CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP049243	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
NZ_CP049245	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed4, complete sequence	0 crisprs	NA	0	1
NZ_CP049242	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	2 crisprs	csa3,cas3HD	9	2
NZ_CP049241	Rhizobium pseudoryzae strain DSM 19479 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,cas4,WYL	0	299

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

54959 : 128733

Streptococcus_phage(11.11%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165225617.1\|54959_55991_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	3.9e-05	32.2
WP_165225620.1\|56192_57206_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_165225623.1\|58779_59088_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_165225626.1\|59258_60314_+	Fic family protein	D7RWK9	Brochothrix_phage	3.2e-07	25.9
WP_165225628.1\|61365_61530_+	hypothetical protein	NA	NA	NA	NA
WP_165225631.1\|61851_62331_+	hypothetical protein	NA	NA	NA	NA
WP_165225976.1\|63287_63869_-	thermonuclease family protein	NA	NA	NA	NA
WP_165225633.1\|64100_66077_-	Ti-type conjugative transfer system protein TraG	NA	NA	NA	NA
WP_165225636.1\|66069_66285_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_165225639.1\|66289_66586_-	TraC family protein	NA	NA	NA	NA
WP_165225642.1\|66841_70153_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	1.2e-15	28.4
WP_165225645.1\|70149_70716_+	conjugative transfer signal peptidase TraF	NA	NA	NA	NA
WP_165225648.1\|70705_71869_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_165225651.1\|71886_72501_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_165225656.1\|72517_72895_-	DUF5615 family PIN-like protein	NA	NA	NA	NA
WP_165225979.1\|72891_73524_-	DUF433 domain-containing protein	NA	NA	NA	NA
WP_165225659.1\|73750_74005_-	hypothetical protein	NA	NA	NA	NA
WP_165225661.1\|74166_74952_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_165225664.1\|75041_76496_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_165225667.1\|77519_78539_+	hypothetical protein	NA	NA	NA	NA
WP_165225670.1\|78825_79773_+	hypothetical protein	NA	NA	NA	NA
WP_165225673.1\|79806_80184_+	hypothetical protein	NA	NA	NA	NA
WP_165225676.1\|80230_80737_+	hypothetical protein	NA	NA	NA	NA
WP_165225982.1\|80759_81314_-	transglutaminase-like cysteine peptidase	V9QJI1	Rhizobium_phage	1.3e-20	38.5
WP_165225679.1\|81602_83051_+	O-antigen ligase family protein	NA	NA	NA	NA
WP_165225682.1\|83206_84391_+	polysaccharide export protein	NA	NA	NA	NA
WP_165225685.1\|84620_85370_+	hypothetical protein	NA	NA	NA	NA
WP_165225687.1\|85439_87677_+	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_165225690.1\|87663_88407_+	hypothetical protein	NA	NA	NA	NA
WP_165225693.1\|88435_89227_-	serine/threonine protein phosphatase	S5MD19	Sinorhizobium_phage	7.0e-23	33.8
WP_165225696.1\|89329_89866_-	hypothetical protein	NA	NA	NA	NA
WP_165225985.1\|89937_90651_-	sugar transferase	NA	NA	NA	NA
WP_165225699.1\|93662_95009_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	6.7e-82	39.0
WP_165225702.1\|97930_98950_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_165225705.1\|101955_104124_-	hypothetical protein	NA	NA	NA	NA
WP_165225708.1\|104502_105414_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_165225712.1\|105413_106406_-	hypothetical protein	NA	NA	NA	NA
WP_165225715.1\|106429_107008_-	putative colanic acid biosynthesis acetyltransferase	NA	NA	NA	NA
WP_165225717.1\|107004_108177_-	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_165225719.1\|108173_109355_-	glycosyltransferase	NA	NA	NA	NA
WP_165225721.1\|109351_110728_-	hypothetical protein	NA	NA	NA	NA
WP_165225723.1\|110724_111807_-	glycosyltransferase	NA	NA	NA	NA
WP_165225734.1\|111907_113230_-	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_165225736.1\|113229_114270_-	polysaccharide pyruvyl transferase family protein	NA	NA	NA	NA
WP_165225988.1\|114310_115489_-	WcaI family glycosyltransferase	A0A1V0SL50	Klosneuvirus	1.2e-07	23.3
WP_165225738.1\|115590_116031_-	NAD-dependent epimerase/dehydratase family protein	M4R1H4	Synechococcus_phage	2.4e-09	43.9
WP_165225740.1\|118013_118472_+\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	1.7e-05	55.1
WP_165225742.1\|118468_118822_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_165225745.1\|120251_121286_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_165225748.1\|122680_123025_+	hypothetical protein	NA	NA	NA	NA
WP_165225752.1\|123139_123925_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_165225755.1\|124014_125469_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_165225758.1\|125703_126306_-	YecA family protein	NA	NA	NA	NA
WP_165225761.1\|127924_128278_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_165225990.1\|128274_128733_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP049244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049244_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049244_1

335555-335787

Orphan

Consensus_repeat	Method
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	CRISPRCasFinder
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	CRT
TGTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP049244_1

>merge|NZ_CP049244|1|335555-335787|CRISPRCasFinder,CRT,PILER-CR
CGGATGATCCACGGCTCCGCGAGCGAGGCGAGCTTGCGCATGAGGGCTCGATGCTGGTGACGGACCTGTTTCGATCCACGCCTCCGAGAGGGAGGCGACGCCAGCGACCAGATCATGAAACCGATCACCGCGCAGTTTCGATCCACGCCTCCGCGAGGGAGGCGACTTGGTCGGCATGGCGTTCTTCCTTCATGTCAGAGTGTTTCGATCCACGCCTCCGCGAGGGAGGCGAC

>NZ_CP049244|1|1|335555-335787|CRISPRCasFinder
CGGATGATCCACGGCTCCGCGAGCGAGGCGAG	CTTGCGCATGAGGGCTCGATGCTGGTGACGGACCT
GTTTCGATCCACGCCTCCGAGAGGGAGGCGAC	GCCAGCGACCAGATCATGAAACCGATCACCGCGCA
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	TTGGTCGGCATGGCGTTCTTCCTTCATGTCAGAGT
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC

>NZ_CP049244|1|1|335555-335787|CRT
CGGATGATCCACGGCTCCGCGAGCGAGGCGAG	CTTGCGCATGAGGGCTCGATGCTGGTGACGGACCT
GTTTCGATCCACGCCTCCGAGAGGGAGGCGAC	GCCAGCGACCAGATCATGAAACCGATCACCGCGCA
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	TTGGTCGGCATGGCGTTCTTCCTTCATGTCAGAGT
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC

>NZ_CP049244|1|1|335621-335787|PILER-CR
TGTTTCGATCCACGCCTCCGAGAGGGAGGCGAC	GCCAGCGACCAGATCATGAAACCGATCACCGCGC
AGTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	TTGGTCGGCATGGCGTTCTTCCTTCATGTCAGAG
TGTTTCGATCCACGCCTCCGCGAGGGAGGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049244.1\|WP_165223226.1\|339940_340087_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049244.1\|WP_165223202.1\|326751_327783_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP049244.1\|WP_165223199.1\|325890_326748_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP049244.1\|WP_165223220.1\|336043_337081_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|226077
NZ_CP049244.1\|WP_165225297.1\|327779_328700_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
NZ_CP049244.1\|WP_165223217.1\|334442_334943_+\|DUF2231-domain-containing-protein	unknown	unknown	gnl\|CDD\|370772
NZ_CP049244.1\|WP_165221754.1\|347757_348709_-\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP049244.1\|WP_165223244.1\|350599_352573_+\|transketolase	unknown	unknown	gnl\|CDD\|223100
NZ_CP049244.1\|WP_165223223.1\|337313_338450_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP049244.1\|WP_165223205.1\|329987_330797_-\|formate/nitrite-transporter-family-protein	unknown	unknown	gnl\|CDD\|376497
NZ_CP049244.1\|WP_165223241.1\|349512_350469_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP049244.1\|WP_165223235.1\|344390_345266_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP049244.1\|WP_165225300.1\|328754_329738_+\|family-43-glycosylhydrolase	unknown	unknown	gnl\|CDD\|350098
NZ_CP049244.1\|WP_165223208.1\|330892_331219_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049244.1\|WP_165225302.1\|334920_335421_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367596
NZ_CP049244.1\|WP_165223214.1\|333716_334385_-\|cytochrome-c-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|259875
NZ_CP049244.1\|WP_165223229.1\|341301_343248_+\|tripartite-tricarboxylate-transporter-permease	unknown	unknown	gnl\|CDD\|376692
NZ_CP049244.1\|WP_165223211.1\|331221_333720_-\|cytochrome-c-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|213748
NZ_CP049244.1\|WP_165223238.1\|345244_346237_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
NZ_CP049244.1\|WP_165223232.1\|343261_344335_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270234

Protein	Function_ID	Function_description	E-value
NZ_CP049244.1\|WP_165223235.1\|344390_345266_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	3.26896e-31
NZ_CP049244.1\|WP_165223223.1\|337313_338450_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	4.53149e-140
NZ_CP049244.1\|WP_165223199.1\|325890_326748_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.33391e-49
NZ_CP049244.1\|WP_165223220.1\|336043_337081_+\|IS110-family-transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.13898e-49
NZ_CP049244.1\|WP_165225297.1\|327779_328700_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	1.6636e-86
NZ_CP049244.1\|WP_165223217.1\|334442_334943_+\|DUF2231-domain-containing-protein	gnl\|CDD\|370772	pfam09990, DUF2231, Predicted membrane protein (DUF2231). This domain, found in various hypothetical bacterial proteins, has no known function.	2.50576e-18
NZ_CP049244.1\|WP_165221754.1\|347757_348709_-\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.11705e-47
NZ_CP049244.1\|WP_165223244.1\|350599_352573_+\|transketolase	gnl\|CDD\|223100	COG0021, TktA, Transketolase [Carbohydrate transport and metabolism].	0
NZ_CP049244.1\|WP_165223202.1\|326751_327783_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.61572e-124
NZ_CP049244.1\|WP_165223205.1\|329987_330797_-\|formate/nitrite-transporter-family-protein	gnl\|CDD\|376497	pfam01226, Form_Nir_trans, Formate/nitrite transporter.	9.14373e-67
NZ_CP049244.1\|WP_165223241.1\|349512_350469_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	1.77126e-62
NZ_CP049244.1\|WP_165225300.1\|328754_329738_+\|family-43-glycosylhydrolase	gnl\|CDD\|350098	cd08984, GH43-like, Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43)-like subfamily includes uncharacterized enzymes similar to those with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	5.8597e-127
NZ_CP049244.1\|WP_165225302.1\|334920_335421_-\|hypothetical-protein	gnl\|CDD\|367596	pfam03653, UPF0093, Uncharacterized protein family (UPF0093).	2.91186e-07
NZ_CP049244.1\|WP_165223214.1\|333716_334385_-\|cytochrome-c-oxidase-subunit-II	gnl\|CDD\|259875	cd04213, CuRO_CcO_Caa3_II, The cupredoxin domain of Caa3 type Cytochrome c oxidase subunit II. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of most bacteria, is a multi-chain transmembrane protein located in the inner membrane the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. Caa3 type of CcO Subunit II contains a copper-copper binuclear site called CuA, which is believed to be involved in electron transfer from cytochrome c to the cytochromes a, a3 and CuB active site in subunit I.	7.81329e-50
NZ_CP049244.1\|WP_165223229.1\|341301_343248_+\|tripartite-tricarboxylate-transporter-permease	gnl\|CDD\|376692	pfam01970, TctA, Tripartite tricarboxylate transporter TctA family. This family, formerly known as DUF112, is a family of bacterial and archaeal tripartite tricarboxylate transporters of the extracytoplasmic solute binding receptor-dependent transporter group of families, distinct from the ABC and TRAP-T families. TctA is part of the tripartite TctABC system which, as characterized in S. typhimurium, is a secondary carrier that depends for activity on the extracytoplasmic tricarboxylate-binding receptor TctC as well as two integral membrane proteins, TctA and TctB. complete three-component systems are found only in bacteria. TctA is a large transmembrane protein with up to 12 predicted membrane spanning regions in bacteria and up to 11 such in archaea, with the N-terminal within the cytoplasm. TctA is thought to be a permease, and in most other bacteria functions without TctB and TctC molecules.	6.38895e-117
NZ_CP049244.1\|WP_165223211.1\|331221_333720_-\|cytochrome-c-oxidase-subunit-I	gnl\|CDD\|213748	TIGR02891, Probable_cytochrome_c_oxidase_subunit_1-beta, cytochrome c oxidase, subunit I. This large family represents subunit I's (CtaD, CoxA, CaaA) of cytochrome c oxidases of bacterial origin. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits I-III form the functional core of the enzyme complex. Subunit I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit II and heme a of subunit I to the bimetallic center formed by heme a3 and copper B. This cytochrome c oxidase shows proton pump activity across the membrane in addition to the electron transfer. In the bacilli an apparent split (paralogism) has created a sister clade (TIGR02882) encoding subunits (QoxA) of the aa3-type quinone oxidase complex which reacts directly with quinones, bypassing the interaction with soluble cytochrome c. This model attempts to exclude these sequences, placing them between the trusted and noise cutoffs. These families, as well as archaeal and eukaryotic cytochrome c subunit I's are included within the superfamily model, pfam00115. [Energy metabolism, Electron transport].	0
NZ_CP049244.1\|WP_165223238.1\|345244_346237_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	1.08611e-55
NZ_CP049244.1\|WP_165223232.1\|343261_344335_+\|hypothetical-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.23018e-18

>NZ_CP049244.1|WP_165225302.1|334920_335421_-|hypothetical-protein
MVALIKFVHVASICLWAAGLVSLPGLYVQRSTVANRDALHRLQKIVRFSYVNVISPAAFIAVLSGIVLIFLRQVYAPWFSVKLLFVASLVILHVLTGLVIIRIFREGEGYPVWRFLVATIVTSGIVVTIFVIVLAKPDIDVAVADGLFKPGGLRSLIQRLSPWPIP
>NZ_CP049244.1|WP_165223217.1|334442_334943_+|DUF2231-domain-containing-protein
MQDDVERESPVITEIEQKDASSAVAVAGHPLHGMTVHFPIALAFATLAVDSLYWYGGDPFWLRVGLWSSGGVFFLGFAAGLIGTIELILVAGIRGRVASWAHAIAAVTLIALAGLNWGMRVTHAADVLPHGFFVSVLTCVMTGMAGWHGGKLIFDHGVGLMVSAKD
>NZ_CP049244.1|WP_165223214.1|333716_334385_-|cytochrome-c-oxidase-subunit-II
MVIGPMLALSGCTGDLSALHPAGPSAASIADLWWVMFWAAVGLFSLVLGLFLAAVSLPHFGRSISAHHWTMAGGLILPIPILAGLTFYAFAQGEFLLDGASRDGGEVVRISAVGRMWQWEFSYPDLSAAPPTAVLHIPVNKTVEITTTSQDVIHSFWVPRLGGKIDAIPGHANILRIRADQPGRYGGVCSEYCGTGHAGMRFEVQAHTEEDFRLAIGRGSTP
>NZ_CP049244.1|WP_165223211.1|331221_333720_-|cytochrome-c-oxidase-subunit-I
MSQTNRTNSEAIALHRQLEHIWGTKPGWGRLAAVNHTVVGRRFMLTALVFFAIGGLLAMLIRTQLASSNSAFMDAETYAQVFTMHGSIMMFLFAIPFFEGMAIYLLPKLLGTRDLAFPRMGAYGYWCYLFGGTMLIAALIGGVAPNSGWFMYTPLSSAVYAPGINSDVWLLGITFVEISALSAAVELIVSILKIRAPGMSIDKMPILAWYMLVVATMMLVGFPPLILGSILLEVERAFDLPFFDPNRGGDPLLWQHLFWLFGHPEVYIIFLPAAGAISTILPVLSGTPLAGYRLIIASIVSMAFLSFGLWVHHMYTVGIPHLALSFFSAASALVAIPTAIQVFAWLATIIHGRPRFSIPLLHIFGFFFVFVIGGLTGVMLAMVPFDWQAHDTHFVVAHLHYVLVGGFIFPMLAMAYYWMPHLTGKQPVQHLSNAAFWMIFIGFNTTFFMMHLTGLRGMPRRVFVYPPESGWETLNFLSSVGSFVMAMGFALVALDFLLIFRFGRAFRRNPWKAGTLEWAMPTPPPSYNFASLPYIDNRADLLDPEAIGPHLAAGKGYLGFVRHDRMEVLGVDSITGEPDQVVILPRQTYLPVWTALATGSFFLLMLFKLYWATPFALVAIVALFLLWNRSSAALEGGDMLDIGHGKSLPVHVKAASPPSHLAMVLTLVADATLYISLLFGCMFLWVSAPNWPPADLALPRFGLTLGAVAAMLAVAMGSRWSASHPAPGMALVLAGHLTAGLLLLTVAFIDMPAPSGHAAIASMVVVLVYAVLHHGIGTVFAGHALWSTLHRGPLCTLTLRIGRLWHGYTVLAGLVALVFPYVLDSLARTGGG
>NZ_CP049244.1|WP_165223208.1|330892_331219_-|hypothetical-protein
MRHPLVLITATFIAWSLAFLVLYATQATGCHISAERANAITMLRIVLCGLAILSVAGVVALARYMRRQTFAEASDADRFLRTVGSRVSIAAIVAVIFCFAGVFWLTPC
>NZ_CP049244.1|WP_165223205.1|329987_330797_-|formate/nitrite-transporter-family-protein
MADQGPMLQPSEICNAVFSACEDKAELPFAKMLVLGILAGLYIGFGGLFATVALAGADAVPFGLSQVVAGVVFSLGLALVILAGAELFTGNTLMIGPVAAGRLPAGRAARALAIVYLSNFVGAALLAVIALLSGLHEAGDGAVGRAAVNLADTKTSKSFWTVLASGVLANMLVCLGVWLAYAGQSVTQKVIGLMLPIAAFVAAGFEHSIANMYLLTYAFLVQSTVETAPTLLAASAIGANLLPATIGNILGGALIALSYQAVYGQPKRG
>NZ_CP049244.1|WP_165225300.1|328754_329738_+|family-43-glycosylhydrolase
MYRDPVQDGAADPTVIRNVETGAWWLFYTNRQPAAEGGKRWIHGSPIGIAISKDDGASWRYYGTVRGLDAPGDPVRNTHWAPEIIHDGALYHMYLTYISGVPDSTLAQHPRSIVHFTSLDLETWTRIGPITLSSNRVIDACVFACPDKLWRMWYKNEADGDSTWVATSPDLYAWTVVERVIPGKPHATPHEGPNVFYLSGWYWMVVDEWHGQAVYRSPDTLSWKRRGIFGNEPGSEPDDLRYVRHVDVEVVADYAVCYYFTHPEWDETSQSAGPQSVNARKTAIHHAILRVVNDDLQFQRDVDLKLPLLNEKSAFQSVRTTGSKGHT
>NZ_CP049244.1|WP_165225297.1|327779_328700_+|ABC-transporter-ATP-binding-protein
MTTHLEIREVSKTFNLGGIFGRKTVRAVQSASLSLREDTPEIFAIIGESGSGKTTLARMILGLEDPSEGSILFRGEPVRRRMGESERHRFMASVQPVFQNPFEAFNPLKLIDRYLDSTARAFLGASDPVAIDAAKDEALQKVGLSLAEVRGRFPHELSGGQLQRVAIARALIPKPALLIADEPVSMVDASLRMSIVNLLKSLRDEFGVSVIYITHDLATAYYISNRIMIMQRGCVVEMGDARAVLDRPEHPYSRLLQASVLSTADAGNGQLEVDRALLSAASDCVGRVGKLVTRPDGRSVMQYAPA
>NZ_CP049244.1|WP_165223202.1|326751_327783_+|ABC-transporter-ATP-binding-protein
MSDTILQVKGLKAYYQMHYFGVQREVRAVDDVTLSIGRNEVYGIAGESSSGKTSLIKVLAAAARPPLRVVEGAVNYNFKSGPIDVASANKTQIDRVRWKSLSYIMQGSMSVLNPVRRIGQTFHDFAYRPLSLPRESFDRRVLDHLLRLKLPPDILRAYPHELSGGMRQRVTIGLATICHPEFIIADEPTTALDLVVQKEVLHLIRDIQAEMGASVVFVTHDMSVHANVTDRIGIFYAGRLVEEGPTRTMFFTPKHPYTAHLVASLPRIGDTAPRPSLEGRPPNLATPPDGCRFHPRCPLAVDRCRVDVPPLVEVAPHQRSACWRWKDVVPLDASVATAHRATP
>NZ_CP049244.1|WP_165223199.1|325890_326748_+|ABC-transporter-permease
MFAVLRDLIRYNAEFAIGLVLVLSIIIFAMLSVFNPVDARLIFTTIPDQPPSAEFWFGTNSRGQDMFWQLSEAFRNSLMFGLTVAVISRILSISVGLLSGYIGGWTDRILMFINDIFVAIPIFPVLVLFYFVLRSDMNAVTLAFIMACLGWPYDARLIRSVALGLKHREFTRHAVFAGMSTRKILLEEHLPFVMPIVFSTFMNNMLWSIGLEVTLAVLGLTDINTPTIGTVLYWANSHSAMVVGVWWWIVIPVVLTALTFLGMFLLAVSTNEYIDPRSRLRRMGV
>NZ_CP049244.1|WP_165223220.1|336043_337081_+|IS110-family-transposase
MPVVTVGLDLAKTIFQAHGVDEAGQTVLRRRLGRSELLAYFAKLPPCLIAMEACSSAHHWARELVILGHDVRLIPPQYVKPYVKRNKTDAADAEAICEAAGRPSMRFVPIKTRDQQAVLVLHRSRSLLVRQRTASINAVRGLVGEFGLITSKGRYRMSELRQRMNAMTPDHLPAIACQAINTLFDHIDVLEEQIAAVERQIVEWHKSNEDSLRLATAPGVGPITASAIVAAVGDGRQFQSARHFAAWLGLTPRMHASGKKERIGRISKGGDRYLRALLIHGARAIVGTLFRNNVTPRPWLVALAARRPTNVTAVAVAHKTARALWAMLTREEKYRKPIAAAPSAA
>NZ_CP049244.1|WP_165223223.1|337313_338450_-|IS256-family-transposase
MTDDMMNLRSLVEKSADADLLREMIGFAAEKLMALEVGTKTGAGYGEKNGFRLAQRNGYRDRDWETRAGTVELRIPKLRTGSYFPSFLEPRRMAEKALTAVIQEAYIQGVSTRSVDDLVKAMGMSGISKSQVSRLCEEIDDKVKAFLDRPIEGEWPYLWIDATYLKVRRGGRIVSVAVIIAVGVNTDGRREVLGMEIGTSEAEAIWTEFLRKLTRRGLRGVKLVVSDAHEGIKAAVSKVLSATWQRCRVHFMRNALAHAGKSGRRVVSAFIATAFAQDTPEAASTQWRNVADQIRPKVPKLATLMDSAEQDVLAYMTFPKQHWTKLHSTNPIERLNGEIKRRTEVVGIFPNDDAIVRLVGALLLEQNDVYGPLPVCKE
>NZ_CP049244.1|WP_165223226.1|339940_340087_+|hypothetical-protein
MDDLEVVACVDLVRRKDAILAVDFEDGDRDHQVAAKLEGVGLCKRKIV
>NZ_CP049244.1|WP_165223229.1|341301_343248_+|tripartite-tricarboxylate-transporter-permease
MLEAFQTLVGSSALLYLLFGALLGLFVGILPALGGAAGMSLLIPFLYGMEPAAAMAMAIGMLATVSTGDTISSVLLGVPGSASSQATVLDGFPMAKNGQGARALAAGFLSSVIGGLFGAFVLTLTLQGAKQVILWFGMPEILMMILFGVASVAALSGKSLAKGISICAFGMLAASIGFAPASGEQRLDLGLFYLSEGLPLLACVIGVFVIPEIVDLIQQNRSISDRPSLGSGMRQGVVDVLRNKWIVFRSAIVGCLVGAMPGVGGSVVDWIVYGQTVRSARDKSMFGKGDVRGVIGVESSNNAVLGGALVPTLLFGVPGSGSTALLLSALILIGIQPGPGMLTQDINLTYLMIWSLALANIIGAGTCFLFARHLAKLTLIPFAWIAPFLIVAITFATLQINRDPRDLFLILVFGAIGIAMRRFGFSRPAFLIGFVLQQNLEKSLYQTAQLYSLGEFLFRPIVLVLLAVILAVLASSVWQQLQKQPEDREEIEAIAKTRPVQFILPILLSVCFASALAMVNDLQPLGRLFPQVAAGIGLVSALILLWQLAVGTPSVLEDQRVTGPRYSISFLHTIAWVVTAVLLIACFGFFAGASLFLGAFLAFEARAKPLAIAAGVVGIMGVYLFLTFQAGTYLPDGWVLSLNPWDYY
>NZ_CP049244.1|WP_165223232.1|343261_344335_+|hypothetical-protein
MNFKSIITATAIAVSLALPAAAQELAIGRINVTVPFGEGGGSDTLVRAVAPYLTKALENEPTVLIRNEPGGGGIPSTNRFARRAKSDGSDILALSSSIFLAKTLKSPQIDFQFDEFVPVFIAPMAPIFYVSPTTGARAKGDVEGMRGAQLVFGGGRQDSADIMTVLQFDLLGFDIKSVWGLERGGGRIGFERGEFNVDHQTTAAYVRSVQPLVDEGKAITFMTTGIIDPSGKIVRDPNFPDVPTFLELYQKVHDKPLSGPAYEAYLGLMGATITTGKSIVLPSSATREVVKAYSEAFSQVAGDPAFRDATKESLGGYQLYTGKDAQALWGTVTDLSPDAYAWLANWYETKVGFKLPR
>NZ_CP049244.1|WP_165223235.1|344390_345266_+|alpha/beta-hydrolase
MMQPSLKPQHKGTDIPLPAVPPGVCVIRDVSFGPHERQSYDVYLPENAPRPMPVVVFLHPGAWSRRDRRAVRTMFVLEHGFALVSIGYRLAQHARFPAQINDVNDGLRHLIAHADRYGIDCDRLVMAGTSAGAHLAALAVLARENEPFRPVSHFAPRGVVAVYGAYDMARLLRDECKVDIDQTSPESPLGLMFGEAPAGRPDLLREISPRTFVASEAPPFLIMHGHEDRVLPWTQSAEMATALIEQGVDVTLRVIPKVGHGAEAFRTPPVSDQIVAFMQNVTATPQLVSAR
>NZ_CP049244.1|WP_165223238.1|345244_346237_-|LysR-family-transcriptional-regulator
MGLVRYAIATAQSVLSSFGKPMAHETSILSRLHLQALRHLEAIVRLKTFEAAARELNVTPGAVSQQIRRLEENLGVPLFRRHGNRSEPTEAAIQIAQSLGDAFRGIEVALEQVVGRELKAIKFRVFQTWANRWLIPRLDAFYQQHPGIAVEFETGIDTVDTDRPDLDMALTVRTVESAGHKLIPLFTPHLCPVCTPSVAVQLGPTLDLARVPLIASRNRMADWPRWLDRADRAANDQTPLLVFSNSTLVYEAAMAGNGLAIAQVELVLNDLLAGRLVRPFPEVIEANEPISIVLPTSRAHRGAPMAFRTWLLSEAALLRERTESYLAETS
>NZ_CP049244.1|WP_165221754.1|347757_348709_-|IS630-family-transposase
MGKPHPIELRERVVAFVNEGNSNREAARHFRVSPRFVNNMMILHRSSGSLRPARQGHPPGSKLSPHGEWIRERVALHGEVTLDELCLELAERGIDVHRATVGRFLHQLGLSIKKSLKASEQRRPEIAKARDLWINRRKRFFNKALSRLIFIDETSTNTRLTKRTGWCAKGSRFAAYAPFGHWKTQTFIAGLRCHGLTAPWIVEGPMNGRIFETWIETQLAPTLSPGDVVILDNVGFHKSEKAEQLVKAKGAWLLFLPPYSPDLNPIEMAFSKLKALLRKRAARSFDAIAQALGDIISLFSVTECRNFFRAAGYEAE
>NZ_CP049244.1|WP_165223241.1|349512_350469_-|LysR-family-transcriptional-regulator
MIGGATLSMLRSFEAAARYGNFKGAADELRLSPSAISHSVRQLEAALGVQLFERAGRGVRPTLEGLALLSRLSVAFDEIRRGIEDVGQRGSALLRIHSAPSFAALWLAPRLKQFTTRHEGIELRLSADTQYARFATDDFDLDIVYGPVRAEGVTSLLLGEEEVAPLCAPAIANQIGCIDDIALFPLIQSDQKQVRWDDWLKVNGINKSLNRALRFDRSFMALSAARNELGIALESMRLAQEDLSSGRLVAPLSQAGGRLYDSGHKLVIPRNRPIRKPVRLFVKWLLESLNLPPHLDAAISLAATEMSESGKAKTPQSG
>NZ_CP049244.1|WP_165223244.1|350599_352573_+|transketolase
MVDIQRMAHAIRFLALDSILNAGEGHQGVPLGMAEIAATLYARHLKIDPSEPLWPDRDRVVLSNGHGSMLLYALLHLAGYDHVSVDALKSFRKLGSLCAGHPEIEQHAGIEITTGLLGQGIACAVGMAVAEARLAARFGAPLVEHRTWAFVGDGCLQEGIGQEAVSLAGHLQLGKLTFLWDDNHITDDGDTDLSTSEDIPARFRAAGWHVHAVDGHDIEAISMALDAAKADPRPSLIACRTTIARGIPRLQGQRGGHSAPLKVEDSEQARALLDWPHAPFDIPAEILRDWRSALAKGSAAHEAWRLRLEVYPDKAEFQRWISGGLPMDWSSQIAALHAAAGRQIEPRATILSSGDLCDGLVSVLPETLVLCADLEAPTNHKRSRGAFDVRDRSGSYVHCGVREHLMGAMADGIAAHGGLRPVNVTYLAFADYERPAMRMAALMGLPALFVFSHDSIGVGSNGPTHQPVEVLASFRAMPNMLVFRPADAIETAEAWQVAIEHRSGPSLLALSRQAAVPVRMETDENRTKRGAYVLREPAGGRDVTLIATGTEVSLAVAAQAELAHLGIAAAVVSMPSWELFEMQGMDYRSAVLGEAPRIGIEAALSFGWERWLRPEDRFIGMSGFGASARAEVLYEHFGITSRRIVDMAKQMVAGVAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP049244_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049244_2

