVSTYTQLVHPGTPLAAQFGYGLFMSTAHAAWFALVATVFASGALRRSLVARQRTVDRIIGMILIGLGLALGLARLA
>NZ_CP049133.1|WP_045220284.1|972194_973061_-|LysR-family-transcriptional-regulator
MALPPLNTLRVFEAAARHGSFVRAAQELHVTHGAVSRQIRLLEDSLGVALFARRNRAVFLTPAGEQLRAAAADAFSILTDSIDRIARRAASSTLVVSCEPTLAMRWLIPRLSRFQARHPHVQVHLFAAGGPIDFKRTGVDVAVRRNDFAWPAHVHAAPICDEWIGPVHAPSTDTVARRRLLHTATRPDAWQTWWRVSGLARPRGRLPEARYEHFYLSLQAALAGQGVAIASKLMAGDDLKDGRLVAPQGFRRDGSAYCLLADAPIAPDSAAGAWLAWLREETAATLAA
>NZ_CP049133.1|WP_045218635.1|971922_972198_+|hypothetical-protein
MDDLIRIENEYDRQTVAWLRERLGDQALCEVVMRMGGRGRPYASEVCRTLSLTPPPRKRATRARPLNRAVGESYLATIRAILGGSNRHAAV
>NZ_CP049133.1|WP_045218634.1|970920_971823_+|MBL-fold-metallo-hydrolase
MNTAIQRADFGRVSVFFGEKRGKYPDGNQVVIRGADTLAAFDTPIVSNHIGPEFDATELVVMGHAHEDHMAGLHRLPHASVHVNEADLAAVRSWAGMVAHYGIDEAQAPAMLANIQRDFFYAPRPDAQGYTDGATWGLGRAQIRAYHMPGHTAGHTVLVVEPEGVAFIGDIDLTGFGPYYGDACSSLRDFRRSLERLPDIRAKVWVTSHHRGIYTDRDHFLRDLAAYTAKLDEREQRLLAMLHSSPKTLGQLVEQRLLYPPGHEALWVVSAETRTISQHLAELGRDGRVRMDDEGRYHAN
>NZ_CP049133.1|WP_164491372.1|980217_980385_+|hypothetical-protein
MKRLLLAMTVLGAALLSGCGVVAAPCRVASAGLKMVPLVGHVAAAPTDACADIID
>NZ_CP049133.1|WP_045220291.1|980374_980944_-|N-acetyltransferase
MSSAQPSDVSPAAHNGAIRIRAATTADLPAIVAIYAHHVRTGTASFEIDPPDAAEMTRRYQTLHDAGMPYIVAEAAGGEVLGYAYAGPHRARPAYRHTVEDSIYLHTDAQGRGVGTLLLQALIAECQARGFKQMVAVVGGGLENAGSARLHARCGFREVGVLQAVGYKFGRWLDCLLMQRTLEDPPPSQ
>NZ_CP049133.1|WP_045218652.1|982448_984002_-|flagellar-hook-length-control-protein
MGLSATPNAAVKDLGAMLSAGNAPAARASAASSGADTFGNLLSDRVTQEAERRRATAQSAADDAGRRADIARKDAARANAARDDQDAGPVERTPGAQVETTPASSTANVPNAKPAAAEDLDTAAQQTVVDPAAQLAAQIEAARQAAQQAAAAQVPALPTAAPSASDAHADAMTQPAGKPATNDAATLAALNAAATNTQGANTDAAASQAAAQAPNDANANATAVSNAPTAPTAALPDGHALAQTLARTRAVGDNTPPGVRQLGSTSQAQNAGAEHGLPRRSDASAHGAAGSTAASVADVTNRTGGNGTGADSAGTQADTSGAGAQFEGILTRAHGDASAAAPTFAVGGVGATGAAAAASITPAQAHALPTFGDAAWPHTMASQLAFMQVHRQSSAELQLNPAELGGLHVKLEVDNGAVNASFVCQHQAVAELVQDAMPRLRDAMHQGGMQLAQTSVSTGDFSQQQGASQGSSAQGNGSGNGGNGSRFGSGATPERSDTVATVPRRASAHDGAIDTFA
>NZ_CP049133.1|WP_045218654.1|984035_984500_-|flagellar-export-protein-FliJ
MTTGTAPFRLETVLELAQKDTEKATQEVGRLMNTREAATQKLALLADYRLNYHQQMLATAEGGIDATRLRNYAAFIDRLGSAVHQQKGTISALERQLEASRANWLEKQRREQSFDVLRQRHLEEQRLHQERRAQRENDEHAAKLIRMRAAQGGN
>NZ_CP049133.1|WP_164491373.1|984606_986046_-|flagellar-protein-export-ATPase-FliI
MSPETVQPSDQPAANNAHVRLWQTHLRQTAQRARLARPVVTCGKLTRVAGLVMEAVGLKLPVGSACRVELPHGRHVLAEVVGFAEERAFLMPQTDLVGVVPGRAFLPLEPQRLPADAADPTISHSKFLPVGPRLLGRVVDANGEPLDGKGPLGTHEELAWGTLNPAPLNPLKRKPIEHVLDVGVRAINGLLTVGQGQRLGLFAGSGVGKSVLLGMMARYTQADVVVVGLIGERGREVKEFIDEILGDEGLARSAVVAAPADTSPLMRLQGAAYAHTIAEYFRDRGCNVLLIVDSLTRYAMAQREIALAIGEPPATKGYPPSAFAKLPALVERAGNGMVDANGRGGSITAFYTVLAEGDDQQDPIADAARAILDGHFVLSRKLAEQGHYPAIDIEQSISRVMSAIVPREELDAARRFKQLYARYQRNRDLIAVGAYARGSDPVTDQAIARYPDMEAFLQQGMFENESREHTLQKMLGVLA
>NZ_CP049133.1|WP_045218657.1|986035_986773_-|flagellar-assembly-protein-FliH
MPRPPIIPRDTLVEYQPWEPTDFVREAERAALEAAPPPPPPEPEEPPISEEEWQAALDAELANARDEGRRDGFAQGFQDGFEQGRRQGEEDARQIAALMQSVREAVDELNGSVAQELVDLALQLAQQFVRGALHAQPERILPLVREVLGDASTAPAPAMLRVHADDAELIRQTLGAELDAAGWTLIVDAAIERGGCRVQTRFGETDATLQTRWAELTRALARDTAWLASERIEAERVAGGALHVA
>NZ_CP049133.1|WP_045218661.1|987795_989622_-|flagellar-basal-body-M-ring-protein-FliF
MPTTADSVAVADTLGTVDMPAGGHGAIARQNAGALGALGPLGRLSPRLLMMIGAAALVAVIAAAMLWSRAPDYRVLFSNVSDSDGGAIIAALQQMNVPYRFADGGTAIMVPEANVHETRLKLASQGLPKGGLAGFELMENQKFGTSQFAEQVNYQRALEGELARTIQAMQEVQSARVHLALSKPSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSSSVPNLPLANVTVVDQSGRLLSTAFQDNASGLDPTQLNYVREIEQGYIKRIEAILGPVVGEDNVRAQVTADVDLDSTEQMAETYRPNQDPATAAVRSTHTAESTQNKADAQGGVPGALSNQPPTAPRMLPTAPAPASASQPGATGPNGQPQQPAVANANAATSNGVTSSTRDTTTNYEVDKTVRRTRAAVGTVRRLSVAVVVNYRVDGKTWKPLTEAEMTKLNALVKDAVGFDAKRGDSVNVVNSQFSGTLPAAKDDLPLWKQPEMIQYGIQAAKYGALAIGFLILVFAVIRPLIRSIGKKEEPVTPTFVGREGEDPNAPIITGAAAPAGPELEGPAANAEDGEDVPESLPQLKNADFEKKLETMRRVAQSNPRAVAAVIKQWVSNE
>NZ_CP049133.1|WP_045218664.1|989856_990192_+|flagellar-hook-basal-body-complex-protein-FliE
MNMTNANSVVSLMNSVLAPTGQVGGIGSGAGGDDAKVSVDFGAVLKSSLDKVDASQQKAESISRSFEMGNNDVDLHDVMLSLQKANIDLQTAVQVRNKLVSAYQSIMSMSI
>NZ_CP049133.1|WP_045218667.1|990354_990777_+|organic-hydroperoxide-resistance-protein
MKTLYQTQVTAEGGRAGHVRSADGTLDLALSLPRELGGAGGAATNPEQLFAAGYAACFENAVLHVARLRQVKLASTAVTATVGIGPREDGGFALTVALVATLGGVDQATAEALVAAAHGVCPYSHAVRGNIDVQLTTVAR
>NZ_CP049133.1|WP_045218669.1|990839_991283_+|MarR-family-transcriptional-regulator
MNDVLALDQQLCFPLYAAGHLLTRLYRPLLDELGLTYPQYLVMMACWQQAPCAVGDLGRTLYLDTGTLTPLLKRLEEQGLVTRTRDRDDQRRVVIELTDSGRALRERAAKVPEALACRIPLERDEIGATRNVLRKLLDALAAADDRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP049133_1	1.5\|979573\|19\|NZ_CP049133\|CRT	979573-979591	19	NZ_CP049132.1	529057-529075	2	0.895