409146-409316

Unclear

Consensus_repeat	Method
ATCGTTTCGATCCACGCCTCCGCGAGGGAGGCGACG	PILER-CR
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP049244_2

>merge|NZ_CP049244|2|409146-409316|PILER-CR,CRISPRCasFinder
ATCGTTTCGATCCACGCCTCCGCGAGGGAGGCGACGTTTCTCCAGCGACCCGCCACCATTTCCAACGAAGTTTCGATCCACGCCTCCGCGAGGGAGGCGACTTTCGAGATCGACGACAGGAGAGCCGTCCAAGCAATCGTTTCGATCCACGCCTCCGCGAGGGAGGCGACG

>NZ_CP049244|2|2|409146-409316|PILER-CR
ATCGTTTCGATCCACGCCTCCGCGAGGGAGGCGACG	TTTCTCCAGCGACCCGCCACCATTTCCAAC
GAAGTTTCGATCCACGCCTCCGCGAGGGAGGCGACT	TTCGAGATCGACGACAGGAGAGCCGTCCAAGCA
ATCGTTTCGATCCACGCCTCCGCGAGGGAGGCGACG

>NZ_CP049244|2|2|409149-409315|CRISPRCasFinder
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	GTTTCTCCAGCGACCCGCCACCATTTCCAACGAA
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC	TTTCGAGATCGACGACAGGAGAGCCGTCCAAGCAATC
GTTTCGATCCACGCCTCCGCGAGGGAGGCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049244.1\|WP_165223367.1\|411772_412807_+\|cellulose-biosynthesis-protein-BcsN	unknown	unknown	gnl\|CDD\|374958
NZ_CP049244.1\|WP_165217141.1\|407431_408931_-\|IS21-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP049244.1\|WP_165225313.1\|406149_406614_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|226932
NZ_CP049244.1\|WP_165223363.1\|405016_405598_-\|response-regulator	unknown	unknown	gnl\|CDD\|226933
NZ_CP049244.1\|WP_165223376.1\|417668_419975_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP049244.1\|WP_165223384.1\|423207_424473_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|378963
NZ_CP049244.1\|WP_165223357.1\|399402_400512_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP049244.1\|WP_165217142.1\|406697_407432_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP049244.1\|WP_165223379.1\|420950_421730_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180604
NZ_CP049244.1\|WP_165225321.1\|420247_420862_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP049244.1\|WP_165223365.1\|405703_406108_-\|response-regulator	unknown	unknown	gnl\|CDD\|381092
NZ_CP049244.1\|WP_165223373.1\|417369_417678_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049244.1\|WP_165225324.1\|421726_422056_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP049244.1\|WP_165223370.1\|412835_414998_+\|UDP-forming-cellulose-synthase-catalytic-subunit	unknown	unknown	gnl\|CDD\|274400
NZ_CP049244.1\|WP_165225319.1\|415042_417373_+\|cellulose-biosynthesis-cyclic-di-GMP-binding-regulatory-protein-BcsB	unknown	unknown	gnl\|CDD\|377001
NZ_CP049244.1\|WP_165223359.1\|400508_402110_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
NZ_CP049244.1\|WP_165223382.1\|422193_423090_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176163
NZ_CP049244.1\|WP_165225311.1\|398380_399292_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP049244.1\|WP_165223356.1\|397006_398209_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP049244.1\|WP_165223361.1\|402415_404707_+\|FdhF/YdeP-family-oxidoreductase	unknown	unknown	gnl\|CDD\|273765

Protein	Function_ID	Function_description	E-value
NZ_CP049244.1\|WP_165223367.1\|411772_412807_+\|cellulose-biosynthesis-protein-BcsN	gnl\|CDD\|374958	pfam17038, CBP_BcsN, Cellulose biosynthesis protein BcsN. This is a family of bacterial cellulose biosynthesis proteins. Cellulose is necessary for biofilm formation in bacteria. (Roemling U. and Galperin M.Y. "Bacterial cellulose biosynthesis. Diversity of operons and subunits" (manuscript in preparation)).	1.25306e-80
NZ_CP049244.1\|WP_165217141.1\|407431_408931_-\|IS21-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.42025e-17
NZ_CP049244.1\|WP_165225313.1\|406149_406614_-\|response-regulator-transcription-factor	gnl\|CDD\|226932	COG4566, TtrR, Response regulator [Signal transduction mechanisms].	7.15741e-65
NZ_CP049244.1\|WP_165223363.1\|405016_405598_-\|response-regulator	gnl\|CDD\|226933	COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription].	3.62146e-28
NZ_CP049244.1\|WP_165223376.1\|417668_419975_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	3.81644e-06
NZ_CP049244.1\|WP_165223357.1\|399402_400512_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	6.42438e-91
NZ_CP049244.1\|WP_165217142.1\|406697_407432_-\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	9.03184e-67
NZ_CP049244.1\|WP_165223379.1\|420950_421730_-\|SDR-family-oxidoreductase	gnl\|CDD\|180604	PRK06523, PRK06523, short chain dehydrogenase; Provisional.	3.21382e-151
NZ_CP049244.1\|WP_165225321.1\|420247_420862_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	9.93866e-32
NZ_CP049244.1\|WP_165223365.1\|405703_406108_-\|response-regulator	gnl\|CDD\|381092	cd17537, REC_FixJ, phosphoacceptor receiver (REC) domain of FixJ family response regulators. FixJ family response regulators contain an N-terminal receiver domain (REC) and a C-terminal LuxR family helix-turn-helix (HTH) DNA-binding output domain. The Sinorhizobium meliloti two-component system FixL/FixJ regulates nitrogen fixation in response to oxygen during symbiosis. Under microaerobic conditions, the kinase FixL phosphorylates the response regulator FixJ resulting in the regulation of nitrogen fixation genes such as nifA and fixK. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.97094e-29
NZ_CP049244.1\|WP_165223384.1\|423207_424473_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|378963	pfam12831, FAD_oxidored, FAD dependent oxidoreductase. This family of proteins contains FAD dependent oxidoreductases and related proteins.	6.61203e-87
NZ_CP049244.1\|WP_165225324.1\|421726_422056_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	7.18564e-07
NZ_CP049244.1\|WP_165223370.1\|412835_414998_+\|UDP-forming-cellulose-synthase-catalytic-subunit	gnl\|CDD\|274400	TIGR03030, Cellulose_synthase_UDP-forming, cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.	0
NZ_CP049244.1\|WP_165225319.1\|415042_417373_+\|cellulose-biosynthesis-cyclic-di-GMP-binding-regulatory-protein-BcsB	gnl\|CDD\|377001	pfam03170, BcsB, Bacterial cellulose synthase subunit. This family includes bacterial proteins involved in cellulose synthesis. Cellulose synthesis has been identified in several bacteria. In Agrobacterium tumefaciens, for instance, cellulose has a pathogenic role: it allows the bacteria to bind tightly to their host plant cells. While several enzymatic steps are involved in cellulose synthesis, potentially the only step unique to this pathway is that catalyzed by cellulose synthase. This enzyme is a multi subunit complex. This family encodes a subunit that is thought to bind the positive effector cyclic di-GMP. This subunit is found in several different bacterial cellulose synthase enzymes. The first recognized sequence for this subunit is BcsB. In the AcsII cellulose synthase, this subunit and the subunit corresponding to BcsA are found in the same protein. Indeed, this alignment only includes the C-terminal half of the AcsAII synthase, which corresponds to BcsB.	3.37366e-72
NZ_CP049244.1\|WP_165223359.1\|400508_402110_+\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.41309e-27
NZ_CP049244.1\|WP_165223382.1\|422193_423090_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176163	cd08474, PBP2_CrgA_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 5. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.06841e-89
NZ_CP049244.1\|WP_165225311.1\|398380_399292_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.08113e-29
NZ_CP049244.1\|WP_165223356.1\|397006_398209_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	2.18806e-26
NZ_CP049244.1\|WP_165223361.1\|402415_404707_+\|FdhF/YdeP-family-oxidoreductase	gnl\|CDD\|273765	TIGR01701, Hypothetical_protein_Rv2900c/MT2968/Mb2924c., oxidoreductase alpha (molybdopterin) subunit. This model represents a well-defined clade of oxidoreductase alpha subunits most closely related to a group of formate dehydrogenases including the E. coli FdhH protein (TIGR01591). These alpha subunits contain a molybdopterin cofactor and generally associate with two other subunits which contain iron-sulfur clusters and cytochromes. The particular subunits with which this enzyme interacts and the substrate which is reduced is unknown at this time. In Ralstonia, the gene is associated with the cbb operon, but is not essential for CO2 fixation.	0