1. spacer 1.5|979573|19|NZ_CP049133|CRT matches to position: 529057-529075, mismatch: 2, identity: 0.895

tcgccgaccttggcgcctt	CRISPR spacer
tcgcccgccttggcgcctt	Protospacer
***** .************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	510651-510672	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	497944-497965	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1895242-1895263	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	9501-9522	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	538740-538761	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	495122-495143	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	406477-406498	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	509543-509564	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	510651-510672	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	495122-495143	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	184488-184509	1	0.955
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	840798-840819	2	0.909
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	64919-64940	2	0.909
NZ_CP049133_1	1.4\|979531\|22\|NZ_CP049133\|CRT	979531-979552	22	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1423580-1423601	2	0.909
NZ_CP049133_1	1.2\|979450\|22\|NZ_CP049133\|CRT	979450-979471	22	NC_020562	Sphingomonas sp. MM-1 plasmid pISP1, complete sequence	97940-97961	3	0.864
NZ_CP049133_1	1.4\|979531\|22\|NZ_CP049133\|CRT	979531-979552	22	NZ_CP031159	Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence	8179-8200	3	0.864

1. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

2. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

3. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggcgagggcgcctt	Protospacer
************** *******

4. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcaccggcgagcgcgcctt	Protospacer
******* **************

5. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

6. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

7. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

8. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

9. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

10. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggagagcgcgcctt	Protospacer
********** ***********

11. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 1, identity: 0.955

ccggcacgggcgagcgcgcctt	CRISPR spacer
ccggcacgggcgagctcgcctt	Protospacer
*************** ******

12. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 2, identity: 0.909

ccggcacgggcgagcgcgcctt	CRISPR spacer
gcggcacgggcgagcgcgccct	Protospacer
 *******************.*

13. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.909

ccggcacgggcgagcgcgcctt	CRISPR spacer
gcggcacgggcgagcgcgccgt	Protospacer
 ******************* *

14. spacer 1.4|979531|22|NZ_CP049133|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 2, identity: 0.909

ccggtgcgggccagggcgccct	CRISPR spacer
tcggtgcgggtcagggcgccct	Protospacer
.*********.***********

15. spacer 1.2|979450|22|NZ_CP049133|CRT matches to NC_020562 (Sphingomonas sp. MM-1 plasmid pISP1, complete sequence) position: , mismatch: 3, identity: 0.864

ccggcacgggcgagcgcgcctt	CRISPR spacer
tcggcacgggcgagcgcgccgc	Protospacer
.******************* .

16. spacer 1.4|979531|22|NZ_CP049133|CRT matches to NZ_CP031159 (Deinococcus wulumuqiensis strain NEB 479 plasmid pDrdA, complete sequence) position: , mismatch: 3, identity: 0.864

ccggtgcgggccagggcgccct	CRISPR spacer
tcggtgcgggccagggcgccac	Protospacer
.******************* .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