>NZ_CP049244.1|WP_165217141.1|407431_408931_-|IS21-family-transposase
MKRVDTIARVRRAFHVQGWSMKKIARELHVSRNTVRKILRTDETDFSYERERQPLPKTGAWKAEIEQFLVTNEGRPSRERLTLIRIYEELRALGYDGSYDAIRRYAKGWAKNRGSATAQAYVPLYYAPGEAYQFDWSHEIVLINGTTTTVKVAHVRLCHSRMIFARAYMRESQEMVFDAHDKAFAFFRGTCTRGIYDNMKTAVEAVFVGKERLYNRRFLQMCSHYLVQPVACTPASGWEKGQVENQVGLVRERFFTPRLRVKSLEELNVWLLDKCVAYAKAHNHPEQADQTIWQMFEAERGSLVPYVGPFDGFHCVPASVSKTCTVRFDNNKYSVLSTAVGRPVEVHAYADRIVVKQDGTVIAEHRRSFGRGETVYDPWHYVPVLARKPGALRNGAPFRDWVMPAAMEKVRKRLKTVDDGDRQMVTILGCVPGDGITAVEAACQEALEQGVCSAAVILNILARRRDPAPAAPLQIPDALRLTHEPVADCARYDSLRRAS
>NZ_CP049244.1|WP_165217142.1|406697_407432_-|ATP-binding-protein
MERTQVLELMSTLKLYGMRSAYDEVMGNGIKRQHEPPRIVGDLLQSEIAEKQARSIRYQLSIAKLPLAKDIDDFDFANTPVNEGLVRDLATGAFVADQRNVVLVGGTGTGKSHLAIAIARALIRNGTRGRFYNVVDLVNRLETETRSGKQGRTADYLNRLDFIILDELGYLPFAQAGGQLLFHLISRLYERTSIIVTTNLAFGEWPTVFGDAKMTTALLDRLTHHCEIVETGNESWRFKNRSQS
>NZ_CP049244.1|WP_165225313.1|406149_406614_-|response-regulator-transcription-factor
MGVNIGRRYGVKFPCRLTPIVFMTGFGDIPMSVRAMKAGAVDFLAKPFRDQDILDAVLSALERDADRRREARRFQELTARFQTLTLREQQVLEAVVKGLMNKQIAFQLGISEITVKLHRGNVMRKMQVRSLAELVRATEQAHEFSVRSTKPATI
>NZ_CP049244.1|WP_165223365.1|405703_406108_-|response-regulator
MSHSSIIAIVDDDLAIREALDDLVKSLGYESRLFASAEAFLDFQPRSAIDCMVVDVKMSGLSGIELQRRLNHEADRPPMIFMTSYHDDRTRAAVLDGGALAFLGKPVNLTKLIECLELALALPKRTESEFTPRT
>NZ_CP049244.1|WP_165223363.1|405016_405598_-|response-regulator
MQNGRAQSNTGSVELQKIVLIVDPQNSQGSIIKQMIESNGHRVLLAKDVEAAAHHITNSPIDYCVTELRFEDGTGHDILRLLAVHHPACRTIVHSQYCNISVAVALTQAGAADVLPKPMSESFVLAILFNEDIRRFSEQPCVPAPNAVREEHIRQVLISCGANVSRSARSLAMHRRTLQRMVDKSPMLRAVLR
>NZ_CP049244.1|WP_165223361.1|402415_404707_+|FdhF/YdeP-family-oxidoreductase
MKKKRPDGIKPYNEPAGGWGALKAVAETLARQQVVAQGTATLMKANQPEGFDCPGCAWPDPTHTSSFEFCENGAKAITWESTAKRVGPDFFADHTVAEMWNWTDHELENQGRLTHPLIYDSSIDRYQIIEWNEAFRLIGQELNALESPNQAEFYTSGRASNEAAFLYQLFVRAFGTNNFPDCSNMCHEATSIGLPESIGVSKGTVTLEDFDHCDAIFSFGHNPGTNHPRMMTTLHEASRRGTPIVVFNPFKERALEKFAAPQDPVEMATFSSTEIASDYHQLRIGGDLAAIKGMMKLIFERDTTDLAMGGSGVLDRAFIADHTLGVDDLRRDVEETSWDDIFTYSGLSRASIESAVDVYLKAKNVILCYGMGLTQHANGTHNVQQTTNLLLLRGNIGRQGAGICPLRGHSNVQGDRTVGITEIPNVSLLDGIQRAFGFRPSADKGHNAIEAIKAIVEGRSKALICLGGNLAVAMSDPTVTFPGMRKLNLAVHISTKLNRSHLLPAKTCLILPCLGRTDLDTQASGPQSVTVEDSMSMVHASRGFLNPPSPLLKSEPAILAGIAQATLGSRYGIDWAGMIENYDRIRDKIEIVFPDFKDFNRRIRARGGFRLNVPASRREWHTATGKAHFRIACGLDEDPRLKDPDTLVMATMRSHDQYNTSIYGLDDRYRGVFGRRDIIFVSPADLKARGLQDGDLIDVHAITEGPERSVRGYTAVAYDLPQGSIGGYYPEMNAIIALGHYDRRSGTPAYKGVPVRITRSQAT
>NZ_CP049244.1|WP_165223359.1|400508_402110_+|MFS-transporter
MTTAFRSFGPVTEGTTATRPVLIVAALLLASFVVGFDTRVFVVGLPDLEGAYSLGSDEASWLSTIANAPQILIASAVAWLVTVFGVRRIMIPTALVYAIVSLEIPMVHDGLLLFVLHAIRGLLLGVFIPATIMVIFRNLDKRYWLIGIAIYALRVPLSQNLGFVLVGFYGDYLGWQWMYWQDVIVAPLIALLLVIAAPKEQINLGLLEHADWGGMLLLGSSMTLLYVGLDQGNRLDWFQSGTIIALLVGGCTLAIGFVINESVVAHPWAHLSVIMSRNIGLGYAIIICYALSSAGASMAIPGFLHTVLGFRPIAISALYLVGAVFPAFLFISVAIILLRRFDARLCIVLGLSLMALGSQLGSHLTLAWGPWNFLSTVLIHTAGQSFVFFAAVVYLVGSSDPSRSTAVSAYIQVVRLGSVELATSILGTLQRHREQFHSDILNGPIAATSQQLQLLLGKLQHVYGQGTRGHLESLSAVSLAIRNQATILAYSDLFVVSFWAAVAGLFVTIFMISMPYGPLHQDFKHQAIAEADR
>NZ_CP049244.1|WP_165223357.1|399402_400512_+|HlyD-family-secretion-protein
MTDQAKTGSASPAPQQPPSQPAASIKRLAIPLLAILFVGSAVASVIIDWDRWIAGASYQSTNDAIINADVSTLSAQISGAVLNVPVGDFQKVTKGQLLVEIDPRSYEAAVRIASANLAAANATLSNLSNQIELQKAAIEAADAQHASAMAQNAQAQEEYQRQLSLGGATSQQALQQAQAAALQAAAAVRSTAASLVAQQAQLKVLHGQEPLLKAQASAAEGNLETARINEGYTRIYAPFDGRLGRRLVHQGDFVTAGTGVVSEVPLPNVYVTANFKETQLSRMLAGDKAEIKVDAFPGRPLHGTVAELSPASGSIFALLPPDNATGNYTKVVQRLPVKIAIDPNQSLLDALRPGMSATVTVSTPGGTSQ
>NZ_CP049244.1|WP_165225311.1|398380_399292_+|helix-turn-helix-transcriptional-regulator
MEFLRVHQTPQIVAASLSGGILSASRIMRDTPGHGMSDDHVQEDAFMLSMQMRDYHGALWADGKEIDFAGSRQGNFTLYDYTRVWRADLQSAFDCINIHISRKALLSLQEQTGVRAVEGFNIAPGADVDDPVIRGIVSAMAPIFQNRFDANQLLLDYIGTGLLVHLSSTYGGHPHSLRLHRGGLTPVQLRKATAMLDANLDGRLNLIDIAQECGLSSSYFARAFKQSTGSTPHRWLAQRRIDKAIDLMRNSSKTLREIAAACGFSDQAHFTRAFGEAKGISPAAWRRHIIPAPSHLFRDAPKG
>NZ_CP049244.1|WP_165223356.1|397006_398209_+|HAMP-domain-containing-histidine-kinase
MIDTLFERRPELSGEVDEGATDAAALLAELVKFAGADQGKLIRCSGQCAIVFATAQVQDGEVQTTVNRSERLDANQQQVVRQALSSGCMVTSGISTLCVPMAPCNGIPWALHLQTRSHAEGFSDQVVSAIRLFAKMLERLLDRHANLDTISSADTAATTYLQKPMIESPSLSGIDPVVLAGVAESMAIKINDSLSSVVAHAGAGLQWLNQETPKLEQARQSLRKIASSSFAIGAMISGFRSASQSSGHAFETVDLQDVIASVLEQLAPDLLEAKVRIDCDLSAGSEALATARQIEQAIVNLVSIAADSMREISHHRKISISSTLQDRYLVLSISDTGPSIPSEGRDAIFDPSYTAKQGNKGVKLAIARTIAQLHGGNLEIARSDDEGTTMLLKLPAKICN
>NZ_CP049244.1|WP_165223367.1|411772_412807_+|cellulose-biosynthesis-protein-BcsN
MAAILCQQNLVLFKGKFLIEARLTFVALMLALVGCSTTGGVRQPSGPELVAADKALIMPPPGGPGIVGVVQQSHENGTEQTVSLTTVSRIPGQNYLKISFSGGRDAEQPTSIAYRPLGEATLRTEMNAAAPGVQLTRSTLYLQNAYGPFGYASGHSRHGDVCIYGWQQLRSRSTGNGFGRDFGMIQVRLRLCDNRATENELLSVLYGYTIVGGFQGEIWNPYGSPAPIDPRLGQTGQPIYPTPDAAARLAAFGYSAATPITTNSIRPVADRTVRASTAPHPTPAPAHRVPVPGVEAGVITIPSPPADASVTGNATSVVVPSPDCIGTTAIPAACSNKGGSKPSR
>NZ_CP049244.1|WP_165223370.1|412835_414998_+|UDP-forming-cellulose-synthase-catalytic-subunit
MRNAPSIIVWSIMAICVIGLITLPVNLQTQLIVSVIVVAIMAALKILGVGGRWRLVALAFGMAIVWRYVYWRTTETLPPINQPENFIPGLLLYLAEIYSVMMLALSLFIVAMPLDSRPSRAARQKTFPSVDVFIPTYNEDPVLLANTLAAAKAIDYPADRLTVWLLDDGGTIQKRNSTDVRESETALSRHAELTRLCDALGVRYLTRERNEHAKAGNLNNGLQHSTGELIAVFDADHAPARDFLLETVGYFEDDPKLFLVQTPHFFLNPDPLERNLRTFERMPSENEMFYGIIQRGLDKWNASFFCGSAAVLSRKALDTTKGFSGLSITEDCETALELHSAGWNSIYVDKPLVAGLQPATFASFISQRSRWAQGMMQILRFRRPFLKHGLTLPQRFCYMSSTLFWLFPFPRTIFLVAPLFYLFFDLEIFTASGGEFLAYTLSYMLVNLMMQNYLYGSFRWPWISELYEFVQTIHLLPALISVMLNPRKPTFKVTAKDESVSVSRLSEISRPFFIIFAVQVVALVVTIYQIYAEPYKADVTLVVGGWNLLNLILAGCALGVVSERGEKSSSQRVRVRRRCEFGIEDQWYPASIDDVSVGGAGLQVFGRDLPSISKGTEAQIRFRSHSQTDPVVLPILVRHVSTQATGDAALIGCQYRPRDPQDHRWIADLIFANSEQWEEFQQTRRRNPGILQGTIWFVGLSLFQTSRGLIYLFRGMGRSK
>NZ_CP049244.1|WP_165225319.1|415042_417373_+|cellulose-biosynthesis-cyclic-di-GMP-binding-regulatory-protein-BcsB
MLCGPLAHAQPVPFDMSPEGPAQPPAAQETTPPLALPLPLPGIDGSPKPSAPSVQAAAEGDDIDRRYLVPAEELTLSGEFARRVWTIYLPEQQASLPATLSLGYRNSIVIAPEASRLSVYLNGRVLSEETIAATDTQKVLNLQIPEGMLQTGANRIEMRVNQRHRTDCDIRSTYDLWTRIDPAQTYLSFQGKASALPSVAETVRAIGVNESGGTRFNIVAPALGQSAVVSPLLRLSEGLSLLAAMPNQDFVFSSTNAQASSPGTLTIGVGTASELQPLFPDLPAAAQSTGIASIVTVSRTGQNIILISGPTWSHIQGAIEGLVAPLDWTPSVRRDVISTQRWMAPDAPLLFGGERLPLSQLGVDTIEFPGRRVRTSFSIAVPADFYGNAYGEAQLLLDAAFANTVEPGSHIDVYVNGNIASTVPITSTKGGIFRHLPVKIAMRHIRPGVNTIDIEAIILTKEDAVCAPAATASLQPRLAIFNTSELLMPKFARISQNPNLAALANTSFPYARKTNPLMLSVDRFDAETLGAASTFLGKLALMGGQPIPIELLVSPNAIGERNAIFFGTISQMPPKLLTQLSLSPDIATAWRPDVNAPAQGVETSQTFEKWRSRVSGGIWSGQVGSLQEWLRRNFDLSASSFQFIPRDEVLFTPSASQSLLVAQGASPEGRASWTIVTAPTTADLRQGVSAFARQDRWDQIAGRATAFADKTDEVQIVPALHVDFIWTGPMTLSNYRLVLTNWLSTNILAYALLLVGFTVLFGLSTASVLNRLGRNQ
>NZ_CP049244.1|WP_165223373.1|417369_417678_+|hypothetical-protein
MTLHVSAFLAVPFLIVQPALATPQSDPAILEQEWADYRSERRDEAGRITGNEGIVHSEGQGDGLADRVVDGKTLPDQPQSNDFATLQLLGLAYAREQHPRCL
>NZ_CP049244.1|WP_165223376.1|417668_419975_+|tetratricopeptide-repeat-protein
MSLKLPLFILTMAVAGGSLFTTVQDRGPVPVNALSAPDGAAQRQGRISGAPPLVEPSHVAEQVRTAQLKEPNEAVPAQNMPFDEFDVVEAQQPSQQQPAEPPSGEARAPSQARQQNNGQSSPVAAPPTASPPGPDLTALRYFAAQGDTARLQAEIARLRSLYPNWTPPADPLAVPTGRDEQLDQMWKFYADGKYAEVRKAIADRQASDPRWQPPQDLLDRVNVAETRTRLITASELKQYETVIDLASQTPSLRNCSDVDVLWRLGEAFIQTKRQDRGEAVYRYILTNCSDPEQRLATVQKASTLLPPEALAPLLSLERGDEFASVRDDLARNRVAQANKKPGSAVPPDDLARLKAIAERDGKATDALLLGWYALRHDDMNEAMKWFSAARGLEDSSSASQGLALAMISLDKAGEAENVMYKWRNDSEEASATYLATTANLMAEDPPPLLSEEVLRRIAETVIEKKYVPTAQQFGWYARALNQPQTALRWFQTALGWKPDDEPSAYGLAVTRQQLNDRAGVAEIQRLWAGRSARIANLGLVTPPMASARVVRPGGQLVQQQPQQSVVPSDSVRPPETTATPRQVRLVRADKAGSASRVSCSSYADPAELPPAAALARGWCLMDLKRPLEAVRAFEIALRSDNIRVKQDAAYGESLAYLRLGLTSKAAVAAAKAPQRPERSAELQIAILADRANAAFNSERYREALVYLDQRSTLQPETSDLLVLRAYALMKLGRPDDALRIFELVAETGNRAASRGLQEARIALGLDRN
>NZ_CP049244.1|WP_165225321.1|420247_420862_+|LysE-family-translocator
MDLLSVAIFAAALLLNAGTPGPSIAALVSRVITSGWRDVIPFIAAMWIGEVVWLTMAMAGLTAIVNTFEFGFHILKWLGVAYLCWLAVKMWHKPVDESMGDLPQRVSPLSMFGAGMALTLGNPKIMVFYLALLPSLIDLSKTGFAEWSILAAVTLVTLAGIDLTWTFLAHKARLLLRTPRAARVANRIGATALAGAAAAIAVRN
>NZ_CP049244.1|WP_165223379.1|420950_421730_-|SDR-family-oxidoreductase
MTPFLTLEGRRALITGGTSGAGAATVALFKDLGARVLTTARKKPENFSGAAFVEADLTTKGGVQVVVDAVHRELGGIDILVNVLGGSSAPSGGFAALSDEEWDKEFDLNFFPAVRLDRALVPGMVAQGSGVVIHVTSIQRHLPLPEATTGYAAAKAALNTYSKSLSKEVSPKGIRVLRVSPGWIANPGANGLAQRIAAEAGIEYDAAVQVIVDSLGGIPLGRPAAPEEVADLIAFLASDRASSITGTEHVIDGGTIPTA
>NZ_CP049244.1|WP_165225324.1|421726_422056_-|nuclear-transport-factor-2-family-protein
MTIKLPKAIQAYFDADRKGSPDTVAALFTSSGRVKDKGETHRGRDAIRQWVADESGQYSYSVEPFFIGTENDKTQVTAHLVGTFPGSPIDLRYFFVLSGDKIAELEITV
>NZ_CP049244.1|WP_165223382.1|422193_423090_+|LysR-family-transcriptional-regulator
MTRFVLADLDAVLSIARLGSFRAAALDLGMSTTALSNSIAKLEQRLGIRLFNRTTRSVSLTDAGRTFVERVGPAVTDIRDAMLAAQSLQEVPTGTLRINAFATAAREVMEPLILSFLQRYPQVHVDLVTEGRIVDIVAAGFDLGLRPADLVPADMIAVPLGLKRSNAVVASPEFLRTHGRPTVPADLYRFRCIRVRLPNNALFRWKFEKDGNAVQIDVQGSITLDESSLVRIAAQNGVGLGYVMEADVREDIAAGRLVRVLEDWTPALAPLALYYPGRKNPPAAFTAFIQAARHFAKG
>NZ_CP049244.1|WP_165223384.1|423207_424473_-|FAD-dependent-oxidoreductase
MLNARQEKTDVVVIGGGAGGMSAAVAAARLGARVVLIEQYGFLGGAASNSQVLAYCGFYQKGSTPVSAVLGIGAELLAELETIGQSVAPIISRSGNWIVMLDPEAVKFAFDRMCERAGVEVRLHSKLTAVTKEEGRITSVTLADQAGTVTIEAGSFIDASGEATLSVLAGARLTSDIRRGDHVQPASMPVRIGGVAPDAPFDRAVLSGIIAHYNATSDTPILRADGGVMSRLPISGDVWWMTIDLPLGGLSGEDFCVVEREARRQAWRNLALIKQMPGFERAYLVATGPQIGIRETRRPQSCEDMTGAALKTGARRSDGIGRAAWPMEVHEAPGRASFTDLGGEGFADIPMGSLQAADIANLYLAGRVVGADQTAYGSVRVMGTAFATGHAAGVAAALWMQTGKAVPEDIRRVLITQNALV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049244_1	1.1\|335587\|35\|NZ_CP049244\|CRISPRCasFinder,CRT	335587-335621	35	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	335587-335621	0	1.0
NZ_CP049244_1	1.2\|335654\|35\|NZ_CP049244\|CRISPRCasFinder,CRT	335654-335688	35	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	335654-335688	0	1.0
NZ_CP049244_1	1.3\|335721\|35\|NZ_CP049244\|CRISPRCasFinder,CRT	335721-335755	35	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	335721-335755	0	1.0
NZ_CP049244_1	1.4\|335654\|34\|NZ_CP049244\|PILER-CR	335654-335687	34	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	335654-335687	0	1.0
NZ_CP049244_1	1.5\|335721\|34\|NZ_CP049244\|PILER-CR	335721-335754	34	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	335721-335754	0	1.0
NZ_CP049244_2	2.1\|409182\|30\|NZ_CP049244\|PILER-CR	409182-409211	30	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	409182-409211	0	1.0
NZ_CP049244_2	2.2\|409248\|33\|NZ_CP049244\|PILER-CR	409248-409280	33	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	409248-409280	0	1.0
NZ_CP049244_2	2.3\|409181\|34\|NZ_CP049244\|CRISPRCasFinder	409181-409214	34	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	409181-409214	0	1.0
NZ_CP049244_2	2.4\|409247\|37\|NZ_CP049244\|CRISPRCasFinder	409247-409283	37	NZ_CP049244	Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence	409247-409283	0	1.0
NZ_CP049244_2	2.1\|409182\|30\|NZ_CP049244\|PILER-CR	409182-409211	30	AP014262	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, * SEQUENCING IN PROGRESS *	2273-2302	4	0.867
NZ_CP049244_1	1.4\|335654\|34\|NZ_CP049244\|PILER-CR	335654-335687	34	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3450485-3450518	7	0.794
NZ_CP049244_2	2.3\|409181\|34\|NZ_CP049244\|CRISPRCasFinder	409181-409214	34	AP014262	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, * SEQUENCING IN PROGRESS *	2270-2303	7	0.794
NZ_CP049244_2	2.2\|409248\|33\|NZ_CP049244\|PILER-CR	409248-409280	33	MG592561	Vibrio phage 1.191.O._10N.286.52.B4, partial genome	39939-39971	8	0.758
NZ_CP049244_1	1.4\|335654\|34\|NZ_CP049244\|PILER-CR	335654-335687	34	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	1337001-1337034	9	0.735
NZ_CP049244_1	1.4\|335654\|34\|NZ_CP049244\|PILER-CR	335654-335687	34	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	494140-494173	9	0.735
NZ_CP049244_1	1.2\|335654\|35\|NZ_CP049244\|CRISPRCasFinder,CRT	335654-335688	35	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	1337001-1337035	10	0.714
NZ_CP049244_1	1.4\|335654\|34\|NZ_CP049244\|PILER-CR	335654-335687	34	NZ_CP016620	Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence	168914-168947	10	0.706

1. spacer 1.1|335587|35|NZ_CP049244|CRISPRCasFinder,CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcgcatgagggctcgatgctggtgacggacct	CRISPR spacer
cttgcgcatgagggctcgatgctggtgacggacct	Protospacer
***********************************

2. spacer 1.2|335654|35|NZ_CP049244|CRISPRCasFinder,CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccagcgaccagatcatgaaaccgatcaccgcgca	CRISPR spacer
gccagcgaccagatcatgaaaccgatcaccgcgca	Protospacer
***********************************

3. spacer 1.3|335721|35|NZ_CP049244|CRISPRCasFinder,CRT matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttggtcggcatggcgttcttccttcatgtcagagt	CRISPR spacer
ttggtcggcatggcgttcttccttcatgtcagagt	Protospacer
***********************************

4. spacer 1.4|335654|34|NZ_CP049244|PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccagcgaccagatcatgaaaccgatcaccgcgc	CRISPR spacer
gccagcgaccagatcatgaaaccgatcaccgcgc	Protospacer
**********************************

5. spacer 1.5|335721|34|NZ_CP049244|PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttggtcggcatggcgttcttccttcatgtcagag	CRISPR spacer
ttggtcggcatggcgttcttccttcatgtcagag	Protospacer
**********************************

6. spacer 2.1|409182|30|NZ_CP049244|PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tttctccagcgacccgccaccatttccaac	CRISPR spacer
tttctccagcgacccgccaccatttccaac	Protospacer
******************************

7. spacer 2.2|409248|33|NZ_CP049244|PILER-CR matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

ttcgagatcgacgacaggagagccgtccaagca	CRISPR spacer
ttcgagatcgacgacaggagagccgtccaagca	Protospacer
*********************************

8. spacer 2.3|409181|34|NZ_CP049244|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gtttctccagcgacccgccaccatttccaacgaa	CRISPR spacer
gtttctccagcgacccgccaccatttccaacgaa	Protospacer
**********************************

9. spacer 2.4|409247|37|NZ_CP049244|CRISPRCasFinder matches to NZ_CP049244 (Rhizobium pseudoryzae strain DSM 19479 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

tttcgagatcgacgacaggagagccgtccaagcaatc	CRISPR spacer
tttcgagatcgacgacaggagagccgtccaagcaatc	Protospacer
*************************************

10. spacer 2.1|409182|30|NZ_CP049244|PILER-CR matches to AP014262 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.867

tttctccagcgacccgccaccatttccaac	CRISPR spacer
tttatccagcgacccgccaccaattctcac	Protospacer
*** ****************** ***. **

11. spacer 1.4|335654|34|NZ_CP049244|PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.794

--gccagcgaccagatcatgaaaccgatcaccgcgc	CRISPR spacer
acaccggcg--cagatcatgaaccggatcaccgcga	Protospacer
  .**.***  *********** * **********

12. spacer 2.3|409181|34|NZ_CP049244|CRISPRCasFinder matches to AP014262 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S31-C59, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 7, identity: 0.794

gtttctccagcgacccgccaccatttccaacgaa	CRISPR spacer
ttttatccagcgacccgccaccaattctcacaac	Protospacer
 *** ****************** ***. **.*

13. spacer 2.2|409248|33|NZ_CP049244|PILER-CR matches to MG592561 (Vibrio phage 1.191.O._10N.286.52.B4, partial genome) position: , mismatch: 8, identity: 0.758

ttcga---gatcgacgacaggagagccgtccaagca	CRISPR spacer
---gaactgatcgacaactggagagccgtccatgtt	Protospacer
   **   *******.** ************* *.

14. spacer 1.4|335654|34|NZ_CP049244|PILER-CR matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 9, identity: 0.735

gccagcgaccagatcatgaaaccgatcaccgcgc	CRISPR spacer
ttcagcgaccagatcatggaagcgatccatccgt	Protospacer
 .****************.** *****  . **.

15. spacer 1.4|335654|34|NZ_CP049244|PILER-CR matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.735

gccagcgaccagatcatgaaaccgatcaccgcgc	CRISPR spacer
accgtcatgaagatcaggacaccgatcaccgcgc	Protospacer
.**. *.   ****** ** **************

16. spacer 1.2|335654|35|NZ_CP049244|CRISPRCasFinder,CRT matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 10, identity: 0.714

gccagcgaccagatcatgaaaccgatcaccgcgca	CRISPR spacer
ttcagcgaccagatcatggaagcgatccatccgtg	Protospacer
 .****************.** *****  . **..

17. spacer 1.4|335654|34|NZ_CP049244|PILER-CR matches to NZ_CP016620 (Microvirga ossetica strain V5/3m plasmid unnamed4, complete sequence) position: , mismatch: 10, identity: 0.706

gccagcgaccagatcatgaaaccgatcaccgcgc	CRISPR spacer
atccagatccaggtcatgaagccgatcaccgctc	Protospacer
..* . . ****.*******.*********** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22722 : 61572

uncultured_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165222583.1\|22722_24150_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_165222585.1\|24638_24989_+\|transposase	transposase	NA	NA	NA	NA
WP_011053349.1\|24985_25330_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_165222587.1\|25403_26996_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	5.0e-52	32.7
WP_165222589.1\|27277_27574_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165222591.1\|27570_27837_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_165217141.1\|29029_30529_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.1e-13	26.9
WP_165217142.1\|30528_31263_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.0e-33	34.2
WP_165222594.1\|32853_33546_-	NnrU family protein	NA	NA	NA	NA
WP_165222596.1\|33558_33714_-	hypothetical protein	NA	NA	NA	NA
WP_165222599.1\|33831_34377_+	cytochrome c oxidase subunit 3 family protein	NA	NA	NA	NA
WP_165222602.1\|34381_34672_+	hypothetical protein	NA	NA	NA	NA
WP_165222605.1\|34668_34887_-	hypothetical protein	NA	NA	NA	NA
WP_165222607.1\|35110_35563_+	cytochrome c	NA	NA	NA	NA
WP_165222610.1\|35585_36926_+	nitric-oxide reductase large subunit	NA	NA	NA	NA
WP_165222612.1\|36986_37799_+	CbbQ/NirQ/NorQ/GpvN family protein	R4TG24	Halovirus	4.8e-11	32.4
WP_165222615.1\|37806_39702_+	VWA domain-containing protein	NA	NA	NA	NA
WP_165222617.1\|39774_41124_-	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_165222620.1\|41309_41576_+	DUF2249 domain-containing protein	NA	NA	NA	NA
WP_165222622.1\|41589_42939_+	hypothetical protein	NA	NA	NA	NA
WP_165222625.1\|42978_43491_+	DUF2249 domain-containing protein	NA	NA	NA	NA
WP_165222627.1\|43487_43775_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_165222630.1\|43848_45078_-	short-chain dehydrogenase	NA	NA	NA	NA
WP_165222633.1\|45264_46401_+	nitrite reductase, copper-containing	NA	NA	NA	NA
WP_165222635.1\|46471_47380_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_165222637.1\|47448_48144_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_165222639.1\|48263_48710_+	pseudoazurin	M4SLM5	Cyanophage	6.3e-05	30.9
WP_165222641.1\|49316_49832_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_165222643.1\|49987_50992_+	FecR family protein	NA	NA	NA	NA
WP_165222645.1\|51107_53528_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_165222647.1\|53572_54454_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165222649.1\|54450_56391_+	Fe(3+)-hydroxamate ABC transporter permease FhuB	NA	NA	NA	NA
WP_165222651.1\|56450_57257_+	ATP-binding cassette domain-containing protein	F2Y302	Organic_Lake_phycodnavirus	1.0e-08	25.8
WP_165222654.1\|57310_58261_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_165222657.1\|60144_61572_+\|transposase	ISNCY family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

336043 : 408931

Mycobacterium_phage(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165223220.1\|336043_337081_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	4.1e-15	31.7
WP_165223223.1\|337313_338450_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.9e-90	48.8
WP_165223226.1\|339940_340087_+	hypothetical protein	NA	NA	NA	NA
WP_165223229.1\|341301_343248_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
WP_165223232.1\|343261_344335_+	hypothetical protein	NA	NA	NA	NA
WP_165223235.1\|344390_345266_+	alpha/beta hydrolase	A0A068F2G2	Mycobacterium_phage	9.8e-18	30.5
WP_165223238.1\|345244_346237_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_165221754.1\|347757_348709_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	1.1e-11	27.9
WP_165223241.1\|349512_350469_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_165223244.1\|350599_352573_+	transketolase	NA	NA	NA	NA
WP_165223247.1\|352569_353526_+	glycerate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.8e-20	28.9
WP_165223250.1\|353541_354813_+	glycerate kinase	NA	NA	NA	NA
WP_165223253.1\|354898_355885_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	8.2e-13	24.7
WP_165223256.1\|355995_356850_+	transketolase	NA	NA	NA	NA
WP_165223259.1\|356846_357881_+	transketolase family protein	A0A0P0YNE1	Yellowstone_lake_phycodnavirus	1.5e-09	35.1
WP_165223262.1\|357925_358678_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.4e-14	28.4
WP_165223265.1\|358952_359921_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_165223268.1\|359965_360490_+	TRAP transporter small permease subunit	NA	NA	NA	NA
WP_165223271.1\|360502_361759_+	TRAP transporter large permease subunit	NA	NA	NA	NA
WP_165223274.1\|362487_363480_+\|transposase	IS5 family transposase	A0A1B0VFY5	Salmonella_phage	3.7e-45	37.9
WP_165223277.1\|363488_363755_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	2.6e-14	51.3
WP_165223280.1\|363751_364114_-\|transposase	transposase	NA	NA	NA	NA
WP_165223283.1\|364245_369438_-	AAA family ATPase	W8CYF6	Bacillus_phage	6.2e-11	31.7
WP_165223286.1\|369492_370389_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165223289.1\|370540_371197_+	hydrolase	NA	NA	NA	NA
WP_165223292.1\|371347_371587_+	XapX domain-containing protein	NA	NA	NA	NA
WP_165223295.1\|371659_373537_+	amidohydrolase	NA	NA	NA	NA
WP_165223298.1\|373650_374628_+	alpha/beta hydrolase	A0A249XU20	Mycobacterium_phage	3.2e-09	25.0
WP_165225305.1\|374765_376358_+	MFS transporter	NA	NA	NA	NA
WP_165223301.1\|376386_376761_-	response regulator	NA	NA	NA	NA
WP_165223304.1\|376846_377482_-	response regulator transcription factor	NA	NA	NA	NA
WP_165223307.1\|377663_378215_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165223310.1\|378458_378833_+	response regulator	NA	NA	NA	NA
WP_165223313.1\|378989_380714_+	ubiquinone-dependent pyruvate dehydrogenase	E5EQ70	Micromonas_sp._RCC1109_virus	6.0e-35	24.1
WP_165223316.1\|380716_381220_+	FUSC family protein	NA	NA	NA	NA
WP_165223319.1\|381384_381834_+	hypothetical protein	NA	NA	NA	NA
WP_165223322.1\|381903_383583_+	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.5e-30	31.0
WP_165223325.1\|383734_384850_-	2-polyprenyl-6-methoxyphenol hydroxylase	NA	NA	NA	NA
WP_165225308.1\|384860_386090_-	MFS transporter	NA	NA	NA	NA
WP_165223328.1\|386288_388538_-	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
WP_165223332.1\|388537_389026_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_165223335.1\|389022_390345_-	c-type cytochrome	NA	NA	NA	NA
WP_165223338.1\|390742_391258_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_165223341.1\|391273_392245_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_165223344.1\|392506_392839_+	hypothetical protein	NA	NA	NA	NA
WP_165223347.1\|393046_393193_+	hypothetical protein	NA	NA	NA	NA
WP_165223350.1\|394003_394144_-	DUF2474 domain-containing protein	NA	NA	NA	NA
WP_165223352.1\|394143_395154_-	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_165223354.1\|395155_396592_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_165223356.1\|397006_398209_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_165225311.1\|398380_399292_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165223357.1\|399402_400512_+	HlyD family secretion protein	NA	NA	NA	NA
WP_165223359.1\|400508_402110_+	MFS transporter	NA	NA	NA	NA
WP_165223361.1\|402415_404707_+	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_165223363.1\|405016_405598_-	response regulator	NA	NA	NA	NA
WP_165223365.1\|405703_406108_-	response regulator	NA	NA	NA	NA
WP_165225313.1\|406149_406614_-	response regulator transcription factor	NA	NA	NA	NA
WP_165217142.1\|406697_407432_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.0e-33	34.2
WP_165217141.1\|407431_408931_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.1e-13	26.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP049241