615115 : 682915

Ralstonia_phage(37.5%)

coat,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_164491343.1\|615115_616264_-	zonular occludens toxin	Q6UAZ2	Ralstonia_phage	6.3e-166	75.7
WP_115043926.1\|616271_616589_-	DUF2523 domain-containing protein	Q6UAZ3	Ralstonia_phage	4.0e-30	74.5
WP_164491344.1\|616588_618028_-\|coat	coat protein	Q6UAZ4	Ralstonia_phage	2.3e-112	58.7
WP_164491345.1\|618171_618387_-\|coat	phage coat protein	Q6UAZ5	Ralstonia_phage	4.5e-09	63.6
WP_164491346.1\|618391_618625_-\|coat	phage coat protein	Q6UAZ6	Ralstonia_phage	3.0e-30	84.4
WP_164491347.1\|619062_620253_-	replication protein	NA	NA	NA	NA
WP_164491397.1\|620257_620566_-	hypothetical protein	NA	NA	NA	NA
WP_164491348.1\|620779_621076_+	helix-turn-helix transcriptional regulator	A0A097ZIG4	Ralstonia_phage	1.8e-16	51.8
WP_024979352.1\|621311_624245_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	1.6e-48	23.6
WP_024979354.1\|625355_627284_-	c-type cytochrome	NA	NA	NA	NA
WP_024979355.1\|627430_627865_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_024979356.1\|627950_630353_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.6e-145	46.6
WP_064809139.1\|630422_630935_+	signal peptidase II	NA	NA	NA	NA
WP_024979358.1\|630998_631847_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_024979359.1\|631932_632556_+	YdcF family protein	NA	NA	NA	NA
WP_024979360.1\|632729_633068_-	hypothetical protein	NA	NA	NA	NA
WP_045220190.1\|633522_633750_-	hypothetical protein	NA	NA	NA	NA
WP_052698571.1\|633881_634388_-	CzcE family metal-binding protein	NA	NA	NA	NA
WP_157773972.1\|634507_634888_-	hypothetical protein	NA	NA	NA	NA
WP_045220186.1\|635270_635609_-	hypothetical protein	NA	NA	NA	NA
WP_045220184.1\|635605_638776_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_045220182.1\|638772_640308_-	efflux RND transporter periplasmic adaptor subunit	S5VL44	Leptospira_phage	6.8e-06	27.0
WP_045220180.1\|640304_641606_-	TolC family protein	NA	NA	NA	NA
WP_024979368.1\|641676_642090_-	hypothetical protein	NA	NA	NA	NA
WP_045220528.1\|642338_642767_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_045220178.1\|642779_645188_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.1e-86	36.7
WP_052698572.1\|645300_645684_+	hypothetical protein	NA	NA	NA	NA
WP_045220176.1\|645790_646048_+	hypothetical protein	NA	NA	NA	NA
WP_045220523.1\|646179_646491_+	hypothetical protein	NA	NA	NA	NA
WP_045220174.1\|646542_646788_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_045220521.1\|646946_647609_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_045220170.1\|647667_647997_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_045220169.1\|648115_650053_+	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_045220167.1\|650135_650810_-	c-type cytochrome	NA	NA	NA	NA
WP_045220165.1\|651030_651393_-	hypothetical protein	NA	NA	NA	NA
WP_045220164.1\|651903_652137_-	hypothetical protein	NA	NA	NA	NA
WP_045220162.1\|652379_653777_-	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	2.4e-18	26.0
WP_045220160.1\|653776_654463_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-32	36.7
WP_045220158.1\|654635_656492_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_045220156.1\|656491_657514_+	copper resistance protein B	NA	NA	NA	NA
WP_045220154.1\|657545_657932_+	copper homeostasis periplasmic binding protein CopC	NA	NA	NA	NA
WP_045220151.1\|657936_658866_+	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_045220149.1\|658897_659386_+	DUF411 domain-containing protein	NA	NA	NA	NA
WP_099050667.1\|659879_660272_+	histidine kinase	NA	NA	NA	NA
WP_045220146.1\|660424_660685_+	hypothetical protein	NA	NA	NA	NA
WP_082076267.1\|660808_661087_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_009240712.1\|661308_661656_+	cobalt-zinc-cadmium resistance protein	NA	NA	NA	NA
WP_024979375.1\|661720_662974_+	TolC family protein	NA	NA	NA	NA
WP_045220140.1\|667817_668792_+	cation transporter	A0A1V0SED0	Indivirus	1.3e-10	31.2
WP_045220137.1\|668788_669466_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	8.9e-35	35.2
WP_024979379.1\|671267_672260_+	DNA-binding protein	NA	NA	NA	NA
WP_045220132.1\|672529_673420_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_045220129.1\|673662_679500_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.1e-187	37.9
WP_045220126.1\|679798_680074_-	hypothetical protein	NA	NA	NA	NA
WP_157774031.1\|680124_680601_-	hypothetical protein	NA	NA	NA	NA
WP_004633552.1\|680619_680991_+\|transposase	transposase	NA	NA	NA	NA
WP_146049720.1\|680978_681323_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_009238807.1\|681385_682915_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.4e-115	46.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP049132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8969 : 79131

uncultured_virus(15.38%)

coat,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009238807.1\|8969_10499_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.4e-115	46.1
WP_146049720.1\|10561_10906_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_004633552.1\|10893_11265_-\|transposase	transposase	NA	NA	NA	NA
WP_009238807.1\|11644_13174_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.4e-115	46.1
WP_146049720.1\|13236_13581_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_004633552.1\|13568_13940_-\|transposase	transposase	NA	NA	NA	NA
WP_164490849.1\|14917_15211_+	DUF2252 family protein	NA	NA	NA	NA
WP_045785498.1\|15538_16348_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_045785499.1\|16344_17172_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_045785500.1\|17240_17966_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_045785501.1\|17962_18616_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_045785502.1\|18602_19340_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-29	39.4
WP_045785503.1\|19458_21027_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_045785504.1\|21821_24047_-	response regulator	NA	NA	NA	NA
WP_045785505.1\|24248_24863_+	glutathione S-transferase	NA	NA	NA	NA
WP_045785506.1\|24890_26057_-	HPP family protein	NA	NA	NA	NA
WP_102080629.1\|26297_28283_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_045787730.1\|28287_29136_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_045785509.1\|30000_30603_+	hypothetical protein	NA	NA	NA	NA
WP_045785510.1\|30717_31908_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.3e-120	59.1
WP_164490850.1\|32151_33003_+	lysophospholipid acyltransferase family protein	NA	NA	NA	NA
WP_045787731.1\|33016_33910_+	lauroyl acyltransferase	NA	NA	NA	NA
WP_045785512.1\|34000_34885_+	diaminopimelate epimerase	NA	NA	NA	NA
WP_045785513.1\|34934_35762_+	polyphosphate kinase 2 family protein	NA	NA	NA	NA
WP_045785514.1\|36408_37086_-	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_045785515.1\|37118_37904_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_045785516.1\|38031_39045_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_045785517.1\|39241_40105_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_045785518.1\|40124_41072_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045787732.1\|41148_41904_-	YdcF family protein	NA	NA	NA	NA
WP_045785520.1\|42645_43233_+	nitroreductase family protein	NA	NA	NA	NA
WP_164490851.1\|44215_45097_-	hypothetical protein	NA	NA	NA	NA
WP_045785522.1\|45449_46394_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_045785523.1\|46512_47811_+	muropeptide transporter	NA	NA	NA	NA
WP_164490852.1\|47802_48996_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_045785525.1\|49012_49828_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_045787734.1\|49848_50247_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_045785526.1\|50532_51462_-	arginase	A0A1V0SJM8	Klosneuvirus	6.5e-12	27.2
WP_045787735.1\|51486_52713_-	ornithine--oxo-acid transaminase	A0A1V0SKB7	Klosneuvirus	2.5e-27	27.2
WP_045785527.1\|52831_53758_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_045785528.1\|53781_55290_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_045785529.1\|55410_56136_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_045785530.1\|56192_57158_+	HlyD family secretion protein	NA	NA	NA	NA
WP_045785531.1\|57154_58117_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.0e-21	31.2
WP_045785532.1\|58113_59289_+	ABC transporter permease	NA	NA	NA	NA
WP_045785533.1\|59296_60880_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_045785534.1\|61158_62112_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_045785535.1\|62263_63199_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.6e-103	72.1
WP_045785536.1\|63505_64873_+	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A0N7G7I9	Chrysochromulina_ericina_virus	2.0e-33	37.2
WP_045785537.1\|65004_66843_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	5.1e-149	46.6
WP_164490853.1\|68128_68425_+	hypothetical protein	NA	NA	NA	NA
WP_164491265.1\|68989_69553_+	hypothetical protein	A0A2H4J137	uncultured_Caudovirales_phage	5.1e-44	50.8
WP_045785541.1\|69555_70689_+	hypothetical protein	A0A2H4J138	uncultured_Caudovirales_phage	9.9e-87	47.3
WP_045785543.1\|72032_72467_+	VOC family protein	NA	NA	NA	NA
WP_164490854.1\|72567_73971_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.0e-21	39.2
WP_164490855.1\|74066_74360_+	hypothetical protein	NA	NA	NA	NA
WP_164490856.1\|74489_75005_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_164490857.1\|74928_75789_+	molecular chaperone	NA	NA	NA	NA
WP_164490858.1\|78165_79131_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_2