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049241_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049241_1

2603042-2603127

Orphan

Consensus_repeat	Method
GCCGCCCCGAAGAAGAAGGCTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP049241_1

>merge|NZ_CP049241|1|2603042-2603127|CRISPRCasFinder
GCCGCCCCGAAGAAGAAGGCTGCCAAGGCTGAGACCGCCGAGGCTGCTGAAGGCGAAGAAGCCGCAGCCCCGAAGAAGAAGGCTGC

>NZ_CP049241|1|1|2603042-2603127|CRISPRCasFinder
GCCGCCCCGAAGAAGAAGGCTGC	CAAGGCTGAGACCGCCGAGGCTGCTGAAGGCGAAGAAGCC
GCAGCCCCGAAGAAGAAGGCTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049241.1\|WP_165218861.1\|2593902_2594934_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
NZ_CP049241.1\|WP_165218889.1\|2615999_2616683_+\|nuclease	unknown	unknown	gnl\|CDD\|224442
NZ_CP049241.1\|WP_165218876.1\|2600578_2600725_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP049241.1\|WP_165218896.1\|2618644_2621143_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|225803
NZ_CP049241.1\|WP_165218888.1\|2613908_2615804_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP049241.1\|WP_165221721.1\|2606827_2610112_-\|maltose-alpha-D-glucosyltransferase	unknown	unknown	gnl\|CDD\|274140
NZ_CP049241.1\|WP_165218863.1\|2594984_2596091_+\|endonuclease	unknown	unknown	gnl\|CDD\|197338
NZ_CP049241.1\|WP_165218866.1\|2596906_2597824_+\|PhzF-family-phenazine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|223461
NZ_CP049241.1\|WP_165218890.1\|2616814_2617075_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049241.1\|WP_165218870.1\|2598593_2599532_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|224981
NZ_CP049241.1\|WP_165218874.1\|2600172_2600316_-\|DUF1127-domain-containing-protein	unknown	unknown	gnl\|CDD\|227744
NZ_CP049241.1\|WP_165221715.1\|2592220_2593915_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP049241.1\|WP_165218868.1\|2598192_2598411_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049241.1\|WP_165218864.1\|2596087_2596831_+\|NUDIX-hydrolase	unknown	unknown	unknown
NZ_CP049241.1\|WP_165218892.1\|2617630_2618122_+\|heme-degrading-domain-containing-protein	unknown	unknown	gnl\|CDD\|179430
NZ_CP049241.1\|WP_165218872.1\|2599749_2599974_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049241.1\|WP_165218878.1\|2604620_2606831_-\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
NZ_CP049241.1\|WP_165218894.1\|2618199_2618451_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP049241.1\|WP_165218880.1\|2610136_2613397_-\|DUF3416-domain-containing-protein	unknown	unknown	gnl\|CDD\|200482
NZ_CP049241.1\|WP_165218882.1\|2613588_2613810_-\|DUF982-domain-containing-protein	unknown	unknown	gnl\|CDD\|368772

Protein	Function_ID	Function_description	E-value
NZ_CP049241.1\|WP_165218861.1\|2593902_2594934_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	4.25061e-125
NZ_CP049241.1\|WP_165218889.1\|2615999_2616683_+\|nuclease	gnl\|CDD\|224442	COG1525, COG1525, Micrococcal nuclease (thermonuclease) homologs [DNA replication, recombination, and repair].	3.45067e-06
NZ_CP049241.1\|WP_165218876.1\|2600578_2600725_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	3.75312e-11
NZ_CP049241.1\|WP_165218896.1\|2618644_2621143_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|225803	COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	0
NZ_CP049241.1\|WP_165218866.1\|2596906_2597824_+\|PhzF-family-phenazine-biosynthesis-protein	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	3.89517e-98
NZ_CP049241.1\|WP_165218888.1\|2613908_2615804_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.4912e-57
NZ_CP049241.1\|WP_165221721.1\|2606827_2610112_-\|maltose-alpha-D-glucosyltransferase	gnl\|CDD\|274140	TIGR02456, Trehalose_synthase, trehalose synthase. Trehalose synthase interconverts maltose and alpha, alpha-trehalose by transglucosylation. This is one of at least three mechanisms for biosynthesis of trehalose, an important and widespread compatible solute. However, it is not driven by phosphate activation of sugars and its physiological role may tend toward trehalose degradation. This view is accentuated by numerous examples of fusion to a probable maltokinase domain. The sequence region described by this model is found both as the whole of a trehalose synthase and as the N-terminal region of a larger fusion protein that includes trehalose synthase activity. Several of these fused trehalose synthases have a domain homologous to proteins with maltokinase activity from Actinoplanes missouriensis and Streptomyces coelicolor (). [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP049241.1\|WP_165218870.1\|2598593_2599532_+\|nitronate-monooxygenase	gnl\|CDD\|224981	COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only].	2.35461e-72
NZ_CP049241.1\|WP_165218874.1\|2600172_2600316_-\|DUF1127-domain-containing-protein	gnl\|CDD\|227744	COG5457, COG5457, Uncharacterized conserved small protein [Function unknown].	2.92507e-11
NZ_CP049241.1\|WP_165221715.1\|2592220_2593915_+\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	9.06915e-98
NZ_CP049241.1\|WP_165218892.1\|2617630_2618122_+\|heme-degrading-domain-containing-protein	gnl\|CDD\|179430	PRK02487, PRK02487, heme-degrading domain-containing protein.	9.09159e-70
NZ_CP049241.1\|WP_165218863.1\|2594984_2596091_+\|endonuclease	gnl\|CDD\|197338	cd10283, MnuA_DNase1-like, Mycoplasma pulmonis MnuA nuclease-like. This subfamily includes Mycoplasma pulmonis MnuA, a membrane-associated nuclease related to Deoxyribonuclease 1 (DNase1 or DNase I, EC 3.1.21.1). The in vivo role of MnuA is as yet undetermined. This subfamily belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds.	4.70402e-07
NZ_CP049241.1\|WP_165218878.1\|2604620_2606831_-\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
NZ_CP049241.1\|WP_165218894.1\|2618199_2618451_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	5.43325e-09
NZ_CP049241.1\|WP_165218880.1\|2610136_2613397_-\|DUF3416-domain-containing-protein	gnl\|CDD\|200482	cd11344, AmyAc_GlgE_like, Alpha amylase catalytic domain found in GlgE-like proteins. GlgE is a (1,4)-a-D-glucan:phosphate a-D-maltosyltransferase, involved in a-glucan biosynthesis in bacteria. It is also an anti-tuberculosis drug target. GlgE isoform I from Streptomyces coelicolor has the same catalytic and very similar kinetic properties to GlgE from Mycobacterium tuberculosis. GlgE from Streptomyces coelicolor forms a homodimer with each subunit comprising five domains (A, B, C, N, and S) and 2 inserts. Domain A is a catalytic alpha-amylase-type domain that along with domain N, which has a beta-sandwich fold and forms the core of the dimer interface, binds cyclodextrins. Domain A, B, and the 2 inserts define a well conserved donor pocket that binds maltose. Cyclodextrins competitively inhibit the binding of maltooligosaccharides to the S. coelicolor enzyme, indicating that the hydrophobic patch overlaps with the acceptor binding site. This is not the case in M. tuberculosis GlgE because cyclodextrins do not inhibit this enzyme, despite acceptor length specificity being conserved. Domain C is hypothesized to help stabilize domain A and could be involved in substrate binding. Domain S is a helix bundle that is inserted within the N domain and it plays a role in the dimer interface and interacts directly with domain B. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP049241.1\|WP_165218882.1\|2613588_2613810_-\|DUF982-domain-containing-protein	gnl\|CDD\|368772	pfam06169, DUF982, Protein of unknown function (DUF982). This family consists of several hypothetical proteins from Rhizobium meliloti, Rhizobium loti and Agrobacterium tumefaciens. The function of this family is unknown. Structural modelling suggests this domain may bind nucleic acids.	2.43544e-10

>NZ_CP049241.1|WP_165218876.1|2600578_2600725_-|DUF1127-domain-containing-protein
MNIARSLNNWRKYRQTVTELGRMSDRELTDLGIGRGDIRRVARTAVGF
>NZ_CP049241.1|WP_165218874.1|2600172_2600316_-|DUF1127-domain-containing-protein
MNPIRLAKSWISYRRTMNELSSLSNQALSDIGLTRYDIRNIASRSFR
>NZ_CP049241.1|WP_165218872.1|2599749_2599974_+|hypothetical-protein
MKRIVALAAVALLGAGTIAFATDLSHASEGRLSIHSVGDTVSQVDLVHGERVAETYRVQPDHTLTLVARTPING
>NZ_CP049241.1|WP_165218870.1|2598593_2599532_+|nitronate-monooxygenase
MPLPSSFSNLRLPAVAAPMFLASGPDLVVETCRSGLVGTFPALNQRTTQGFVDWLAEIRDRLAGHANAAPYGVNLIVHRSNPRIEADLKAVVDNKVPLVITSLGAVPDVVNAVHSYGGLVFHDVISRRHAEKAAEAGVDGIIAVCAGAGGHAGTLSPFALIPEIRSFFGGTILLSGAMSTGAQIAAARMMGADLAYLGTRFLVTKEAMVSDDQKRMTMEAKAGDIIYTDAISGVNANFLRQSIVAAGLNPANLVSHGPMDMANEAKAWKNVWSAGQGVSAIDDIPAAADLCERLIAEYRAAMSQALSDPFTH
>NZ_CP049241.1|WP_165218868.1|2598192_2598411_+|hypothetical-protein
MIRSEKRPSEEPLNSEDLARCQQVFERLKADICLDEDHEEINRLAAITIELYRQGVRREDQLREMVAAARGH
>NZ_CP049241.1|WP_165218866.1|2596906_2597824_+|PhzF-family-phenazine-biosynthesis-protein
MVLRYMIYDVFTDTRLAGNPLAVVFGADALSDETMQALAGEMNLSETVFIRTAQNPAHAARLRIFTPARELPFAGHPTVGAAIAISELNHADQHPDFDIVCVLEENVGPVRCAVKLSDTGASFAEFDLPRNPVRTDLNLDRQGLADALGVKLSDLGFENHVPAIWSAGVPFLMLPLHNLAAVEGVEFDVTLWEKAAPLVEGRLASAYVYCRGGVHHAAKFHARMFSPDMGIAEDPATGGAAAALAGAIHQFDALPDGLTPILIEQGVEMGRPSFIHLHIDVKDGAISKARIGGQAVKLASGELHL
>NZ_CP049241.1|WP_165218864.1|2596087_2596831_+|NUDIX-hydrolase
MMERHATQPVDSKVFAISGIDMRVEPGRHSFEIAEEAAIAENWQRELAANPALYNGEIVLQEEIKLHGGVVEARARMSNFATLLWWRKQPQPTSGRMLVASAVPISSDGAAIVIRMAPHTANPGMVYFAAGSLDGSDLRLDGTVDVLGSMGRELLEETGLRVDDASADPVLYAVSAGARFYLFRFYRFPWTAAEMCRRVEAHMAVDPDPEINAVYPLTSADLSLHRYDRLARIILPFFFGDETNKAG
>NZ_CP049241.1|WP_165218863.1|2594984_2596091_+|endonuclease
MPLRLATFNIENLMARFDFSGFRKQWRQDRVVKMFGVEDQELYRDLEQARLISETDDTRQLSALAIAETAADILCLQEVDDMAALQAFEENYLYRMLGYGYRQKILVEGNDSRGIDVAVMMRDRTRDGLPIELVDVRSHATLTYQDLDLFTPQIALTNQPQDRIFRRDCLEVDVKIGGRPLTLYVVHFKSMTGSREEGDARMATMPVREAEARAVRHIIEQRFDRNLANRNFVICGDMNDYQERVKVIGDRLDGYRFEPAREEVSALDIFSRDGFAENIVRRRPEMDRWTLYHARGPQEQHLCQLDYLWLSPALSRANPDAVPQIIRNGQPYRTVFPPDQAVERFPRIGWDRPKASDHCPVVVSLEIQ
>NZ_CP049241.1|WP_165218861.1|2593902_2594934_+|ABC-transporter-ATP-binding-protein
MAQLILNHLSKDFGTGKPAVTGVSLKIREGGFLALLGPSGCGKTTVLRMIAGFEQPSDGEIFLGEWRLADVNAMVPPEKRNMAMVFQSYALWPHMSVAENVGYPLKVRGLSRDARDTKIRAALEAVRLDAFADRRPADLSGGQRQRVALARCLVTDPDVVLLDEPLANLDRHLRQEMEETFREFHVRSRATMIYVTHDQAEAMALATDVAVMAEGKLLQVAPPQEIYARPEGRIVGGLIGQGAILSLPWPDQAGREADWSVIREMVSPQALFTQSFADVLVRPQDVILSDEGLDAAVESAVFEGERYALRLRLDNGQRLRAFSRRPHAVGDRVRAVIRSAWRL
>NZ_CP049241.1|WP_165221715.1|2592220_2593915_+|iron-ABC-transporter-permease
MSRILTLGNSQPRWLFPFVLIVLFLLSVLPLGRLAATGILSLMRGGGDGLLSDPSLWAALWNTLATSFYGMLVSVLIGGAFALLLTLFDIRGKWMLGFLFMLPMMIPPQVTALSWVGLTGPSSTLLKAIGMAPPLGSPQPLYSIGGIALLLGVQNAPLVYLALRAGLLALPRDGIEAARLSGASALQVLMHIILPLALPGFAAGAAMAFVSNVGNFGIPAILGIPASIYTLPTLIYAKFASFGPNTFADISLLSGLIALLSVAGLLVEERVLRGRDYRIIGLSGRTAVFQLKSWRLFCELSLWLVLLLILVLPFAALVASSLAPAYGVPLSLKTATIHAYEEVLLRQAVTQTAFRNSIGLSLATAFGLLLVTVLMGYLVARSGRRLAALIGALADIPYALPGIVLAVACILLFAAPLPVFGVSIYGTIWILLFAYCSSFLAVSLRPIASAFRQLDPSLEEAARLSGAGFFRRMRDILSPLIAPAAGAAVILVFLIACNELTVSALLWSAGTQTLGVAIYNLDDSGSFNLASALSVLVVGMVVVMMFLLELLANRLPKGVVPWRS
>NZ_CP049241.1|WP_165218878.1|2604620_2606831_-|1,4-alpha-glucan-branching-protein-GlgB
MNIERSELTTGIDREALNALVEGRHGDPFSILGPHPVQGATIIRTFLPGAEGVEIVNRDTGRVDTKMHAIHPGGVFAAAVESGSRYRLRIQWPEAVQETEDPYSFGPLLGDLDLHLIGQGTHYDLGRTLGARAMEIDGVSGVRFSVWAPNARRVSVVGDFDAWDGRRHPMRLRQSSGVWELFVPRLGPGDRYKFEILDRNGTVLPQKADPVARASEAAPATASIVASSQPFRWTDDEWMRSGADRRSGEAAISVYEVHLGSWLRIAEENNRSLDWVELSQRLVPYAQTLGFTHIELLPIMEHPFGGSWGYQPLGLFAPTGRYGTPEDFAYFIDRCHAAGIGVILDWVPAHFPTDVWGLARFDGTALYEHEDPREGFHKDWNTLIYNLGRNEVKGFLLASALEWLEHFHIDALRVDAVASMLYRDYSRNADEWIPNQYGGRENLESVEFFKHLNSIIHQRCPHAFTVAEESTAWPGVTKPVEEGGLGFDFKWNMGWMHDTLHYMEKEPVFRQYHHGMMTFGMVYAYSERFMLPLSHDEVVHGKGSLIGKMPGDHWQKMANLRAYFGFMWAHPGKKLMFMGGEIGQLTEWNHDGSVHWDLLDRPDHAGLQRLIADLNRLYAAEPALQYGDLHPEGFEWVVGDDAANSVFGMLRKSADGEGLILAISNLTPVPRPGYRVGVPKAGRWREILNTDAGVYGGSNLGNVEAWSEAHPAHGRDQSIILTLPPLSTIYLRFDAE
>NZ_CP049241.1|WP_165221721.1|2606827_2610112_-|maltose-alpha-D-glucosyltransferase
MQSAQTQQTDQNLLWYKDSIIYQLHVKSFYDSNGDGIGDFAGLTEKIDHIASLGATAIWLLPFFPSPRRDDGYDIADYGNVSPDYGTMDEFRAFVDAAHARGIRVIIELVINHTSDQHPWFQRARNAPAGSPERDFYVWSDTDQKFPETRIIFLDTEKSNWTWDPVAGAYYWHRFYSHQPDLNFDNPQVLDELLNVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHDILKKIRAALDATHPGKVLLAEANQWPEDTSEYFGDGDECNMAFHFPLMPRMYMAIAKEDRFPITDIMRQTPEIPDNCQWAIFLRNHDELTLEMVTDEERDYLWNIYAADRRARINLGIRRRLAPLMERDRRRVELMNGLLLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRADPARLVLPPVMDPLYGYEALNVEAQSVDQHSLLNWTRRMLALRGRHPAFGRGSLRFLTPGNRKILAYLREYEGDTILCVANLSRLPQAVELDLSEFQGRVPIELTGMSPFPPIGQLTYLLTLPPFSFYWFQLVAEADGPAWRTEPPEQLPDLTTLVFRRDLTELVDEPRLSVTLSREVLPAYLGKRRWFGSKGERLKSAKLVAATPMGFTHNIMLGELEAELEGHTETYLLPLTHVWDEQQPSALAQQLALARIRQGRRVGFLTDGFAIEGLARGVIRGLCERSVISGRAGTLEFLGSDHLDCMTLSDDMEVRWLSAEQSNSSLIIGDLAMVKLIRHIFPGVHPEVEMTRYLTKVGYKNTAPLLGEVARIAPDGSRFTLILVQGAIRNQGDAWNWMLTNLRRVLDDIGLTQPEDEAVDDMLRPLVTMAGTIGTRLGELHAALAEDTDDEDFRPLPAKAENVELWRLSAVGQIEKALSILADANGEFDPETAALAEPLIARREELLDLAAELATSAEGAMMIRNHGDFHLGQILVAEADAFIIDFEGEPARDLSERRAKTIPLRDVAGLLRSLSYLAATADLENEAVTETENPDRTTLIRRFTEQAERAFLESYLVAVDQSETLAVDPDRRRRMLDLYLLEKAAYEIGYEARNRPKWLPIPLGGFAAIVDRLTEKTA
>NZ_CP049241.1|WP_165218880.1|2610136_2613397_-|DUF3416-domain-containing-protein
MNVAEPLPSRITTPSPAPRLYYVHPLMLGDGTAWEGMFRHASDLGFDTVLTAPLVARPTGGSVFVARDADRLDPAYGLGEDVDAGLRRLCEMAKAHGLRLMVDLVLDREAVDEDAPSSVLADPRLSPNDRSSRQVMAEDAGTADRMLAAWGPRLERMVEAGVAGFRCLGLDRVPEETWRQLIKIATDRNPTCVFLAWTPGTSFDLRRRLPDLGFHGCFSSLAWWDLESRWFMEEYEIQRRFAFQITFPEAPFARRLAHGMDSTEIRMRRARQALHLSATLGQGLMIPIGFEYGATAPLDPTFGDGEGLRGLAERQTFDLSAEIRATNGRLQGTADAFSQKPLQLIASTQSPALALMQADSEDRRRARSVRLVVVNRDLRRSAPAPLNALREAASAFLPLKPADQPQSDTIPAALRLQPGELRLLEGTASPAIRDAVPAEDVMEAAASPRLAIEAITPAVDDGRFPVKRIVGETVTVEADVFGDGHDPISAALVFRAADEADWTEVPMRLIENDRWRGEFTPRRMGRYEFAVETWRNPFQIFRYELSKKHEARLDLKLELQEGVNLIRASLDSASGYTAEALQDLLTQLDQAAESERVVMLLAPETFALMAKADRRPHRVRSQAIPLDAERREAGFASWYQIFPRSQSGDPNRHGTFDDVIQRLPAIREMGFDVLYFPPIHPIGKTNRKGRNNSLTAGPNDPGSPYGIGSEDGGHDAIHPELGTFEDFRRLVAAAEEHGLEIALDLAIQASPDHPWLKDHPGWFDWRPDGTVRYAENPPKKYEDIVNVDFYAKDAVPSLWVELRDVVQKWVDNGVKLFRVDNPHTKPLPFWEWLIADIRNRHPEVVFLSEAFTRPKVMYRLAKVGFSQSYTYFTWRNTKWELETYMREITTEAPKEFFRPHFFVNTHDINPDFLQNAPRSAYLIRAALAATLSGLWGVYNGFELCEGRPDAKRKEYADSEKYEIRAWDYDRPGHIKGEIAMLNRIRRENPALHSHLGLKQLIAWNDNIMFYEKASPGRENVLLVGVSLDPHHVQEADVEIPLWSWNLPDHGALNLEDLVTGQTFVATGKWQRLRLQPHLPFSIWRVR
>NZ_CP049241.1|WP_165218882.1|2613588_2613810_-|DUF982-domain-containing-protein
MHEAQWQKPVRAGGRAIRNPLEAIRFMDREWPARKTMSFAQAHRTCLAALDGRQPADDARTSFKDAVDEAQLH
>NZ_CP049241.1|WP_165218888.1|2613908_2615804_-|diguanylate-cyclase
MNEPKNPFTTLLVMLAGILAVAALALWAESSNKSAHLQGLDNGLRHAALSIGNDVVDSIEMADIVLLGLTGEIKAYGGVDQVGTRLDHIIAELSKHAPDLRNIHVIGKDGHLIATTVTNADMHRTFADRAYFQYHATTASDEPLLGSPIVSRLSGEHIVTITKRLNDPSGAFAGVVVAHLAIDRFNTLLERYMSAFGSASAVVVHTDGTLLAATSEFANRIGEKVSLPPVQADLQDQLSTPVTTRAWSLDDRSRRTASFASSHPPVSITLGILQDSIAQEWAYDSRDRWFIGIALMVAAVAPSLRWYRQAKLHHASMTTLRQREQELQLLADASGDLIERLSVDGVREYVSAAAVDVLGCRPVDLVGTRVFDHLAREDRLTTTEKFVDFKRDGSEINRVVSRYLRPDGSEAWLETTLTRLEAHGILRGFVAITRDVTRRKLRHDELDALANTDTLTGLANRRAFDTALTTRLQAARDNATPLSLLIIDVDRFKLYNDTYGHASGDDCLKAVATATRSAVRRDDFVARYGGEEFAVLLERADADAARATAEKIRRTIASLRYPHERNLPWGYATISIGTATTGTDEITPDTAHMLFNAADAALYRAKGSGRNRVQSDDGTNDDTDAGKVVNV
>NZ_CP049241.1|WP_165218889.1|2615999_2616683_+|nuclease
MAQATASKGRRPRRKAGRSRQASGKGRTWPWLLALVATAGAIAAFEHKQEVMRWLPTGVLPLSKSQATADNSAASARSDSAHTLPVHPVQPVARPAAVPAKPEPGEMTGKGFTGTFYFCGTSGLDNCVQSGDLFWFRKQAINLADVVAPETEKARCQAERDKGFAAKVRLRDLLNAGAFELVDWPNSDEDPRGRKLRVVMRNGQSIGAQLIREGLVHGVSDMGKGWC
>NZ_CP049241.1|WP_165218890.1|2616814_2617075_+|hypothetical-protein
MTLAHFPADRRTADIRRCAQALLSLHGEEANLFWRQEMAGFARTLSAQGAEPAEISHQAALFMNAVQMELQQLFAEDDPEALDAWA
>NZ_CP049241.1|WP_165218892.1|2617630_2618122_+|heme-degrading-domain-containing-protein
MSIESDIVRIGEQEKALRFERFDLGAAWSVGQHIHGVAAAAGHILSIDVQINGMQAFFAAMPGARPDFEHWIRRKRNIALRFLRSSYGVGLELAQQKTTLEEKWGLPTADYASHGGSVPILVEGVGCIGAVTVSGLPQRDDHNLVIESLAVHRGLDPQRLRHP
>NZ_CP049241.1|WP_165218894.1|2618199_2618451_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MESAGIGWIAAIIIGGIAGWLAEQFMKSNMGILMNVILGIVGAIIANAILGIFGIVLGGWIGYLIAGFIGACILIAVARMIRR
>NZ_CP049241.1|WP_165218896.1|2618644_2621143_+|mechanosensitive-ion-channel-family-protein
MRILSLRSFPAAVAGLLLLFISSVAVPGVGASLIPSAKAQTTPVAQPANPESLTARARVLAAEARKKLDLLTARAGANNVEDIQLAEVKAEADDLVAQISSFLSETKQRQDQIQARLKELGEPPKDGQPAEAAVVTEERNRLTAERTEITAISSEMGQLASTARGLSDKITEQRRRLFSATILKHTDLSPAVFSDAASAFLSEIKAFGDTMASWLSFAWKFKKLSLLGAVILSMGAALLFLAGGYRLFGKMVTRDLAMENPPYITRLSFAFWSLIIQTMSLSAFLLSTFFFLASFNVLRPDIAPIVASFLGTIWVVFFVARLAGLIFSPAHPHWRLIRLSNRGARRLYRLTMLMAVINSLDYWLSEISEALNSPVALTITRSVVATVLIGVILILMSFMKPVLAEDKDPHAQGRPWPRGFPLLLRLAGGVLILAVLSGYVGLARFVAMQIVLTGAIVVTMYIGVLSGRAVGKQGAFTKTAVGRYLAGRYRLSEIALDQIGLGAGLGIYAVALLFGLPLILLTWGFQIQDIQAGAVRLFTQISIGSISISLIGILVGILLFVAGYFVTRFVQSWIDRNVMARGHVDTGVRNSVKTGIGYIGVAVAVIIGVSAAGIDLSSLALVASALSVGIGFGLQNIVSNFVSGLILLVERPFKVGDHVVTGTTEGIVKRISVRATEIETFRKQTIIVPNSDLINASVGNWTHKNRMQRSEIPVGVSYGSDARKVMAILLDIAMTTPNVLHNPEPHVDFIGFGGSSLDFELRFHLADISEGIATRAAVRVEILRRFEEEGIEIPYPHQDVNITGTVFTVPAREKARAPVENATNTAEGEMNA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 53364

Dinoroseobacter_phage(18.75%)

portal,tail,transposase,capsid,head,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214248.1\|733_1685_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_165214250.1\|2391_2847_-	peptidase P60	A0A1V0DYB6	Dinoroseobacter_phage	3.4e-30	45.9
WP_165214252.1\|2843_3716_-	DUF2163 domain-containing protein	A0A1V0DY93	Dinoroseobacter_phage	1.4e-48	38.3
WP_165214254.1\|3712_4348_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	7.0e-50	49.0
WP_165214256.1\|4360_4921_-\|tail	phage tail tape measure protein	K7PH87	Enterobacterial_phage	3.8e-07	47.0
WP_165214258.1\|4970_5204_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_165214260.1\|5200_5563_-	gene transfer agent family protein	NA	NA	NA	NA
WP_165214262.1\|5562_5970_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_165214264.1\|6093_6357_+	type II toxin-antitoxin system VapB family antitoxin	NA	NA	NA	NA
WP_165214266.1\|6356_6743_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_165221064.1\|6957_8094_+	MFS transporter	NA	NA	NA	NA
WP_165214268.1\|8074_8473_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_165214270.1\|8469_8808_-\|head	phage head closure protein	NA	NA	NA	NA
WP_165214272.1\|8808_9378_-	hypothetical protein	NA	NA	NA	NA
WP_165214274.1\|9461_10538_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_165214276.1\|11000_12254_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	3.3e-83	43.2
WP_165214278.1\|12258_12831_-\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	4.4e-27	44.7
WP_165214280.1\|13002_14079_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_165214282.1\|14312_14636_-	hypothetical protein	NA	NA	NA	NA
WP_165214284.1\|14880_15186_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165214286.1\|15185_15458_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_165214288.1\|15533_16709_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	9.9e-66	40.9
WP_165221067.1\|18116_19394_-	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	4.2e-70	39.9
WP_165214290.1\|20794_21091_-	hypothetical protein	NA	NA	NA	NA
WP_165214292.1\|21455_21755_-	hypothetical protein	NA	NA	NA	NA
WP_165214294.1\|22221_22614_+	GFA family protein	NA	NA	NA	NA
WP_165214296.1\|22703_23222_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_165214298.1\|23218_24235_+	xanthine dehydrogenase family protein subunit M	NA	NA	NA	NA
WP_165214300.1\|24248_26522_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	A0A0P0I429	Acinetobacter_phage	4.8e-24	23.7
WP_165214302.1\|27879_28338_-	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_165214304.1\|28327_28564_-	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_165214306.1\|28674_30228_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	4.6e-42	33.1
WP_165214308.1\|30402_31044_+	porin family protein	O11861	Bartonella_henselae_phage	3.2e-10	28.4
WP_165214310.1\|31277_31481_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_165214312.1\|31492_31927_-	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_165221070.1\|31923_34395_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.9e-80	36.9
WP_165214314.1\|34548_34827_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165214316.1\|34823_35126_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_165214318.1\|35230_37420_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_165214320.1\|37697_38591_-	NAD(P)-dependent oxidoreductase	L7RCI0	Acanthamoeba_polyphaga_moumouvirus	1.4e-06	25.2
WP_165214322.1\|38698_38980_-	hypothetical protein	NA	NA	NA	NA
WP_165214324.1\|39084_39510_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_165214326.1\|39763_40234_-	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_165214328.1\|40417_42622_+	penicillin-binding protein	NA	NA	NA	NA
WP_165214330.1\|42742_43327_+	DUF1214 domain-containing protein	NA	NA	NA	NA
WP_165214332.1\|43319_43868_+	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_165214334.1\|44767_45772_+	DUF2336 domain-containing protein	NA	NA	NA	NA
WP_165214336.1\|45791_46133_-	DUF1491 family protein	NA	NA	NA	NA
WP_165214338.1\|46321_46555_+	hypothetical protein	NA	NA	NA	NA
WP_165221073.1\|46643_46964_+	XRE family transcriptional regulator	A0A1I9L2L2	Xanthomonas_phage	1.4e-09	43.6
WP_165214340.1\|46980_47355_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165214342.1\|47433_48414_-	peptidoglycan-binding protein	NA	NA	NA	NA
WP_165214344.1\|48385_49909_-	HAMP domain-containing histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	7.6e-26	35.0
WP_165214346.1\|50394_50850_+	DUF5330 domain-containing protein	NA	NA	NA	NA
WP_165214348.1\|51029_51452_+	SufE family protein	NA	NA	NA	NA
WP_165214350.1\|51462_52251_-	hypothetical protein	NA	NA	NA	NA
WP_165214352.1\|52243_52657_-\|transposase	transposase	NA	NA	NA	NA
WP_165214354.1\|52932_53364_-	MucR family transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.2e-21	45.0

DBSCAN-SWA_2

61530 : 68003

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214374.1\|61530_63237_-	vanadium-dependent haloperoxidase	A0A1V0SKZ4	Klosneuvirus	5.0e-42	36.0
WP_165214376.1\|63454_63955_-	N-acetyltransferase	NA	NA	NA	NA
WP_165214378.1\|64484_64934_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_165214380.1\|65054_68003_-	N-6 DNA methylase	R4TFP1	Halovirus	1.2e-11	30.9

DBSCAN-SWA_3

76413 : 77000

Brucella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221076.1\|76413_76704_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	3.0e-24	57.3
WP_165214407.1\|76700_77000_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	6.7e-19	52.0

DBSCAN-SWA_4

92685 : 94240

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214470.1\|92685_93288_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.8e-39	42.0
WP_165214473.1\|93586_93784_+	hypothetical protein	NA	NA	NA	NA
WP_165214475.1\|93811_94240_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PH90	Moraxella_phage	3.8e-15	38.9

DBSCAN-SWA_5

98558 : 99998

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214487.1\|98558_99386_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	9.8e-44	38.4
WP_165214490.1\|99550_99730_-	hypothetical protein	NA	NA	NA	NA
WP_165214492.1\|99710_99998_-	NINE protein	A0A219YD70	Aeromonas_phage	4.6e-09	50.0

DBSCAN-SWA_6

108531 : 121926

Paramecium_bursaria_Chlorella_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214520.1\|108531_109353_-	alpha/beta hydrolase	A0A076YK43	Mycobacterium_phage	5.0e-16	27.2
WP_165214522.1\|109781_110630_+	hypothetical protein	NA	NA	NA	NA
WP_165214524.1\|110668_111364_-	hypothetical protein	NA	NA	NA	NA
WP_165214526.1\|111360_112854_-	NTP transferase domain-containing protein	M1HXP3	Paramecium_bursaria_Chlorella_virus	1.4e-51	47.2
WP_165214528.1\|112853_113606_-	HAD family phosphatase	M1HXP3	Paramecium_bursaria_Chlorella_virus	3.4e-35	41.1
WP_165214530.1\|113499_114120_-	hypothetical protein	NA	NA	NA	NA
WP_165214533.1\|114448_114805_+	HNH endonuclease	NA	NA	NA	NA
WP_165214536.1\|114927_115230_+	alkylphosphonate utilization protein	NA	NA	NA	NA
WP_165214539.1\|115655_116060_-	DUF559 domain-containing protein	NA	NA	NA	NA
WP_165214541.1\|116117_117731_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	9.7e-80	42.7
WP_165214544.1\|117729_118827_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_165214547.1\|119043_119433_+	hypothetical protein	NA	NA	NA	NA
WP_165214550.1\|119610_119886_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_165214553.1\|119878_120169_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165214556.1\|120447_121926_+	peptidase M15	B6DZZ7	Stx2-converting_phage	1.8e-27	32.3

DBSCAN-SWA_7

126949 : 128593

Swinepox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214582.1\|126949_128593_-	cisplatin damage response ATP-dependent DNA ligase	Q8V3G6	Swinepox_virus	3.7e-10	27.0

DBSCAN-SWA_8

141794 : 142076

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214635.1\|141794_142076_-	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	3.0e-13	43.0

DBSCAN-SWA_9

148506 : 150860

Burkholderia_virus(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214652.1\|148506_148857_-	helix-turn-helix transcriptional regulator	Q8W6N2	Burkholderia_virus	4.9e-13	38.8
WP_165214655.1\|148863_149109_-	cytotoxic translational repressor of toxin-antitoxin stability system	NA	NA	NA	NA
WP_165214677.1\|149204_150860_+\|holin	choline dehydrogenase	A0A2K9L353	Tupanvirus	2.9e-34	25.4

DBSCAN-SWA_10

155553 : 156897

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214689.1\|155553_156897_+	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	4.5e-06	29.7

DBSCAN-SWA_11

165280 : 166783

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214708.1\|165280_166783_+	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	6.8e-27	28.5

DBSCAN-SWA_12

173399 : 176075

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214734.1\|173399_176075_-	pyruvate, phosphate dikinase	A0A2D2W2B1	Stenotrophomonas_phage	1.8e-94	41.5

DBSCAN-SWA_13

186474 : 187611

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214761.1\|186474_187611_-	site-specific DNA-methyltransferase	A0A249XUJ2	Enterococcus_phage	6.7e-27	29.2

DBSCAN-SWA_14

192636 : 197520

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214777.1\|192636_193935_+	insulinase family protein	G3MBJ8	Bacillus_virus	1.4e-44	30.7
WP_165214780.1\|193993_194617_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_165214783.1\|194613_197520_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.3e-10	29.4

DBSCAN-SWA_15

200684 : 209088

Pelagibacter_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214796.1\|200684_201170_+	peroxiredoxin	M1I839	Pelagibacter_phage	3.9e-24	48.3
WP_165214799.1\|201479_203411_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_165214802.1\|203789_204530_+	ABC transporter ATP-binding protein	M1I4Q1	Paramecium_bursaria_Chlorella_virus	5.0e-07	29.4
WP_165214805.1\|204526_205399_+	metal ABC transporter permease	NA	NA	NA	NA
WP_165214808.1\|205416_206316_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165214811.1\|206534_206843_-	Dabb family protein	NA	NA	NA	NA
WP_165214814.1\|206889_207336_-	ribonuclease HI	J9Q745	Salmonella_phage	6.5e-42	55.4
WP_165214817.1\|207332_208304_-	homoserine kinase	NA	NA	NA	NA
WP_165214820.1\|208493_208895_-	type II toxin-antitoxin system HicB family antitoxin	A0A0U4ISP5	Pseudomonas_phage	6.3e-20	44.1
WP_165214823.1\|208899_209088_-	type II toxin-antitoxin system HicA family toxin	A0A0R6PJD4	Moraxella_phage	1.4e-14	60.0

DBSCAN-SWA_16

214591 : 216286

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214849.1\|214591_216286_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.4e-07	34.3

DBSCAN-SWA_17

219903 : 221015

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221121.1\|219903_220584_+	HAD family phosphatase	M1I080	Acanthocystis_turfacea_Chlorella_virus	7.1e-08	28.3
WP_165214858.1\|220595_221015_-	ribbon-helix-helix protein, CopG family	D6R430	Bacillus_phage	5.7e-08	26.9

DBSCAN-SWA_18

225820 : 235179

Agrobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214875.1\|225820_226975_+	J domain-containing protein	A0A2L0UZR4	Agrobacterium_phage	9.9e-10	52.4
WP_165214878.1\|227106_227925_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_165214881.1\|227951_228548_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_165214884.1\|228564_228825_-	DUF1344 domain-containing protein	NA	NA	NA	NA
WP_165214887.1\|229230_232818_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.8e-18	36.0
WP_165214890.1\|232954_234052_+	chorismate synthase	A0A291AU41	Pandoravirus	1.3e-67	40.8
WP_165214893.1\|234078_235179_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.5e-58	36.2

DBSCAN-SWA_19

239292 : 239973

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214911.1\|239292_239973_+	ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	1.3e-09	25.5

DBSCAN-SWA_20

243460 : 244396

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214924.1\|243460_244396_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	1.0e-44	32.1

DBSCAN-SWA_21

248730 : 249516

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214954.1\|248730_249516_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.7e-18	28.2

DBSCAN-SWA_22

254950 : 257074

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214967.1\|254950_257074_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.3e-47	31.5

DBSCAN-SWA_23

266327 : 267575

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165214984.1\|266327_267575_+	class I SAM-dependent RNA methyltransferase	A0A2K5B251	Erysipelothrix_phage	2.7e-21	26.3

DBSCAN-SWA_24

278815 : 279796

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215012.1\|278815_279796_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	3.5e-40	38.9

DBSCAN-SWA_25

285634 : 286891

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215024.1\|285634_286891_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	2.8e-50	35.2

DBSCAN-SWA_26

301673 : 303698

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215055.1\|301673_303698_+	hypothetical protein	W8CYF6	Bacillus_phage	7.5e-21	28.8

DBSCAN-SWA_27

308247 : 309114

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215071.1\|308247_309114_-	S49 family peptidase	A0A2I7REP4	Vibrio_phage	6.1e-12	27.4

DBSCAN-SWA_28

315594 : 317585

Acidianus_two-tailed_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215091.1\|315594_316752_+	PA0069 family radical SAM protein	A0A1C9EG97	Acidianus_two-tailed_virus	4.8e-12	30.7
WP_165215094.1\|316931_317585_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	3.5e-28	43.9

DBSCAN-SWA_29

320601 : 323795

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215106.1\|320601_321735_-	cell wall hydrolase	A0A218MLD1	uncultured_virus	1.4e-24	45.0
WP_165215109.1\|321881_323795_-	potassium transporter Kup	A7K9V6	Acanthocystis_turfacea_chlorella_virus	8.9e-64	29.4

DBSCAN-SWA_30

332464 : 337730

Bordetella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215132.1\|332464_333826_-	EAL domain-containing protein	A0A2D0WB36	Bordetella_virus	3.0e-05	36.7
WP_165215134.1\|333908_335591_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	5.5e-09	33.9
WP_165215135.1\|335882_337730_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.1e-106	39.0

DBSCAN-SWA_31

341343 : 341583

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215145.1\|341343_341583_-	DUF4170 domain-containing protein	K4JVU0	Caulobacter_phage	1.5e-05	40.9

DBSCAN-SWA_32

350580 : 359822

uncultured_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215166.1\|350580_353541_-\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	2.4e-55	24.3
WP_165215168.1\|353711_354335_+	DUF1902 domain-containing protein	NA	NA	NA	NA
WP_165215171.1\|354360_355341_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_165221148.1\|355354_356203_-	TIGR01459 family HAD-type hydrolase	NA	NA	NA	NA
WP_165215173.1\|356305_357676_-	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	3.9e-29	60.2
WP_165215176.1\|357815_358112_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	4.2e-21	56.5
WP_165215178.1\|358181_359822_+	chaperonin GroEL	A0A219YK78	uncultured_virus	5.8e-173	61.4

DBSCAN-SWA_33

364359 : 368107

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215194.1\|364359_365961_-\|tRNA	histidine--tRNA ligase	A0A2K9L6G5	Tupanvirus	1.3e-28	25.0
WP_165215196.1\|366108_366288_+	hypothetical protein	NA	NA	NA	NA
WP_165215198.1\|366434_367190_+	hypothetical protein	NA	NA	NA	NA
WP_165215200.1\|367228_367651_+	hypothetical protein	NA	NA	NA	NA
WP_165215203.1\|367699_368107_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	4.7e-15	48.4

DBSCAN-SWA_34

377053 : 378574

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221157.1\|377053_378574_+	inorganic phosphate transporter	G9E3M1	Emiliania_huxleyi_virus	3.1e-19	41.6

DBSCAN-SWA_35

383413 : 390737

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215237.1\|383413_384871_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-09	56.9
WP_165215239.1\|384989_385772_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
WP_165215242.1\|385789_386953_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_165215245.1\|387119_388148_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	1.4e-34	28.5
WP_165221160.1\|388292_388709_-	hypothetical protein	NA	NA	NA	NA
WP_165221163.1\|388780_389146_-	hypothetical protein	NA	NA	NA	NA
WP_165215248.1\|389243_390737_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	3.5e-92	39.7

DBSCAN-SWA_36

402230 : 404948

Bathycoccus_sp._RCC1105_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215283.1\|402230_404948_-	AAA family ATPase	E5ESM9	Bathycoccus_sp._RCC1105_virus	2.8e-23	25.9

DBSCAN-SWA_37

409769 : 412448

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215287.1\|409769_412448_+	class I SAM-dependent DNA methyltransferase	Q6NE04	Leptospira_phage	2.6e-130	35.2

DBSCAN-SWA_38

424660 : 425332

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221172.1\|424660_425332_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-18	33.9

DBSCAN-SWA_39

442049 : 447362

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215337.1\|442049_444245_-	glycosyltransferase	R9S8I6	Prochlorococcus_phage	3.2e-09	23.9
WP_165215339.1\|444244_445312_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_165221180.1\|445365_446628_-	capsule biosynthesis protein	NA	NA	NA	NA
WP_165215342.1\|446708_447362_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.6e-09	24.8

DBSCAN-SWA_40

451521 : 452880

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221183.1\|451521_452880_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	V5LQ39	Emiliania_huxleyi_virus	5.0e-53	35.3

DBSCAN-SWA_41

466672 : 468310

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215364.1\|466672_468310_-	3'-5' exonuclease	A2I2Z6	Vibrio_virus	4.4e-11	30.4

DBSCAN-SWA_42

475096 : 476002

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215377.1\|475096_475306_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	4.0e-10	44.4
WP_165215379.1\|475422_475707_+	cold-shock protein	NA	NA	NA	NA
WP_165215382.1\|475759_476002_+	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	2.6e-05	52.4

DBSCAN-SWA_43

480560 : 485261

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215394.1\|480560_481685_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-24	37.1
WP_165215397.1\|481934_482426_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_165214232.1\|482480_482846_-	hypothetical protein	NA	NA	NA	NA
WP_165215399.1\|483147_483975_-	catalase	NA	NA	NA	NA
WP_165215402.1\|484112_485261_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	5.3e-104	47.8

DBSCAN-SWA_44

499979 : 503963

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215427.1\|499979_503963_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	1.4e-23	30.6

DBSCAN-SWA_45

510033 : 511200

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215440.1\|510033_511200_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.9e-26	34.3

DBSCAN-SWA_46

523267 : 524740

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215460.1\|523267_524740_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	1.9e-77	38.0

DBSCAN-SWA_47

529658 : 532692

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215472.1\|529658_530924_-	AAA family ATPase	C7BGE8	Burkholderia_phage	1.3e-18	22.4
WP_165221197.1\|531089_531446_-	hypothetical protein	NA	NA	NA	NA
WP_165215475.1\|531603_532692_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	2.0e-20	31.7

DBSCAN-SWA_48

539444 : 540344

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215490.1\|539444_540344_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	4.8e-28	37.5

DBSCAN-SWA_49

562905 : 564162

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215541.1\|562905_564162_-	hypothetical protein	S5YF14	Mycobacterium_phage	1.6e-08	28.4

DBSCAN-SWA_50

598524 : 599262

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215618.1\|598524_599262_-	helix-turn-helix transcriptional regulator	A0A1I9KF49	Aeromonas_phage	6.6e-07	49.2

DBSCAN-SWA_51

602341 : 602731

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215627.1\|602341_602731_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.1e-08	32.3

DBSCAN-SWA_52

607489 : 609867

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215639.1\|607489_607855_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.4e-13	37.6
WP_165215642.1\|607851_608151_-	STAS domain-containing protein	NA	NA	NA	NA
WP_165215644.1\|608241_609867_-	globin-coupled sensor protein	A0A2H4J162	uncultured_Caudovirales_phage	8.5e-15	39.6

DBSCAN-SWA_53

614883 : 615516

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215652.1\|614883_615516_+	TerC family protein	W8EBD0	Pseudomonas_phage	7.3e-15	35.9

DBSCAN-SWA_54

632411 : 637787

Caulobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221212.1\|632411_633218_-	phosphohydrolase	K4K650	Caulobacter_phage	2.8e-35	32.1
WP_165215698.1\|633292_635197_-	AAA family ATPase	E5ESM9	Bathycoccus_sp._RCC1105_virus	1.7e-35	30.0
WP_165221215.1\|635257_635773_-	hypothetical protein	NA	NA	NA	NA
WP_165215700.1\|636029_636251_-	hypothetical protein	NA	NA	NA	NA
WP_165215701.1\|636568_636796_+	hypothetical protein	NA	NA	NA	NA
WP_165215703.1\|636806_637787_+	ATP-binding protein	A0A0R6PCP6	Moraxella_phage	3.1e-12	31.5

DBSCAN-SWA_55

651173 : 657780

Stenotrophomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215718.1\|651173_652205_-	UDP-glucose 4-epimerase GalE	A0A2D2W2J1	Stenotrophomonas_phage	2.3e-34	32.9
WP_165215719.1\|652366_653533_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_165221218.1\|653636_654059_-	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
WP_165215721.1\|654276_657780_+	hybrid sensor histidine kinase/response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	2.8e-15	32.9

DBSCAN-SWA_56

663574 : 664324

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215732.1\|663574_664324_-	DUF5131 family protein	R9TNA8	Rhizobium_phage	1.2e-53	44.2

DBSCAN-SWA_57

685984 : 686479

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215757.1\|685984_686479_+	CAP domain-containing protein	U5Q1E2	Bacillus_phage	6.3e-06	35.1

DBSCAN-SWA_58

691093 : 691759

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215766.1\|691093_691759_+	helix-turn-helix transcriptional regulator	B5WZX5	Pseudomonas_phage	8.3e-09	33.3

DBSCAN-SWA_59

699094 : 703052

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215777.1\|699094_700012_-	ornithine carbamoyltransferase	M1I6M4	Paramecium_bursaria_Chlorella_virus	1.4e-19	27.0
WP_165215778.1\|700065_701262_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.8e-22	26.6
WP_165215780.1\|701679_702243_+	GcrA cell cycle regulator	NA	NA	NA	NA
WP_165215781.1\|702368_703052_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	1.0e-38	38.5