779352 : 814754

Acidithiobacillus_phage(38.24%)

head,portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102080537.1\|779352_780504_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.6e-29	31.4
WP_102080538.1\|780522_780987_-	lysozyme	K4I410	Acidithiobacillus_phage	3.4e-70	82.7
WP_164490937.1\|780983_781460_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	3.3e-76	89.2
WP_164490938.1\|781456_781756_-	hypothetical protein	K4I011	Acidithiobacillus_phage	7.7e-23	67.9
WP_102080337.1\|781818_782172_-	DUF2793 domain-containing protein	A0A2H4GY35	Pseudomonas_phage	6.7e-34	61.0
WP_102080338.1\|782173_784396_-	hypothetical protein	A0A125SA60	Pseudomonas_phage	7.9e-173	45.5
WP_102080339.1\|784392_784608_-	hypothetical protein	L7P7U5	Pseudomonas_phage	3.0e-05	41.5
WP_102080340.1\|784604_784835_-	hypothetical protein	A0A0S0N2N8	Pseudomonas_phage	3.6e-12	50.0
WP_164490939.1\|784844_785648_-	DUF2163 domain-containing protein	A0A2H4GXY6	Pseudomonas_phage	1.6e-54	39.2
WP_164490940.1\|785644_787327_-	hypothetical protein	J9SU43	Pseudomonas_phage	2.2e-74	35.0
WP_164490941.1\|787327_788470_-	hypothetical protein	A0A2H4GY31	Pseudomonas_phage	2.3e-19	29.5
WP_164490942.1\|788477_789449_-	hypothetical protein	W8VMF4	Pseudomonas_phage	4.1e-25	30.4
WP_164490943.1\|789451_792652_-	tape measure protein	K7RVL7	Vibrio_phage	3.3e-39	42.3
WP_164490944.1\|792655_793303_-	hypothetical protein	NA	NA	NA	NA
WP_164491270.1\|793280_793493_-	hypothetical protein	NA	NA	NA	NA
WP_164490945.1\|793492_793882_-	hypothetical protein	NA	NA	NA	NA
WP_164490946.1\|793894_794647_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	1.3e-55	49.6
WP_164490947.1\|794649_794823_-	hypothetical protein	NA	NA	NA	NA
WP_164490948.1\|794829_795255_-	hypothetical protein	D6PGA7	uncultured_phage	3.6e-10	31.2
WP_164490949.1\|795266_795551_-	hypothetical protein	NA	NA	NA	NA
WP_164490950.1\|795550_796561_-\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	9.3e-113	67.0
WP_164490951.1\|796563_796944_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	8.5e-27	52.0
WP_164490952.1\|796945_798181_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	6.8e-65	41.7
WP_164490953.1\|798190_799702_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	8.1e-153	56.7
WP_009521789.1\|799701_799908_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	9.6e-25	91.2
WP_164490954.1\|799915_801886_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	92.4
WP_164490955.1\|801896_802424_-	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	1.4e-88	97.1
WP_164490956.1\|802529_802727_+	hypothetical protein	NA	NA	NA	NA
WP_164490957.1\|802824_803355_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.7e-44	87.3
WP_164490958.1\|803452_803821_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	1.4e-55	86.1
WP_164490959.1\|803784_805053_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	1.8e-238	95.0
WP_164491271.1\|805049_806459_-	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	1.5e-164	60.9
WP_164490960.1\|806774_807203_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164490961.1\|807195_807399_-	hypothetical protein	NA	NA	NA	NA
WP_164490962.1\|807400_807865_-	crossover junction endodeoxyribonuclease RuvC	K4ICN3	Acidithiobacillus_phage	4.3e-57	70.5
WP_164490963.1\|808004_810284_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	6.9e-289	64.4
WP_164490964.1\|810280_810535_-	hypothetical protein	K4I1D6	Acidithiobacillus_phage	5.2e-20	73.4
WP_164490965.1\|810531_811269_-	hypothetical protein	K4HZA0	Acidithiobacillus_phage	6.4e-111	76.6
WP_164490966.1\|811265_811754_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	1.5e-71	79.2
WP_164490967.1\|811762_812389_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	2.1e-78	71.4
WP_164490968.1\|813999_814479_-	hypothetical protein	K4HZ96	Acidithiobacillus_phage	9.7e-52	63.3
WP_164490969.1\|814490_814754_-	helix-turn-helix domain-containing protein	K4I3X3	Acidithiobacillus_phage	3.1e-28	75.9

DBSCAN-SWA_3

3079624 : 3166428

Acidithiobacillus_phage(35.0%)

protease,tail,head,portal,coat,terminase,integrase,capsid

attL 3085442:3085458|attR 3136902:3136918

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045785168.1\|3079624_3080140_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
WP_082062834.1\|3080063_3080924_+	molecular chaperone	NA	NA	NA	NA
WP_164491192.1\|3080923_3083302_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_164491293.1\|3083301_3084264_+\|coat	spore coat protein U domain-containing protein	NA	NA	NA	NA
WP_164491193.1\|3084767_3086021_+	Hsp70 family protein	M4R062	Micromonas_pusilla_virus	4.0e-12	24.4
3085442:3085458	attL	NA	NA	NA	NA
WP_102080217.1\|3086181_3086457_-	hypothetical protein	NA	NA	NA	NA
WP_102080937.1\|3087915_3088632_-	hypothetical protein	A0JC17	Ralstonia_phage	2.2e-44	41.5
WP_164491194.1\|3091872_3093825_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_045785179.1\|3093938_3094730_-	glycosyltransferase	NA	NA	NA	NA
WP_080324167.1\|3094934_3095819_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_009238668.1\|3096849_3097647_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_105857203.1\|3097659_3098520_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_123876282.1\|3100934_3101246_-	hypothetical protein	NA	NA	NA	NA
WP_104566654.1\|3101242_3102142_-\|integrase	integrase arm-type DNA-binding domain-containing protein	B7SYF8	Stenotrophomonas_phage	7.6e-50	39.6
WP_102080524.1\|3104256_3104754_-	DUF3368 domain-containing protein	NA	NA	NA	NA
WP_102080525.1\|3104750_3105083_-	prevent-host-death family protein	NA	NA	NA	NA
WP_164491195.1\|3105324_3107169_+	N-6 DNA methylase	A0A220A2U4	Liberibacter_phage	6.8e-61	32.8
WP_102080527.1\|3107165_3108389_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_164491196.1\|3108385_3111328_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	5.7e-78	29.1
WP_102080529.1\|3111324_3111687_+	M48 family metallopeptidase	NA	NA	NA	NA
WP_164491197.1\|3111715_3113068_+	phospholipase	NA	NA	NA	NA
WP_102080530.1\|3113295_3113577_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_008906266.1\|3113612_3114182_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_164491198.1\|3114275_3117125_+	heat shock survival AAA family ATPase ClpK	K4FB40	Cronobacter_phage	9.0e-129	40.9
WP_164491199.1\|3117142_3118573_+	cardiolipin synthase	NA	NA	NA	NA
WP_164491200.1\|3118600_3120481_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	5.4e-106	41.6
WP_164491201.1\|3120477_3120918_+	heat resistance system thioredoxin Trx-GI	A0A1J0GW78	Streptomyces_phage	1.7e-10	35.9
WP_164491202.1\|3120921_3122637_+	heat resistance system K+/H+ antiporter KefB-GI	NA	NA	NA	NA
WP_164491203.1\|3122633_3123131_+	heat resistance protein PsiE-GI	NA	NA	NA	NA
WP_164491204.1\|3123108_3124074_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_164491205.1\|3124097_3125249_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	3.3e-29	31.4
WP_164491206.1\|3125267_3125732_-	lysozyme	K4I410	Acidithiobacillus_phage	1.3e-69	81.3
WP_164491207.1\|3125728_3126205_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	2.4e-74	87.3
WP_102080540.1\|3126201_3126507_-	hypothetical protein	K4I011	Acidithiobacillus_phage	3.2e-24	63.5
WP_102080541.1\|3126644_3126866_-	hypothetical protein	NA	NA	NA	NA
WP_102080542.1\|3126858_3128883_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	7.7e-58	38.3
WP_102080543.1\|3128886_3129282_-	hypothetical protein	J7FAS1	Agrobacterium_phage	1.1e-08	34.7
WP_102080544.1\|3129278_3130364_-	hypothetical protein	NA	NA	NA	NA
WP_102080545.1\|3130367_3131636_-	hypothetical protein	A0A0M5TJJ3	Ralstonia_phage	8.9e-36	29.0
WP_102080546.1\|3131664_3135249_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	2.5e-229	40.2