DBSCAN-SWA_60

707581 : 710069

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215788.1\|707581_708622_-	phosphonate ABC transporter substrate-binding protein	A0A1B1IWY0	uncultured_Mediterranean_phage	2.8e-64	41.3
WP_165215789.1\|708812_710069_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	3.6e-29	34.3

DBSCAN-SWA_61

713300 : 719415

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215794.1\|713300_714854_+	acyl--CoA ligase	A0A1V0SBX8	Catovirus	1.1e-11	26.2
WP_165221235.1\|714853_715858_+	NAD(+) synthase	NA	NA	NA	NA
WP_165215795.1\|715858_716971_-	hypothetical protein	NA	NA	NA	NA
WP_165215797.1\|717103_717493_-	PRC-barrel domain containing protein	NA	NA	NA	NA
WP_165215798.1\|717711_719415_+	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	9.4e-41	26.1

DBSCAN-SWA_62

725173 : 725872

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215803.1\|725173_725872_-	orotate phosphoribosyltransferase	S4W4D9	Pandoravirus	4.3e-16	36.4

DBSCAN-SWA_63

737206 : 737716

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215816.1\|737206_737716_+	FMN reductase	Q9KX93	Enterobacteria_phage	1.5e-23	56.0

DBSCAN-SWA_64

751000 : 751876

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215838.1\|751000_751876_-	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	4.7e-12	34.5

DBSCAN-SWA_65

757789 : 764155

Synechococcus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215857.1\|757789_758323_-	peptide deformylase	E3SLL2	Synechococcus_phage	8.6e-25	42.6
WP_165215858.1\|758428_759607_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_165215859.1\|759659_760559_+	ribokinase	NA	NA	NA	NA
WP_165215860.1\|760694_761123_+	Hsp20 family protein	A0A2H4N7P1	Lake_Baikal_phage	2.9e-15	34.7
WP_165215861.1\|761166_761424_+	DUF1150 family protein	NA	NA	NA	NA
WP_165215862.1\|761445_762159_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_165215863.1\|762161_763403_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	4.1e-94	47.8
WP_165215864.1\|763735_764155_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	1.5e-32	58.0

DBSCAN-SWA_66

767812 : 768871

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215870.1\|767812_768871_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	4.5e-49	50.5

DBSCAN-SWA_67

772796 : 777841

uncultured_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215879.1\|772796_773363_-	NifU family protein	A0A218MN08	uncultured_virus	7.0e-09	37.8
WP_165215880.1\|773475_773967_-	universal stress protein	NA	NA	NA	NA
WP_165215882.1\|774077_775142_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_165215883.1\|775615_776017_-	VOC family protein	NA	NA	NA	NA
WP_165215885.1\|776233_777841_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-17	31.4

DBSCAN-SWA_68

788283 : 791022

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215897.1\|788283_791022_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	1.1e-33	23.1

DBSCAN-SWA_69

795107 : 797243

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215905.1\|795107_797243_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-21	32.6

DBSCAN-SWA_70

800856 : 804398

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215914.1\|800856_801168_-	integration host factor subunit beta	A7KV42	Bacillus_phage	1.3e-12	46.0
WP_165215916.1\|801195_802152_-	signal peptide peptidase SppA	K4I1N3	Providencia_phage	6.5e-15	30.9
WP_165221256.1\|802335_803019_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_165215917.1\|803015_803588_+	hypothetical protein	NA	NA	NA	NA
WP_165215918.1\|803603_804398_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-22	28.8

DBSCAN-SWA_71

810666 : 811311

Cassava_brown_streak_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215930.1\|810666_811311_+	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	A0A0N9Z738	Cassava_brown_streak_virus	3.5e-12	31.7

DBSCAN-SWA_72

818074 : 821499

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215941.1\|818074_818965_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	2.1e-28	34.1
WP_165215942.1\|819109_819886_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_165215944.1\|819924_821499_+	2-polyprenylphenol 6-hydroxylase	A0A2P0VMP1	Tetraselmis_virus	3.1e-14	23.2

DBSCAN-SWA_73

827078 : 828293

Methanothermobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215957.1\|827078_828293_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	6.1e-42	33.6

DBSCAN-SWA_74

835572 : 841309

Streptococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215976.1\|835572_837087_+\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	7.4e-21	26.0
WP_165215977.1\|837350_838934_-	peptide chain release factor 3	A0A1B0RXH7	Streptococcus_phage	2.1e-34	28.1
WP_165215979.1\|839021_839480_+	dUTP diphosphatase	A0A1Q1PNN8	Noumeavirus	8.7e-42	61.1
WP_165215980.1\|839536_840151_+	LysE family translocator	NA	NA	NA	NA
WP_165215982.1\|840343_841309_+	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	4.8e-82	53.4

DBSCAN-SWA_75

844893 : 845997

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215988.1\|844893_845997_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	7.0e-21	31.6

DBSCAN-SWA_76

849623 : 851926

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165215996.1\|849623_850625_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.3e-47	41.4
WP_165215998.1\|850807_851926_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	3.1e-85	48.4

DBSCAN-SWA_77

859931 : 860294

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216015.1\|859931_860294_+	septal ring lytic transglycosylase RlpA family protein	A0A0F6SJ38	Sinorhizobium_phage	7.4e-28	73.3

DBSCAN-SWA_78

868541 : 870122

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216023.1\|868541_870122_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	5.5e-11	25.9

DBSCAN-SWA_79

878263 : 879352

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216033.1\|878263_879352_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.1e-24	33.2

DBSCAN-SWA_80

884069 : 885503

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216040.1\|884069_885503_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-13	43.4

DBSCAN-SWA_81

893069 : 894683

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216054.1\|893069_894683_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	7.3e-35	35.0

DBSCAN-SWA_82

906812 : 910054

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216070.1\|906812_907175_-	BrnA antitoxin family protein	A0A2H4J5Y5	uncultured_Caudovirales_phage	3.1e-10	42.5
WP_165216072.1\|907110_907407_-	BrnT family toxin	K4NX81	Burkholderia_phage	2.2e-14	51.8
WP_165216073.1\|907444_908530_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	8.4e-27	31.4
WP_165216075.1\|908674_909079_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_165216076.1\|909118_909322_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_165221277.1\|909517_910054_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	7.6e-13	32.9

DBSCAN-SWA_83

921065 : 925529

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216097.1\|921065_922886_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	7.2e-23	26.1
WP_165216098.1\|922950_923181_+	type II toxin-antitoxin system CcdA family antitoxin	NA	NA	NA	NA
WP_165216099.1\|923180_923480_+	hypothetical protein	NA	NA	NA	NA
WP_165216100.1\|924401_924590_-	YegP family protein	NA	NA	NA	NA
WP_165216101.1\|924746_925529_-	sugar ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	7.0e-07	27.7

DBSCAN-SWA_84

930544 : 931933

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216109.1\|930544_931933_-	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	5.5e-31	31.3

DBSCAN-SWA_85

947646 : 954660

Geobacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216131.1\|947646_948957_-	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.0e-79	41.3
WP_165216132.1\|948963_949734_-	deoxyribose-phosphate aldolase	NA	NA	NA	NA
WP_165216134.1\|949850_950654_-	purine-nucleoside phosphorylase	Q5YBA4	Grouper_iridovirus	1.2e-43	39.0
WP_165216135.1\|950650_951043_-	cytidine deaminase	NA	NA	NA	NA
WP_165216136.1\|951049_952021_-	ABC transporter permease	NA	NA	NA	NA
WP_165216138.1\|952031_953135_-	ABC transporter permease	NA	NA	NA	NA
WP_165216140.1\|953148_954660_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-25	31.7

DBSCAN-SWA_86

958988 : 960422

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216147.1\|958988_960422_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	2.1e-54	29.5

DBSCAN-SWA_87

963835 : 967992

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221292.1\|963835_964510_-	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	1.1e-05	25.1
WP_165216155.1\|964628_965975_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_165216156.1\|965971_966772_+	DUF1365 domain-containing protein	NA	NA	NA	NA
WP_165216158.1\|966768_967992_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	4.7e-34	31.1

DBSCAN-SWA_88

977553 : 984170

Stx2-converting_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216168.1\|977553_977931_-	XRE family transcriptional regulator	A0A0P0ZCT8	Stx2-converting_phage	1.5e-15	39.2
WP_165216170.1\|978022_978949_-	pseudouridine-5'-phosphate glycosidase	NA	NA	NA	NA
WP_165216171.1\|978952_980071_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165216173.1\|980254_980650_+	DUF1236 domain-containing protein	NA	NA	NA	NA
WP_165216174.1\|980691_981999_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.9e-136	54.4
WP_165214234.1\|982171_982456_-	hypothetical protein	NA	NA	NA	NA
WP_165216176.1\|982541_984170_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-20	33.2

DBSCAN-SWA_89

992106 : 1002911

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216186.1\|992106_993957_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-51	29.0
WP_165216188.1\|994005_994827_+	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_165216189.1\|994845_995481_+	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
WP_165216190.1\|995769_996471_+	DUF1045 domain-containing protein	NA	NA	NA	NA
WP_165216192.1\|996587_996878_+	hypothetical protein	NA	NA	NA	NA
WP_165216193.1\|996907_999907_-	DNA polymerase I	A0A142F1Q9	Bacillus_phage	1.6e-64	32.0
WP_165216195.1\|1000453_1000894_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_165216196.1\|1000966_1002349_+	dipeptidase	NA	NA	NA	NA
WP_165216198.1\|1002701_1002911_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	4.0e-10	46.0

DBSCAN-SWA_90

1007698 : 1011446

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216211.1\|1007698_1009600_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.6e-150	51.7
WP_165216212.1\|1009683_1010826_+	molecular chaperone DnaJ	A0A0G2YAM9	Acanthamoeba_polyphaga_mimivirus	1.6e-12	30.6
WP_165216214.1\|1010897_1011446_-	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	1.2e-18	31.8

DBSCAN-SWA_91

1015243 : 1016248

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216224.1\|1015243_1016248_-	D-glycerate dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	9.8e-22	28.2

DBSCAN-SWA_92

1024317 : 1026219

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216241.1\|1024317_1026219_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	4.1e-45	35.5

DBSCAN-SWA_93

1034791 : 1037584

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216257.1\|1034791_1037584_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	7.0e-25	25.3

DBSCAN-SWA_94

1063908 : 1066894

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216293.1\|1063908_1065225_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.9e-82	39.0
WP_165221311.1\|1065460_1066894_-	EAL domain-containing protein	G3MA91	Bacillus_virus	2.7e-17	31.6

DBSCAN-SWA_95

1073592 : 1086187

uncultured_Caudovirales_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216307.1\|1073592_1075890_+	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.8e-78	30.7
WP_165216308.1\|1075886_1076054_+	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_165216310.1\|1076096_1076798_-	ParA family protein	A0A0A8IL09	Aurantimonas_phage	6.6e-25	34.7
WP_165216311.1\|1076979_1078065_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_165216313.1\|1078071_1078944_-	chemotaxis protein CheR	NA	NA	NA	NA
WP_165216314.1\|1078940_1079429_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_165216316.1\|1079432_1081346_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.2e-09	41.8
WP_165216317.1\|1081475_1083167_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.0e-15	30.2
WP_165216319.1\|1083189_1083702_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_165216321.1\|1083698_1085822_-	chemotaxis protein CheA	NA	NA	NA	NA
WP_165216323.1\|1085818_1086187_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.4e-10	33.9

DBSCAN-SWA_96

1089474 : 1090563

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216328.1\|1089474_1090563_-	DUF475 domain-containing protein	K4JUR1	Caulobacter_phage	1.3e-64	41.1

DBSCAN-SWA_97

1113024 : 1117636

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216358.1\|1113024_1114962_+	M23 family metallopeptidase	G9BW84	Planktothrix_phage	4.7e-20	42.5
WP_165216359.1\|1115035_1117636_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	5.7e-122	38.1

DBSCAN-SWA_98

1127844 : 1128102

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216373.1\|1127844_1128102_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	1.7e-18	55.8

DBSCAN-SWA_99

1141500 : 1142058

Virus_Rctr197k(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216410.1\|1141500_1142058_-	HNH endonuclease	A0A1P8DIY8	Virus_Rctr197k	4.5e-24	39.8

DBSCAN-SWA_100

1155088 : 1156357

Bovine_gammaherpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216434.1\|1155088_1156357_+	diaminopimelate decarboxylase	A0A060D2X4	Bovine_gammaherpesvirus	1.3e-18	26.2

DBSCAN-SWA_101

1159783 : 1161911

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216439.1\|1159783_1160338_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.7e-07	28.7
WP_165216440.1\|1160377_1161049_-	hypothetical protein	NA	NA	NA	NA
WP_165216442.1\|1161251_1161911_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	9.3e-29	37.9

DBSCAN-SWA_102

1167108 : 1168215

Pacmanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216450.1\|1167108_1168215_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	2.5e-18	24.4

DBSCAN-SWA_103

1172654 : 1182614

uncultured_Mediterranean_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216460.1\|1172654_1173290_+	queuosine precursor transporter	A0A1B1IR19	uncultured_Mediterranean_phage	9.6e-07	30.8
WP_165216462.1\|1173295_1174294_-	hypothetical protein	NA	NA	NA	NA
WP_165216468.1\|1174304_1176200_-	cobaltochelatase subunit CobT	J9Q7G6	Salmonella_phage	8.1e-17	28.9
WP_165216477.1\|1176231_1177224_-	cobaltochelatase subunit CobS	L7TKP0	Rhizobium_phage	1.2e-40	31.5
WP_165216485.1\|1177298_1177925_-	DnaJ domain-containing protein	NA	NA	NA	NA
WP_165216487.1\|1178025_1178307_+	BolA family transcriptional regulator	NA	NA	NA	NA
WP_165221326.1\|1178319_1179627_-	HlyC/CorC family transporter	NA	NA	NA	NA
WP_165216488.1\|1179623_1180757_-	3-dehydroquinate synthase	A9YVT7	Ostreococcus_tauri_virus	1.8e-24	34.1
WP_165216490.1\|1180734_1181349_-	shikimate kinase	NA	NA	NA	NA
WP_165216492.1\|1181508_1181670_+	hypothetical protein	NA	NA	NA	NA
WP_165216494.1\|1181669_1182614_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.2e-37	33.1

DBSCAN-SWA_104

1210469 : 1210961

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216541.1\|1210469_1210961_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	2.7e-17	37.0

DBSCAN-SWA_105

1219795 : 1223324

Tetraselmis_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216547.1\|1219795_1220747_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	3.5e-13	28.4
WP_165216556.1\|1221051_1222845_+	PAS domain-containing protein	NA	NA	NA	NA
WP_165216558.1\|1222844_1223324_+	purine-binding chemotaxis protein CheW	Q56AR1	Bacillus_thuringiensis_phage	9.5e-07	26.6

DBSCAN-SWA_106

1238309 : 1241151

Oenococcus_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216577.1\|1238309_1239527_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.1e-54	37.0
WP_165216579.1\|1239534_1241151_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	2.4e-46	27.4

DBSCAN-SWA_107

1250250 : 1255133

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216594.1\|1250250_1251186_+	tyrosine recombinase XerC	A0A0F6SJK8	Mycobacterium_phage	1.3e-15	25.8
WP_165216596.1\|1251271_1252348_+	polysaccharide biosynthesis protein GumN	NA	NA	NA	NA
WP_165216598.1\|1252331_1252838_-	cytochrome b	NA	NA	NA	NA
WP_165216600.1\|1252949_1254356_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-47	29.2
WP_165221349.1\|1254380_1255133_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.4e-20	35.5

DBSCAN-SWA_108

1273491 : 1274586

Moraxella_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216646.1\|1273491_1274586_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.3e-72	47.1

DBSCAN-SWA_109

1282765 : 1283299

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216663.1\|1282765_1283299_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	6.8e-46	50.6

DBSCAN-SWA_110

1287663 : 1288653

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216673.1\|1287663_1288653_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-13	28.4

DBSCAN-SWA_111

1302046 : 1302757

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216719.1\|1302046_1302757_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.1e-10	30.2

DBSCAN-SWA_112

1306371 : 1306917

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216725.1\|1306371_1306917_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	2.0e-21	38.7

DBSCAN-SWA_113

1311513 : 1318305

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216732.1\|1311513_1312161_+	heme ABC exporter ATP-binding protein CcmA	G3M9Y6	Bacillus_virus	2.3e-11	26.8
WP_165216734.1\|1312498_1313158_+	heme exporter protein CcmB	NA	NA	NA	NA
WP_165216736.1\|1313201_1313960_+	heme ABC transporter permease	NA	NA	NA	NA
WP_165216738.1\|1313961_1314138_+	heme exporter protein CcmD	NA	NA	NA	NA
WP_165216740.1\|1314134_1314734_+	DsbE family thiol:disulfide interchange protein	NA	NA	NA	NA
WP_165216742.1\|1314801_1315083_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	3.1e-10	40.2
WP_165216744.1\|1315112_1315415_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_165216746.1\|1315421_1316009_-	DUF2585 domain-containing protein	NA	NA	NA	NA
WP_165216748.1\|1316005_1316653_-	septation protein A	NA	NA	NA	NA
WP_165216750.1\|1316709_1318305_-	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	6.1e-18	37.4

DBSCAN-SWA_114

1338243 : 1346228

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216790.1\|1338243_1338927_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.3e-22	29.5
WP_165216791.1\|1339011_1339467_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_165216793.1\|1339535_1340288_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_165216795.1\|1340380_1341181_-	exodeoxyribonuclease III	A0A0N9QXX6	Chrysochromulina_ericina_virus	2.0e-09	24.7
WP_165216797.1\|1341239_1341884_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
WP_165216798.1\|1341955_1344640_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	6.8e-78	43.9
WP_165216800.1\|1344875_1346228_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	4.4e-33	32.6

DBSCAN-SWA_115

1350024 : 1350999

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216808.1\|1350024_1350999_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	5.1e-15	41.1

DBSCAN-SWA_116

1366222 : 1368043

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216838.1\|1366222_1368043_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.1e-34	26.1

DBSCAN-SWA_117

1371469 : 1380103

Bacillus_virus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216853.1\|1371469_1372186_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.4e-22	35.8
WP_165221382.1\|1372423_1373947_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_165216855.1\|1373999_1374863_-	RNA polymerase factor sigma-32	I1ZBD5	Salisaeta_icosahedral_phage	2.3e-11	28.3
WP_165216857.1\|1375152_1375722_-	CarD family transcriptional regulator	NA	NA	NA	NA
WP_165216859.1\|1376091_1376430_-	ferredoxin family protein	NA	NA	NA	NA
WP_165216861.1\|1376664_1377006_-	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
WP_165221385.1\|1377007_1380103_-	helicase	A0A248SJQ0	Salicola_phage	2.7e-25	32.9

DBSCAN-SWA_118

1395923 : 1397690

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216894.1\|1395923_1397690_+	glucan ABC transporter ATP-binding protein/ permease	W8CYL7	Bacillus_phage	5.0e-37	28.3

DBSCAN-SWA_119

1441878 : 1442946

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216946.1\|1441878_1442946_-	molybdenum ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-18	30.8

DBSCAN-SWA_120

1448124 : 1449261

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216958.1\|1448124_1449261_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.4e-37	30.3

DBSCAN-SWA_121

1457394 : 1462198

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216973.1\|1457394_1458171_+	sugar ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.3e-08	29.1
WP_165216975.1\|1458426_1460289_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.1e-46	28.3
WP_165216977.1\|1460302_1462198_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.7e-44	26.2

DBSCAN-SWA_122

1469334 : 1470087

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216998.1\|1469334_1470087_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	A0A0M4JSW6	Mollivirus	1.8e-07	35.8

DBSCAN-SWA_123

1480103 : 1481675

Stx2-converting_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217008.1\|1480103_1481675_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	5.6e-72	35.7

DBSCAN-SWA_124

1489723 : 1490668

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217014.1\|1489723_1490668_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	5.0e-36	35.1

DBSCAN-SWA_125

1510995 : 1511916

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217042.1\|1510995_1511916_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.3e-22	27.3

DBSCAN-SWA_126

1517595 : 1521999

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217049.1\|1517595_1519311_+	catalase	A0A2K9L0T1	Tupanvirus	1.8e-92	44.4
WP_165217051.1\|1519644_1520859_-	arsenite efflux MFS transporter ArsK	NA	NA	NA	NA
WP_165221442.1\|1520855_1521566_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	4.4e-85	67.5
WP_165217053.1\|1521567_1521999_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.2e-46	65.0

DBSCAN-SWA_127

1525264 : 1529925

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217062.1\|1525264_1527778_-	response regulator	A0A1V0SGX0	Hokovirus	7.9e-20	30.0
WP_165217064.1\|1527774_1529925_-	EAL domain-containing protein	G3MA91	Bacillus_virus	2.3e-12	29.8

DBSCAN-SWA_128

1535567 : 1537184

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217075.1\|1535567_1537184_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.6e-67	45.9

DBSCAN-SWA_129

1548878 : 1551783

Molluscum_contagiosum_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217093.1\|1548878_1549811_+	SDR family oxidoreductase	Q76TT0	Molluscum_contagiosum_virus	2.0e-13	34.3
WP_165217095.1\|1549887_1551783_+	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	1.0e-19	25.6

DBSCAN-SWA_130

1560768 : 1564158

Saccharomonospora_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217109.1\|1560768_1564158_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	2.8e-76	27.4

DBSCAN-SWA_131

1568963 : 1570295

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217117.1\|1568963_1570295_-	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.4e-23	29.0

DBSCAN-SWA_132

1573519 : 1575962

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217126.1\|1573519_1574800_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.6e-85	47.4
WP_165217128.1\|1574789_1575962_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.5e-55	38.8

DBSCAN-SWA_133

1581830 : 1588980

Ralstonia_phage(25.0%)

integrase,transposase

attL 1579411:1579470|attR 1589222:1589380

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1579411:1579470	attL	NA	NA	NA	NA
WP_165217139.1\|1581830_1582823_+\|integrase	site-specific integrase	A0A1L7DQ84	Ralstonia_phage	9.0e-60	42.3
WP_165217141.1\|1583192_1584692_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.1e-13	26.9
WP_165217142.1\|1584691_1585426_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.0e-33	34.2
WP_165217144.1\|1586097_1588980_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	2.3e-31	26.3
1589222:1589380	attR	NA	NA	NA	NA

DBSCAN-SWA_134

1598285 : 1601319

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217163.1\|1598285_1599212_-	N-carbamoyl-D-amino-acid hydrolase	M1I5T1	Acanthocystis_turfacea_Chlorella_virus	2.2e-12	27.7
WP_165217165.1\|1599239_1599905_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_165217167.1\|1599907_1600585_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_165221475.1\|1600590_1601319_-	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-11	31.9

DBSCAN-SWA_135

1604969 : 1620383

Staphylococcus_phage(42.86%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217173.1\|1604969_1605551_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.9e-17	50.0
WP_165217175.1\|1605722_1607345_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.2e-62	31.3
WP_165217177.1\|1607431_1608076_+	hypothetical protein	NA	NA	NA	NA
WP_165217178.1\|1608137_1608584_+	thermonuclease family protein	NA	NA	NA	NA
WP_165217180.1\|1608631_1610593_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.7e-90	38.9
WP_165217182.1\|1610814_1611516_+	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_165217183.1\|1611589_1613521_-	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	5.4e-61	31.1
WP_165217185.1\|1613630_1614290_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_165217187.1\|1614452_1617086_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.2e-167	38.4
WP_165221478.1\|1617123_1617597_+	hypothetical protein	NA	NA	NA	NA
WP_165217189.1\|1617602_1618652_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_165217191.1\|1618688_1619570_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	1.6e-20	38.7
WP_165217193.1\|1619591_1620383_-	ParA family protein	Q8JL10	Natrialba_phage	1.4e-18	33.1

DBSCAN-SWA_136

1630609 : 1631305

Bradyrhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217207.1\|1630609_1631305_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	2.2e-60	53.0

DBSCAN-SWA_137

1634912 : 1637839

Pseudomonas_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217217.1\|1634912_1635278_+	helix-turn-helix transcriptional regulator	L7TKV7	Pseudomonas_virus	8.8e-05	33.0
WP_165217219.1\|1635406_1637839_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	2.8e-115	35.1

DBSCAN-SWA_138

1646168 : 1650116

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217235.1\|1646168_1646489_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.2e-19	49.5
WP_165221490.1\|1646561_1650116_-	double-strand break repair helicase AddA	G3MA40	Bacillus_virus	1.3e-07	21.6

DBSCAN-SWA_139

1655572 : 1659746

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217252.1\|1655572_1658149_-	PAS domain-containing protein	W8CYF6	Bacillus_phage	2.7e-23	27.9
WP_165217254.1\|1658345_1659746_-	adenosylhomocysteinase	S4W1G4	Pandoravirus	2.8e-43	32.2

DBSCAN-SWA_140

1663030 : 1667855

Bacillus_thuringiensis_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217264.1\|1663030_1663768_-	response regulator transcription factor	Q56AR1	Bacillus_thuringiensis_phage	3.5e-08	33.3
WP_165217266.1\|1664076_1665687_+	phosphoenolpyruvate carboxykinase	A0A2H4PQN1	Staphylococcus_phage	1.2e-149	52.2
WP_165217268.1\|1665770_1666205_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_165217270.1\|1666216_1666828_+	alpha-ketoglutarate-dependent dioxygenase AlkB	NA	NA	NA	NA
WP_165217272.1\|1666859_1667855_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	4.7e-32	33.8

DBSCAN-SWA_141

1672274 : 1676182

Erwinia_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217288.1\|1672274_1673582_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	2.2e-42	30.7
WP_165221493.1\|1673811_1674732_+	DUF1402 family protein	NA	NA	NA	NA
WP_165217290.1\|1674778_1676182_+	cytochrome P450	V5UQK0	Mycobacterium_phage	2.9e-27	27.5

DBSCAN-SWA_142

1681911 : 1685333

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221502.1\|1681911_1684371_-	ATP-dependent helicase HrpB	A0A2H4UU36	Bodo_saltans_virus	2.2e-30	27.2
WP_165217298.1\|1684379_1685333_-	ornithine cyclodeaminase family protein	A0A1V0SL93	Klosneuvirus	6.1e-13	30.0

DBSCAN-SWA_143

1706699 : 1708475

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217326.1\|1706699_1708475_-	N-acetylglutaminylglutamine amidotransferase	R4TIC1	Phaeocystis_globosa_virus	1.7e-32	24.7

DBSCAN-SWA_144

1715881 : 1716892

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221511.1\|1715881_1716892_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	5.8e-22	30.4

DBSCAN-SWA_145

1747382 : 1751517

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217387.1\|1747382_1747781_+	CopG family transcriptional regulator	A0A0U4ISP5	Pseudomonas_phage	2.1e-07	33.3
WP_165217389.1\|1747797_1748130_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_165217391.1\|1748260_1750711_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_165217392.1\|1750716_1751517_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.7e-27	34.6

DBSCAN-SWA_146

1757068 : 1764326

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217403.1\|1757068_1757815_-	response regulator	W8CYM9	Bacillus_phage	5.0e-31	32.7
WP_165217405.1\|1757941_1758694_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_165217407.1\|1758730_1760638_+	PAS domain S-box protein	A0A1V0SL97	Klosneuvirus	2.6e-15	33.8
WP_165221522.1\|1760650_1762411_-	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_165217409.1\|1762697_1764326_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	1.7e-47	32.5

DBSCAN-SWA_147

1768258 : 1768942

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217418.1\|1768258_1768942_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-11	26.5

DBSCAN-SWA_148

1771953 : 1772727

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217432.1\|1771953_1772727_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	8.1e-08	27.9

DBSCAN-SWA_149

1786748 : 1788695

Dishui_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217461.1\|1786748_1788695_-	asparagine synthase (glutamine-hydrolyzing)	A0A2K9R7N5	Dishui_lake_phycodnavirus	9.4e-29	32.4

DBSCAN-SWA_150

1797713 : 1803406

Niemeyer_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217475.1\|1797713_1798766_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	6.2e-35	31.2
WP_165217477.1\|1798866_1799427_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_165217479.1\|1799450_1799648_-	hypothetical protein	NA	NA	NA	NA
WP_165217481.1\|1799837_1800893_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_165217483.1\|1800889_1803406_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	1.3e-06	36.8

DBSCAN-SWA_151

1814661 : 1818764

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217513.1\|1814661_1817199_-	DNA ligase D	A0A068CDF3	Rhizobium_phage	3.4e-55	42.6
WP_165217514.1\|1817202_1818084_-	Ku protein	NA	NA	NA	NA
WP_165217516.1\|1818119_1818764_+	sigma-70 family RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	5.0e-11	33.8

DBSCAN-SWA_152

1829808 : 1830831

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217532.1\|1829808_1830831_+	sulfate/molybdate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-29	36.2

DBSCAN-SWA_153

1840518 : 1843084

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217545.1\|1840518_1841352_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-12	27.5
WP_165217547.1\|1841348_1842101_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-23	36.0
WP_165217549.1\|1842154_1843084_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.7e-08	31.5

DBSCAN-SWA_154

1851043 : 1851610

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217570.1\|1851043_1851610_-	RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	5.4e-09	28.8

DBSCAN-SWA_155

1861621 : 1876013

Planktothrix_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217586.1\|1861621_1863469_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-20	31.6
WP_165217588.1\|1863614_1864361_+	sulfate transporter family protein	NA	NA	NA	NA
WP_165217591.1\|1864313_1865102_-	endonuclease III	NA	NA	NA	NA
WP_165217593.1\|1865127_1865622_+	DUF2244 domain-containing protein	NA	NA	NA	NA
WP_165217595.1\|1865788_1866673_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	8.4e-17	36.1
WP_165217597.1\|1866719_1867019_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_165217599.1\|1867011_1867380_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165217601.1\|1867385_1868366_-	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_165217610.1\|1868533_1869493_+	transaldolase	A0A1D7SEQ4	Cyanophage	1.2e-13	34.8
WP_165217612.1\|1869549_1870392_-	metal ABC transporter permease	NA	NA	NA	NA
WP_165217614.1\|1870388_1871249_-	metal ABC transporter permease	NA	NA	NA	NA
WP_165221538.1\|1871229_1872132_-	manganese/iron ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-15	24.1
WP_165221541.1\|1872134_1873019_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165217616.1\|1874516_1876013_-\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	7.2e-77	36.0

DBSCAN-SWA_156

1879642 : 1880410

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217621.1\|1879642_1880410_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.3e-42	41.2

DBSCAN-SWA_157

1889527 : 1891066

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217637.1\|1889527_1891066_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.7e-15	26.8

DBSCAN-SWA_158

1896475 : 1904715

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217646.1\|1896475_1897849_+	beta-glucosidase	A0A0B5JD41	Pandoravirus	1.1e-66	36.9
WP_165217647.1\|1897944_1898694_+	EAL domain-containing protein	NA	NA	NA	NA
WP_165217649.1\|1898851_1899484_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_165221546.1\|1899834_1900875_+	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-25	32.9
WP_165217651.1\|1900864_1901533_+	ABC transporter permease	NA	NA	NA	NA
WP_165217652.1\|1901585_1902365_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165217654.1\|1902513_1904715_+	EAL domain-containing protein	G3MA91	Bacillus_virus	1.0e-18	36.0

DBSCAN-SWA_159

1909509 : 1910007

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217662.1\|1909509_1910007_-	CYTH domain-containing protein	E1A2M8	Aeromonas_phage	1.2e-07	32.5

DBSCAN-SWA_160

1915820 : 1916954

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217676.1\|1915820_1916954_+	type III PLP-dependent enzyme	A0A1V0SKK0	Klosneuvirus	2.9e-30	28.2

DBSCAN-SWA_161

1933734 : 1933965

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217703.1\|1933734_1933965_-	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	1.2e-07	49.2

DBSCAN-SWA_162

1939869 : 1941111

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217712.1\|1939869_1941111_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	4.6e-53	36.1

DBSCAN-SWA_163

1950475 : 1952938

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217723.1\|1950475_1952938_-	glycogen/starch/alpha-glucan phosphorylase	A0A140XAG6	Dickeya_phage	1.1e-10	44.8

DBSCAN-SWA_164

1962216 : 1966204

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217731.1\|1962216_1963251_+	glutamine synthetase	A0A1V0SG77	Hokovirus	6.9e-71	43.0
WP_165217733.1\|1963361_1965164_-	chloride channel protein	NA	NA	NA	NA
WP_165217735.1\|1965455_1965776_+	hypothetical protein	NA	NA	NA	NA
WP_165217737.1\|1965826_1966204_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	5.7e-15	49.3

DBSCAN-SWA_165

1970453 : 1970936

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217750.1\|1970453_1970936_+	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	2.5e-23	41.5

DBSCAN-SWA_166

1984716 : 1985598

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217764.1\|1984716_1985598_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	8.5e-62	45.4

DBSCAN-SWA_167

1993232 : 1993940

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217781.1\|1993232_1993940_+	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	9.9e-53	50.4

DBSCAN-SWA_168

1997087 : 2006190

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217796.1\|1997087_1999055_-	LysM peptidoglycan-binding domain-containing protein	S4W5J5	Pandoravirus	1.5e-21	24.7
WP_165217797.1\|1999271_1999637_-	hypothetical protein	NA	NA	NA	NA
WP_165217799.1\|1999773_2001219_-	homospermidine synthase	B2ZXX8	Ralstonia_phage	8.1e-102	41.0
WP_165217801.1\|2001328_2002267_-	DUF3445 domain-containing protein	NA	NA	NA	NA
WP_165217802.1\|2002279_2002975_-	hypothetical protein	NA	NA	NA	NA
WP_165221575.1\|2002884_2004087_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.2e-42	41.9
WP_165217809.1\|2004171_2006190_-	diguanylate cyclase	G3MA91	Bacillus_virus	2.2e-12	31.4

DBSCAN-SWA_169

2012058 : 2012319

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217814.1\|2012058_2012319_-	DUF2312 domain-containing protein	A0A2L0V115	Agrobacterium_phage	3.1e-28	80.0

DBSCAN-SWA_170

2016581 : 2020139

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217821.1\|2016581_2017592_-	alpha/beta hydrolase	A0A2D1G8C7	Mycobacterium_phage	1.2e-06	32.4
WP_165217822.1\|2017611_2018220_-	hypothetical protein	NA	NA	NA	NA
WP_165217824.1\|2018310_2018436_-	50S ribosomal protein L36	NA	NA	NA	NA
WP_165217825.1\|2018583_2019642_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_165217827.1\|2019638_2020139_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.7e-19	41.3

DBSCAN-SWA_171

2029105 : 2030974

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221587.1\|2029105_2030974_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.3e-56	30.8

DBSCAN-SWA_172

2047408 : 2048308

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217869.1\|2047408_2048308_+	fructose bisphosphate aldolase	A0A0K0KVJ8	Prochlorococcus_phage	1.4e-06	28.3

DBSCAN-SWA_173

2060346 : 2063075

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217904.1\|2060346_2061387_+	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	5.4e-07	32.5
WP_165217905.1\|2061387_2062284_+	metallophosphoesterase	NA	NA	NA	NA
WP_165217906.1\|2062285_2062801_+	NUDIX hydrolase	NA	NA	NA	NA
WP_165217908.1\|2062856_2063075_+	HVA1 family protein	A0A1L2BWQ1	Bacteriophage	1.2e-09	53.2

DBSCAN-SWA_174

2072656 : 2076058

Paramecium_bursaria_Chlorella_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217935.1\|2072656_2074078_+\|tRNA	tRNA lysidine(34) synthetase TilS	A7J7A8	Paramecium_bursaria_Chlorella_virus	1.3e-06	25.3
WP_165217937.1\|2074120_2076058_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	4.1e-117	41.9

DBSCAN-SWA_175

2081017 : 2084267

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217947.1\|2081017_2082613_+	phosphoglycerate dehydrogenase	A0A2R8FCS0	Cedratvirus	9.1e-46	37.4
WP_165217949.1\|2082821_2083841_+	Tim44 domain-containing protein	NA	NA	NA	NA
WP_165217951.1\|2083844_2084267_-	DUF1810 domain-containing protein	A0A2H4UVK5	Bodo_saltans_virus	6.0e-13	39.6

DBSCAN-SWA_176

2089287 : 2090118

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217963.1\|2089287_2090118_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.1e-10	31.3

DBSCAN-SWA_177

2094994 : 2096080

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217973.1\|2094994_2096080_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	9.0e-21	31.2

DBSCAN-SWA_178

2101317 : 2102130

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221599.1\|2101317_2102130_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	7.4e-60	47.4

DBSCAN-SWA_179

2111618 : 2114733

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218005.1\|2111618_2112416_+	heme ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-15	34.4
WP_165218006.1\|2112422_2112788_-	DUF454 domain-containing protein	NA	NA	NA	NA
WP_165218008.1\|2113011_2114001_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.3e-53	36.6
WP_165221605.1\|2114028_2114733_+	uracil-DNA glycosylase	S4VYQ4	Pandoravirus	2.4e-51	46.5

DBSCAN-SWA_180

2122728 : 2123550

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218027.1\|2122728_2123550_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-32	38.0

DBSCAN-SWA_181

2128366 : 2133432

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218037.1\|2128366_2129665_+	adenylosuccinate synthase	A0A291AUF9	Pandoravirus	1.9e-57	32.5
WP_165218039.1\|2129725_2132374_+	hypothetical protein	NA	NA	NA	NA
WP_165218041.1\|2132523_2133432_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.2e-35	32.2

DBSCAN-SWA_182

2139776 : 2143780

Roseobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218059.1\|2139776_2140478_-	response regulator transcription factor	F4YXP8	Roseobacter_phage	3.0e-17	48.6
WP_165218061.1\|2140916_2141267_+	flagellar export protein FliJ	NA	NA	NA	NA
WP_165218063.1\|2141356_2141638_-	N-acetyltransferase	NA	NA	NA	NA
WP_165218065.1\|2141729_2142194_+	paraquat-inducible protein A	NA	NA	NA	NA
WP_165218067.1\|2142298_2142574_-	DUF1153 domain-containing protein	NA	NA	NA	NA
WP_165218069.1\|2142748_2143780_-	DUF2793 domain-containing protein	A0A0K1Y6G9	Rhodobacter_phage	2.3e-26	36.4

DBSCAN-SWA_183

2149741 : 2150023

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218081.1\|2149741_2150023_+	type II toxin-antitoxin system ParD family antitoxin	A0A0N7C055	Escherichia_phage	1.6e-09	40.5

DBSCAN-SWA_184

2156190 : 2166044

Staphylococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218092.1\|2156190_2156937_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.9e-12	25.8
WP_165218094.1\|2156961_2157315_+	hypothetical protein	NA	NA	NA	NA
WP_165218096.1\|2157455_2158571_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165218098.1\|2158763_2159294_-	chemotaxis protein CheD	NA	NA	NA	NA
WP_165218100.1\|2159552_2160479_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.5e-12	34.1
WP_165218102.1\|2160471_2163858_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	4.5e-34	26.9
WP_165218104.1\|2164139_2164892_+	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	A0A167R0X0	Powai_lake_megavirus	7.4e-22	32.4
WP_165218106.1\|2164949_2166044_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	4.6e-65	37.7

DBSCAN-SWA_185

2172373 : 2174050

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218116.1\|2172373_2173132_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	4.1e-12	26.0
WP_165218118.1\|2173354_2174050_+	urea ABC transporter ATP-binding subunit UrtE	G9BWD6	Planktothrix_phage	9.5e-16	26.8

DBSCAN-SWA_186

2179864 : 2180404

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218142.1\|2179864_2180404_+	peroxiredoxin	A0A1D8KSL1	Synechococcus_phage	1.4e-51	57.9

DBSCAN-SWA_187

2192068 : 2192857

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218159.1\|2192068_2192857_-	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	8.0e-11	24.2

DBSCAN-SWA_188

2208625 : 2210930

Cafeteria_roenbergensis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218205.1\|2208625_2210173_+	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	3.6e-55	27.7
WP_165221623.1\|2210237_2210930_+	SDR family NAD(P)-dependent oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	2.5e-24	37.7

DBSCAN-SWA_189

2223347 : 2229576

Diachasmimorpha_longicaudata_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218231.1\|2223347_2224934_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.3e-55	34.1
WP_165218233.1\|2225237_2225576_-	hypothetical protein	NA	NA	NA	NA
WP_165218235.1\|2225681_2225894_-	hypothetical protein	NA	NA	NA	NA
WP_165218237.1\|2225934_2229576_+	response regulator	A0A1V0SGX0	Hokovirus	8.7e-68	32.4

DBSCAN-SWA_190

2238299 : 2238620

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218260.1\|2238299_2238620_-	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	1.1e-11	38.4

DBSCAN-SWA_191

2244348 : 2249286

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218276.1\|2244348_2245143_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.4e-26	34.8
WP_165218278.1\|2245237_2247574_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	1.5e-214	52.1
WP_165218280.1\|2247813_2249286_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	7.0e-101	43.8

DBSCAN-SWA_192

2269237 : 2271031

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218322.1\|2269237_2271031_+	M23 family metallopeptidase	A0A1C9M0Q3	Mycobacterium_phage	1.6e-14	40.5

DBSCAN-SWA_193

2276644 : 2277694

Bacillus_virus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218334.1\|2276644_2277694_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.7e-19	32.5

DBSCAN-SWA_194

2288456 : 2292457

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218352.1\|2288456_2289632_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.7e-20	36.1
WP_165218354.1\|2289628_2290495_-	extensin	NA	NA	NA	NA
WP_165218356.1\|2290630_2292457_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-11	35.5

DBSCAN-SWA_195

2297119 : 2302518

Pneumococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218364.1\|2297119_2297584_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	1.2e-27	55.2
WP_165218366.1\|2297654_2298449_-	DUF2076 domain-containing protein	NA	NA	NA	NA
WP_165218368.1\|2298591_2299182_-	HupE/UreJ family protein	NA	NA	NA	NA
WP_165218370.1\|2299406_2299994_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	4.4e-30	37.9
WP_165218372.1\|2300111_2301074_+	acetylxylan esterase	NA	NA	NA	NA
WP_165218374.1\|2301070_2301799_+	esterase family protein	NA	NA	NA	NA
WP_165218376.1\|2301807_2302518_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.4e-67	56.5

DBSCAN-SWA_196

2311932 : 2312884

Tetraselmis_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165216547.1\|2311932_2312884_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	3.5e-13	28.4

DBSCAN-SWA_197

2338455 : 2339718

Roseobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218436.1\|2338455_2339718_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A1B0V011	Roseobacter_phage	6.1e-53	34.1

DBSCAN-SWA_198

2345328 : 2350368

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218448.1\|2345328_2347185_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.4e-35	31.3
WP_165218454.1\|2347300_2348407_+	diguanylate cyclase	NA	NA	NA	NA
WP_165218455.1\|2348505_2350368_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.5e-33	29.1

DBSCAN-SWA_199

2354432 : 2354975

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218464.1\|2354432_2354975_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	4.8e-31	43.8

DBSCAN-SWA_200

2360290 : 2360599

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218476.1\|2360290_2360599_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	8.5e-09	39.5

DBSCAN-SWA_201

2366257 : 2371733

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218484.1\|2366257_2368348_+	EAL domain-containing protein	G3MA91	Bacillus_virus	2.8e-18	34.1
WP_165218485.1\|2368446_2370702_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_165218487.1\|2370800_2371733_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	2.4e-46	36.8

DBSCAN-SWA_202

2378218 : 2383603

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218498.1\|2378218_2379037_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.1e-23	33.6
WP_165218500.1\|2379055_2379394_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_165218502.1\|2379397_2380840_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_165218504.1\|2380880_2381585_-	response regulator	W8CYM9	Bacillus_phage	2.9e-36	36.0
WP_165221652.1\|2381586_2382054_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_165218505.1\|2382338_2382530_+	hypothetical protein	NA	NA	NA	NA
WP_165218507.1\|2382598_2383246_+	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	3.3e-18	29.9
WP_003494703.1\|2383387_2383603_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.6e-09	50.0

DBSCAN-SWA_203

2396813 : 2397788

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218522.1\|2396813_2397788_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	7.0e-65	43.9

DBSCAN-SWA_204

2407339 : 2407660

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218538.1\|2407339_2407660_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	7.4e-16	54.1

DBSCAN-SWA_205

2413087 : 2414005

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218553.1\|2413087_2414005_+	zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	1.9e-35	40.0

DBSCAN-SWA_206

2419802 : 2427037

Halovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218572.1\|2419802_2421008_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	4.3e-40	32.7
WP_165218575.1\|2421328_2421781_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.0e-18	38.8
WP_165218577.1\|2421842_2422184_-	hypothetical protein	NA	NA	NA	NA
WP_165218579.1\|2422573_2424592_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	5.1e-94	43.5
WP_165218581.1\|2424985_2427037_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-36	33.9

DBSCAN-SWA_207

2432710 : 2433757

Emiliania_huxleyi_virus(100.0%)

integrase

attL 2431212:2431225|attR 2437894:2437907

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2431212:2431225	attL	NA	NA	NA	NA
WP_165221673.1\|2432710_2433757_-\|integrase	tyrosine-type recombinase/integrase	G8DH71	Emiliania_huxleyi_virus	7.8e-30	30.4
WP_165221673.1\|2432710_2433757_-\|integrase	tyrosine-type recombinase/integrase	G8DH71	Emiliania_huxleyi_virus	7.8e-30	30.4
2437894:2437907	attR	NA	NA	NA	NA

DBSCAN-SWA_208

2437328 : 2440563

Escherichia_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165217141.1\|2437328_2438828_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.1e-13	26.9
WP_165217142.1\|2438827_2439562_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	9.0e-33	34.2
WP_165218601.1\|2440050_2440563_-	DNA adenine methylase	R9U1F2	Rhizobium_phage	8.7e-59	73.0

DBSCAN-SWA_209

2450392 : 2457959

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218621.1\|2450392_2454166_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.6e-16	57.1
WP_165218623.1\|2454178_2454577_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_165218625.1\|2454573_2454807_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_165218627.1\|2454887_2455757_-	hypothetical protein	NA	NA	NA	NA
WP_165218629.1\|2455763_2456807_-	zinc-dependent alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_165218631.1\|2456897_2457959_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.1e-30	34.8

DBSCAN-SWA_210

2471159 : 2471879

Aurantimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218657.1\|2471159_2471879_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	1.6e-29	39.0

DBSCAN-SWA_211

2480132 : 2490189

Raccoon_poxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218669.1\|2480132_2481089_-	alpha/beta hydrolase	A0A0G3G493	Raccoon_poxvirus	1.7e-15	30.6
WP_165218671.1\|2481181_2482831_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	2.8e-50	28.6
WP_165218673.1\|2483091_2485353_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
WP_165221685.1\|2485579_2486611_+	metalloregulator ArsR/SmtB family transcription factor	S4VUD3	Pandoravirus	3.0e-05	31.1
WP_165218675.1\|2486607_2487507_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_165218677.1\|2488065_2489268_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_165218679.1\|2489382_2490189_-	glycoside hydrolase family 25 protein	D0R7H8	Paenibacillus_phage	4.8e-19	31.8

DBSCAN-SWA_212

2497971 : 2498745

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218691.1\|2497971_2498745_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	1.9e-12	41.7

DBSCAN-SWA_213

2524793 : 2529005

Sphingobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218731.1\|2524793_2526953_+	NAD-dependent DNA ligase LigA	A0A1W6DX16	Sphingobium_phage	3.0e-116	38.5
WP_165218733.1\|2527281_2527812_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_165218735.1\|2528121_2528367_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_165218737.1\|2528414_2529005_+	3'-5' exonuclease	A0A1S5SFA9	Streptococcus_phage	4.4e-22	38.1

DBSCAN-SWA_214

2534803 : 2536633

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218749.1\|2534803_2536633_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	9.7e-84	35.6

DBSCAN-SWA_215

2542609 : 2545108

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218763.1\|2542609_2545108_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	8.5e-115	37.2

DBSCAN-SWA_216

2558286 : 2563575

Microbacterium_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218785.1\|2558286_2559081_+	thymidylate synthase	A0A2R4A1R4	Microbacterium_phage	1.2e-107	69.0
WP_165218787.1\|2559077_2559614_+	dihydrofolate reductase	J7KJR5	Erwinia_phage	6.6e-25	39.4
WP_165218789.1\|2559759_2560890_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_165218791.1\|2560886_2561858_+\|protease	protease modulator HflC	NA	NA	NA	NA
WP_165218793.1\|2562024_2563575_+	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.1e-24	31.2

DBSCAN-SWA_217

2568496 : 2572537

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221706.1\|2568496_2570254_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	1.0e-37	26.3
WP_165218799.1\|2570312_2570633_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_165218801.1\|2570613_2571015_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_165218811.1\|2571045_2571618_+	acetolactate synthase small subunit	NA	NA	NA	NA
WP_165218813.1\|2571691_2572537_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	7.0e-29	33.0

DBSCAN-SWA_218

2579893 : 2581018

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218837.1\|2579893_2581018_+	AAA family ATPase	A0A291LA07	Bordetella_phage	3.8e-107	55.2

DBSCAN-SWA_219

2593902 : 2594934

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218861.1\|2593902_2594934_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-24	30.5

DBSCAN-SWA_220

2600578 : 2600725

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218876.1\|2600578_2600725_-	DUF1127 domain-containing protein	A0A0F6YPC3	Sinorhizobium_phage	3.5e-05	54.8

DBSCAN-SWA_221

2623988 : 2626247

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218900.1\|2623988_2624846_+	response regulator	W8CYM9	Bacillus_phage	4.9e-06	27.4
WP_165218902.1\|2624864_2626247_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-17	34.9

DBSCAN-SWA_222

2630928 : 2631999

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218917.1\|2630928_2631999_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-28	36.1

DBSCAN-SWA_223

2644065 : 2645496

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218953.1\|2644065_2645496_+	NADP-dependent phosphogluconate dehydrogenase	M4QGJ9	Cyanophage	1.1e-26	28.1

DBSCAN-SWA_224

2649732 : 2650695

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218964.1\|2649732_2650695_+	metal ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	1.3e-07	28.0

DBSCAN-SWA_225

2661777 : 2663424

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218984.1\|2661777_2663424_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	33.6

DBSCAN-SWA_226

2672430 : 2673998

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165218996.1\|2672430_2673174_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.2e-20	31.6
WP_165218998.1\|2673170_2673998_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.6e-12	28.0

DBSCAN-SWA_227

2679706 : 2680474

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219010.1\|2679706_2680474_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.8e-31	36.8

DBSCAN-SWA_228

2683840 : 2694042

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219018.1\|2683840_2684602_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-16	28.9
WP_165221733.1\|2684598_2685591_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.1e-08	22.4
WP_165219020.1\|2685653_2686676_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165219022.1\|2686946_2687561_-	chloramphenicol acetyltransferase	M1HJ62	Paramecium_bursaria_Chlorella_virus	7.1e-07	38.5
WP_165219024.1\|2687557_2688421_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_165219034.1\|2688423_2689350_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_165219036.1\|2689410_2690313_-	phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_165219038.1\|2690337_2691144_-	phosphonate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	37.5
WP_165219040.1\|2691343_2692513_-	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_165219042.1\|2692499_2693207_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	5.3e-06	29.1
WP_165219044.1\|2693214_2694042_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-07	22.9

DBSCAN-SWA_229

2698920 : 2700648

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219054.1\|2698920_2700648_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-16	29.7

DBSCAN-SWA_230

2716981 : 2718658

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221745.1\|2716981_2718658_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-16	31.4

DBSCAN-SWA_231

2737286 : 2738237

Tetraselmis_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221754.1\|2737286_2738237_+\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	6.0e-13	28.0

DBSCAN-SWA_232

2744910 : 2746878

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219120.1\|2744910_2746878_-	EAL domain-containing protein	G3MA91	Bacillus_virus	3.9e-14	31.5

DBSCAN-SWA_233

2759378 : 2760302

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219144.1\|2759378_2760302_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	8.8e-17	31.0

DBSCAN-SWA_234

2766571 : 2768107

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221765.1\|2766571_2768107_-	HAMP domain-containing histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.4e-19	31.0

DBSCAN-SWA_235

2791179 : 2792250

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219200.1\|2791179_2792250_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.0e-14	32.7

DBSCAN-SWA_236

2804447 : 2806121

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219216.1\|2804447_2806121_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.5e-103	38.4

DBSCAN-SWA_237

2811012 : 2811960

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219249.1\|2811012_2811960_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	8.0e-58	41.8

DBSCAN-SWA_238

2817941 : 2818778

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219267.1\|2817941_2818778_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.2e-11	28.6

DBSCAN-SWA_239

2830667 : 2831462

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221779.1\|2830667_2831462_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.0e-26	32.6

DBSCAN-SWA_240

2838566 : 2846310

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219303.1\|2838566_2841179_+	response regulator	W8CYM9	Bacillus_phage	8.0e-07	33.9
WP_165219305.1\|2841408_2842497_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.7e-115	62.9
WP_165219307.1\|2842661_2845322_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.8e-70	34.1
WP_165221785.1\|2845464_2846310_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	6.0e-73	54.4

DBSCAN-SWA_241

2849352 : 2862291

Microbacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219315.1\|2849352_2851560_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-156	41.3
WP_165221791.1\|2851674_2852235_-	acyloxyacyl hydrolase	NA	NA	NA	NA
WP_165219317.1\|2852446_2852842_-	hypothetical protein	NA	NA	NA	NA
WP_165219319.1\|2852876_2853548_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_165219321.1\|2853544_2853802_-	hypothetical protein	NA	NA	NA	NA
WP_165219333.1\|2853819_2854062_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_165221794.1\|2854079_2854844_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.1e-44	43.5
WP_165219341.1\|2855078_2855393_+	DUF1476 family protein	NA	NA	NA	NA
WP_165219343.1\|2855469_2855784_+	DUF1476 domain-containing protein	NA	NA	NA	NA
WP_165221797.1\|2855864_2858393_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	9.1e-16	35.7
WP_165219345.1\|2858539_2859094_-	serine hydrolase family protein	NA	NA	NA	NA
WP_165219347.1\|2859262_2860918_+	tannase/feruloyl esterase family alpha/beta hydrolase	NA	NA	NA	NA
WP_165219349.1\|2860989_2862291_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.7e-18	32.2

DBSCAN-SWA_242

2871049 : 2874035

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219373.1\|2871049_2872558_-	DEAD/DEAH box helicase	A0A2H4UVC7	Bodo_saltans_virus	5.1e-38	32.3
WP_165219375.1\|2872736_2874035_-	M23 family metallopeptidase	A0A1D6X855	Bacillus_phage	1.2e-22	49.6

DBSCAN-SWA_243

2879029 : 2893774

Cronobacter_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219382.1\|2879029_2880286_-\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	6.2e-66	38.3
WP_165219384.1\|2880504_2881677_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-18	33.5
WP_165219386.1\|2881741_2882419_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_165219388.1\|2882629_2883796_+	cysteine desulfurase	H7BUW1	unidentified_phage	5.9e-26	35.8
WP_165219390.1\|2883937_2885407_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_165219392.1\|2885406_2885787_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_165219394.1\|2885783_2886188_+	HEPN domain-containing protein	NA	NA	NA	NA
WP_165219396.1\|2886266_2887022_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	9.7e-06	24.3
WP_165219398.1\|2887048_2888323_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_165219400.1\|2888410_2889631_+	cysteine desulfurase	Q2XUY6	environmental_halophage	8.1e-95	40.8
WP_165219402.1\|2889641_2890022_+	SUF system Fe-S cluster assembly protein	NA	NA	NA	NA
WP_165219404.1\|2890070_2890349_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_165219406.1\|2890345_2890633_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165219408.1\|2890726_2891119_+	Fe-S cluster assembly scaffold SufA	A0A0P0CQC4	Ostreococcus_lucimarinus_virus	6.5e-14	37.8
WP_165219410.1\|2891150_2891792_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_165219412.1\|2891865_2893068_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_165219414.1\|2893057_2893774_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-34	38.1

DBSCAN-SWA_244

2901046 : 2902633

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219428.1\|2901046_2902633_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-20	28.4

DBSCAN-SWA_245

2905878 : 2909175

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219434.1\|2905878_2907240_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0G2Y8M0	Acanthamoeba_polyphaga_mimivirus	2.8e-19	28.6
WP_165219436.1\|2907348_2909175_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.6e-107	39.8

DBSCAN-SWA_246

2929898 : 2943590

uncultured_Mediterranean_phage(71.43%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219491.1\|2929898_2932820_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	61.8
WP_165219493.1\|2933103_2933655_+	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	5.7e-48	55.7
WP_165219495.1\|2933741_2934926_-	HPP family protein	NA	NA	NA	NA
WP_165219497.1\|2935022_2935652_-	MarC family protein	NA	NA	NA	NA
WP_165219499.1\|2935872_2938692_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.5e-99	33.7
WP_165219501.1\|2939009_2939165_-	hypothetical protein	NA	NA	NA	NA
WP_165219503.1\|2939599_2940094_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.0e-24	35.9
WP_165219505.1\|2940124_2940691_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-46	54.1
WP_165219507.1\|2940724_2941240_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.5e-46	60.0
WP_165219509.1\|2941383_2942469_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_165219511.1\|2942465_2943590_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-102	53.3

DBSCAN-SWA_247

2956335 : 2972700

Pseudomonas_phage(22.22%)

integrase,tRNA

attL 2961439:2961456|attR 2976193:2976210

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219545.1\|2956335_2957766_+	tape measure protein	A0A2H4GY41	Pseudomonas_phage	7.4e-23	35.3
WP_165219547.1\|2957762_2958446_+	hypothetical protein	NA	NA	NA	NA
WP_165219549.1\|2958529_2958742_+	hypothetical protein	NA	NA	NA	NA
WP_165221818.1\|2959257_2961102_+	hypothetical protein	B4UTR2	Rhizobium_phage	1.1e-21	43.3
WP_165219551.1\|2961157_2961619_-	translation initiation factor 2	NA	NA	NA	NA
2961439:2961456	attL	NA	NA	NA	NA
WP_165219553.1\|2961697_2961946_-	hypothetical protein	A0A141GEZ4	Brucella_phage	1.4e-17	51.4
WP_165219555.1\|2961938_2962220_-	hypothetical protein	NA	NA	NA	NA
WP_165219557.1\|2962216_2962477_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_165219559.1\|2962634_2962877_-	hypothetical protein	NA	NA	NA	NA
WP_165219561.1\|2962873_2963092_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165219563.1\|2963213_2963423_+	hypothetical protein	NA	NA	NA	NA
WP_165219565.1\|2963682_2964921_-\|integrase	integrase arm-type DNA-binding domain-containing protein	Q8W6M6	Sinorhizobium_phage	9.9e-141	61.1
WP_165219567.1\|2965422_2966478_+	restriction endonuclease	A0A1S5SAB0	Streptococcus_phage	1.5e-60	39.4
WP_165219569.1\|2966776_2967937_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	7.6e-18	52.3
WP_165219571.1\|2968002_2969175_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_165221821.1\|2969310_2969994_+	dTMP kinase	M1PSC7	Streptococcus_phage	2.9e-33	39.5
WP_165219573.1\|2969990_2971019_+	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	1.9e-12	29.0
WP_165219575.1\|2971140_2972700_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.6e-103	39.1
2976193:2976210	attR	NA	NA	NA	NA

DBSCAN-SWA_248

2976094 : 2977327

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219581.1\|2976094_2977327_+	glycine betaine/L-proline ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	7.1e-30	37.5

DBSCAN-SWA_249

2991137 : 3003268

Acinetobacter_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219607.1\|2991137_2992154_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	5.4e-60	43.6
WP_165219609.1\|2992161_2992977_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	9.0e-58	51.1
WP_165221830.1\|2992976_2993486_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_165219611.1\|2993497_2994727_+	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_165219613.1\|2994785_2996240_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.4e-56	30.6
WP_165219615.1\|2996307_2996880_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_165219617.1\|2996918_2998547_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.8e-151	51.5
WP_165219619.1\|2998683_2999082_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_165219621.1\|2999199_2999970_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_165219623.1\|3000118_3001003_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_165219625.1\|3001213_3003268_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	7.0e-107	39.2

DBSCAN-SWA_250

3010242 : 3014610

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221836.1\|3010242_3012270_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	2.4e-112	35.6
WP_165219641.1\|3012399_3012825_-	DUF2267 domain-containing protein	NA	NA	NA	NA
WP_165219643.1\|3012828_3013221_-	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
WP_165219645.1\|3013227_3013671_-	iron-sulfur cluster assembly scaffold protein	NA	NA	NA	NA
WP_165219647.1\|3014001_3014610_+	GTP cyclohydrolase I FolE	E7DN69	Pneumococcus_phage	5.5e-44	49.2

DBSCAN-SWA_251

3019846 : 3020455

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219661.1\|3019846_3020455_+	transglutaminase-like cysteine peptidase	V9QJI1	Rhizobium_phage	1.1e-15	32.9

DBSCAN-SWA_252

3033846 : 3034641

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219685.1\|3033846_3034641_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	3.6e-11	27.6

DBSCAN-SWA_253

3041889 : 3044339

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219699.1\|3041889_3043017_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.1e-34	28.5
WP_165219701.1\|3043109_3044339_+	class I SAM-dependent methyltransferase	A0A0F7L6Q1	uncultured_marine_virus	1.5e-11	31.5

DBSCAN-SWA_254

3051874 : 3052252

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219719.1\|3051874_3052252_-	fluoride efflux transporter CrcB	A0A2H4PQR0	Staphylococcus_phage	4.7e-09	33.9

DBSCAN-SWA_255

3056303 : 3059168

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219731.1\|3056303_3059168_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	4.3e-264	51.4

DBSCAN-SWA_256

3076019 : 3080023

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219760.1\|3076019_3077144_-	nitrogen regulation protein NR(II)	W8CYF6	Bacillus_phage	1.8e-08	25.5
WP_165219762.1\|3077140_3078160_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_165219764.1\|3078329_3079526_+	bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_165219766.1\|3079522_3080023_+	CinA family protein	B5TK85	Pseudomonas_phage	4.9e-22	51.1

DBSCAN-SWA_257

3089789 : 3095269

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219790.1\|3089789_3091064_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.9e-143	62.9
WP_165219792.1\|3091373_3093209_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_165219794.1\|3093265_3094114_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	9.4e-50	42.2
WP_165219796.1\|3094552_3095269_+	transcriptional repressor LexA	A0A1B2APZ3	Phage_Wrath	1.2e-08	37.4

DBSCAN-SWA_258

3108444 : 3109188

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219816.1\|3108444_3109188_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	4.0e-20	40.5

DBSCAN-SWA_259

3114712 : 3115450

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219832.1\|3114712_3115450_+	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	2.7e-13	27.9

DBSCAN-SWA_260

3119609 : 3122498

Agrobacterium_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219844.1\|3119609_3122135_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.8e-174	42.3
WP_165221861.1\|3122144_3122498_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	3.2e-12	41.5

DBSCAN-SWA_261

3128473 : 3132771

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219858.1\|3128473_3129496_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	5.2e-79	43.4
WP_165219860.1\|3129615_3130818_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_165219862.1\|3130819_3131974_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_165221866.1\|3132021_3132771_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-32	39.7

DBSCAN-SWA_262

3136715 : 3141310

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219886.1\|3136715_3137294_-	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	2.5e-06	36.9
WP_165219888.1\|3137508_3137949_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_165219890.1\|3138076_3138685_+	hypothetical protein	NA	NA	NA	NA
WP_165219892.1\|3139507_3141310_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	5.6e-52	30.0

DBSCAN-SWA_263

3149417 : 3153065

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219909.1\|3149417_3150917_+	Si-specific NAD(P)(+) transhydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-35	24.5
WP_165219920.1\|3151023_3151641_-	30S ribosomal protein S4	NA	NA	NA	NA
WP_165219922.1\|3152072_3153065_+	TerC family protein	K7QKE8	Escherichia_phage	4.1e-44	36.4

DBSCAN-SWA_264

3167252 : 3180535

uncultured_Mediterranean_phage(70.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219952.1\|3167252_3169814_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	4.1e-64	48.7
WP_165219954.1\|3169871_3170222_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_165219956.1\|3170419_3171295_+	ATP-binding protein	NA	NA	NA	NA
WP_165219958.1\|3171412_3172999_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	4.5e-13	31.7
WP_165219960.1\|3173132_3173786_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC50	Streptomyces_phage	3.3e-10	36.4
WP_165219962.1\|3173782_3174550_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.2e-22	30.2
WP_165219964.1\|3174556_3175840_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.3e-98	45.8
WP_165219966.1\|3175934_3176765_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.0e-48	44.0
WP_165219968.1\|3176761_3177517_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_165219970.1\|3177566_3177764_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	2.7e-08	69.8
WP_165219972.1\|3177806_3178910_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.3e-08	31.2
WP_165219974.1\|3178994_3179714_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-38	46.4
WP_165221874.1\|3179710_3180535_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.6e-33	33.9

DBSCAN-SWA_265

3187992 : 3188325

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165219984.1\|3187992_3188325_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	6.1e-21	47.2

DBSCAN-SWA_266

3192207 : 3195123

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220002.1\|3192207_3195123_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	8.1e-133	36.7

DBSCAN-SWA_267

3218375 : 3221519

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220056.1\|3218375_3221519_-	ammonium transporter	A0A127AWB9	Bacillus_phage	5.8e-12	32.7

DBSCAN-SWA_268

3229525 : 3238893

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220076.1\|3229525_3231379_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.9e-35	27.5
WP_165220078.1\|3231498_3233406_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_165220080.1\|3234073_3237889_+	vitamin B12-dependent ribonucleotide reductase	A0A1X9SGV9	Bradyrhizobium_phage	0.0e+00	54.2
WP_165220082.1\|3238032_3238893_+	hypothetical protein	A0A1I9LJQ0	Stx_converting_phage	3.2e-29	29.7

DBSCAN-SWA_269

3243057 : 3245771

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220093.1\|3243057_3244374_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	2.9e-74	38.6
WP_165220095.1\|3244370_3245771_-\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	1.5e-15	26.0

DBSCAN-SWA_270

3254338 : 3254929

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220111.1\|3254338_3254929_-	adenylate kinase	A0A2K9L833	Tupanvirus	1.7e-10	33.1

DBSCAN-SWA_271

3266495 : 3286117

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220168.1\|3266495_3267671_-	elongation factor Tu	A0A2K9L516	Tupanvirus	4.8e-12	24.9
WP_165220170.1\|3267746_3269846_-	elongation factor G	E4ZFJ7	Streptococcus_phage	7.0e-62	27.5
WP_165220177.1\|3269879_3270350_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003507760.1\|3270426_3270798_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_165220178.1\|3271446_3271740_+	transcriptional regulator	NA	NA	NA	NA
WP_165220179.1\|3271944_3276159_-	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	1.4e-69	27.4
WP_165220181.1\|3276346_3280483_-	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	3.5e-25	30.2
WP_165220182.1\|3280740_3281118_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
WP_143128065.1\|3281178_3281697_-	50S ribosomal protein L10	NA	NA	NA	NA
WP_165220184.1\|3282053_3282749_-	50S ribosomal protein L1	NA	NA	NA	NA
WP_062553865.1\|3282751_3283183_-	50S ribosomal protein L11	NA	NA	NA	NA
WP_165220186.1\|3283331_3283862_-	transcription termination/antitermination protein NusG	A0A068C9G5	Rhizobium_phage	8.3e-12	29.6
WP_165220188.1\|3283879_3284080_-	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_165221892.1\|3284466_3284730_-	hypothetical protein	NA	NA	NA	NA
WP_165220190.1\|3284941_3286117_-	elongation factor Tu	A0A2K9L516	Tupanvirus	4.8e-12	24.9

DBSCAN-SWA_272

3289156 : 3295029

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220198.1\|3289156_3291445_-	response regulator	A0A1V0SGX0	Hokovirus	2.5e-49	34.6
WP_165220200.1\|3291441_3291945_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_165220202.1\|3291997_3292459_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_165220204.1\|3293050_3293824_+	NAD kinase	NA	NA	NA	NA
WP_165220206.1\|3293897_3295029_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.2e-05	36.2

DBSCAN-SWA_273

3312662 : 3312914

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220236.1\|3312662_3312914_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.2e-06	42.5

DBSCAN-SWA_274

3318714 : 3328224

Paramecium_bursaria_Chlorella_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220250.1\|3318714_3319671_+	aspartate carbamoyltransferase catalytic subunit	A7RB08	Paramecium_bursaria_Chlorella_virus	2.7e-29	35.5
WP_165220252.1\|3319667_3320960_+	dihydroorotase	NA	NA	NA	NA
WP_165220254.1\|3320972_3321590_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_165220259.1\|3321598_3322750_+	DNA-protecting protein DprA	S6BFL3	Thermus_phage	8.3e-25	41.0
WP_165220260.1\|3322729_3322936_-	hypothetical protein	NA	NA	NA	NA
WP_165220262.1\|3323179_3325867_+	type I DNA topoisomerase	A0A0G2Y787	Acanthamoeba_polyphaga_mimivirus	1.8e-99	30.9
WP_165220263.1\|3325863_3328224_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.8e-59	33.3

DBSCAN-SWA_275

3331587 : 3333343

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220269.1\|3331587_3332955_-	PleD family two-component system response regulator	W8CYM9	Bacillus_phage	3.4e-17	43.2
WP_165220271.1\|3332971_3333343_-	response regulator	A0A1V0SGR9	Hokovirus	9.6e-07	26.0

DBSCAN-SWA_276

3337213 : 3340720

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220279.1\|3337213_3340720_-	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	5.1e-182	37.2

DBSCAN-SWA_277

3344520 : 3345204

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220284.1\|3344520_3345204_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	9.1e-11	30.9

DBSCAN-SWA_278

3369671 : 3377352

Emiliania_huxleyi_virus(33.33%)

integrase

attL 3369649:3369664|attR 3383635:3383650

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3369649:3369664	attL	NA	NA	NA	NA
WP_165220333.1\|3369671_3370853_-\|integrase	phage integrase family protein	G8DH71	Emiliania_huxleyi_virus	1.1e-27	30.8
WP_165220336.1\|3371166_3371352_-	hypothetical protein	NA	NA	NA	NA
WP_165220339.1\|3371368_3372985_-	hypothetical protein	NA	NA	NA	NA
WP_165220342.1\|3373035_3373209_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_165220345.1\|3373312_3373771_+	Arc family DNA-binding protein	S5WBL1	Pseudomonas_phage	3.8e-05	55.6
WP_165220348.1\|3374083_3374278_-	hypothetical protein	NA	NA	NA	NA
WP_165220351.1\|3374326_3374521_-	hypothetical protein	NA	NA	NA	NA
WP_165220354.1\|3375782_3376730_+	hypothetical protein	NA	NA	NA	NA
WP_165220357.1\|3376752_3377352_+	hypothetical protein	S5FXQ0	Shigella_phage	1.7e-05	32.1
3383635:3383650	attR	NA	NA	NA	NA

DBSCAN-SWA_279

3381442 : 3402002

uncultured_Mediterranean_phage(11.11%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220368.1\|3381442_3382849_-	AAA family ATPase	A0A1B1INT2	uncultured_Mediterranean_phage	2.4e-66	41.0
WP_165220371.1\|3382832_3383489_-	hypothetical protein	NA	NA	NA	NA
WP_165220374.1\|3384294_3385314_-	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	2.8e-32	31.1
WP_165220377.1\|3385484_3387683_-	alkaline phosphatase	M4SLV1	Cyanophage	2.5e-86	45.7
WP_165221904.1\|3387781_3388642_-	DMT family transporter	NA	NA	NA	NA
WP_165220380.1\|3389104_3389380_-	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	6.0e-06	35.6
WP_165220383.1\|3389577_3391998_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.2e-194	47.6
WP_165220386.1\|3392347_3393628_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	6.7e-132	58.2
WP_165220389.1\|3393916_3394549_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	5.0e-64	59.2
WP_165220392.1\|3394796_3396053_+	GGDEF domain-containing protein	NA	NA	NA	NA
WP_165220395.1\|3396167_3397925_+	gamma-glutamyltransferase	Q5GF27	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-09	25.2
WP_165220398.1\|3397975_3399223_+	cytochrome P450	NA	NA	NA	NA
WP_165220401.1\|3399283_3399556_+	hypothetical protein	NA	NA	NA	NA
WP_165220404.1\|3399552_3399939_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_165220407.1\|3400020_3400260_+	hypothetical protein	NA	NA	NA	NA
WP_165220410.1\|3400320_3400665_