WP_102080547.1\|3135250_3135658_-	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	6.3e-28	47.1
WP_102080548.1\|3135668_3139712_-\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	2.5e-31	29.2
3136902:3136918	attR	NA	NA	NA	NA
WP_102080549.1\|3139778_3140030_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_102080550.1\|3140026_3140440_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_102080551.1\|3140443_3141088_-	hypothetical protein	NA	NA	NA	NA
WP_084690661.1\|3141062_3141284_-	hypothetical protein	NA	NA	NA	NA
WP_102080954.1\|3141280_3141676_-	hypothetical protein	NA	NA	NA	NA
WP_102080552.1\|3141687_3142440_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	1.9e-46	44.2
WP_102080553.1\|3142436_3142649_-	hypothetical protein	NA	NA	NA	NA
WP_102080554.1\|3142655_3143102_-	hypothetical protein	NA	NA	NA	NA
WP_102080555.1\|3143105_3143408_-	hypothetical protein	NA	NA	NA	NA
WP_102080556.1\|3143407_3144412_-\|capsid	major capsid protein	Q9JMM2	Wolbachia_phage	4.4e-123	66.5
WP_102080557.1\|3144414_3144792_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	4.2e-26	51.2
WP_102080558.1\|3144793_3146026_-	S49 family peptidase	K4HZZ6	Acidithiobacillus_phage	1.5e-64	42.4
WP_102080559.1\|3146048_3147572_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	2.6e-151	55.8
WP_102080560.1\|3147583_3147805_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	3.4e-12	58.9
WP_102080561.1\|3147804_3148197_-	hypothetical protein	NA	NA	NA	NA
WP_102080562.1\|3148196_3148688_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	2.7e-25	48.5
WP_102080563.1\|3148724_3150689_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	89.9
WP_102080564.1\|3150691_3151237_-	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	3.9e-73	80.7
WP_102080565.1\|3151344_3151611_+	hypothetical protein	NA	NA	NA	NA
WP_102080566.1\|3151687_3152206_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.4e-32	77.4
WP_102080567.1\|3152303_3152672_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	2.5e-63	95.7
WP_102080568.1\|3152635_3153904_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	5.3e-230	91.9
WP_102080569.1\|3153900_3155298_-	site-specific DNA-methyltransferase	K4I3Y2	Acidithiobacillus_phage	2.0e-161	60.4
WP_164491208.1\|3155664_3156063_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164491209.1\|3156055_3156265_-	hypothetical protein	NA	NA	NA	NA
WP_164491210.1\|3156266_3156743_-	crossover junction endodeoxyribonuclease RuvC	K4ICN3	Acidithiobacillus_phage	9.3e-63	76.8
WP_164491211.1\|3159158_3159386_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164491212.1\|3159382_3160120_-	hypothetical protein	K4HZA0	Acidithiobacillus_phage	1.4e-105	75.0
WP_164491213.1\|3160116_3160605_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	8.0e-70	78.0
WP_164491214.1\|3161254_3162112_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.8e-110	71.4
WP_164491215.1\|3162108_3162870_-	hypothetical protein	K4I1D2	Acidithiobacillus_phage	1.4e-89	69.4
WP_164491216.1\|3162872_3163154_-	hypothetical protein	NA	NA	NA	NA
WP_164491217.1\|3163156_3163636_-	hypothetical protein	K4HZ96	Acidithiobacillus_phage	1.2e-54	66.5
WP_164491218.1\|3163647_3163911_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_164491219.1\|3164087_3164552_-	hypothetical protein	K4HZX2	Acidithiobacillus_phage	9.8e-17	39.7
WP_164491220.1\|3164548_3165961_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	3.4e-137	59.8
WP_164491221.1\|3165957_3166428_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	3.1e-34	50.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049133

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP049132

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection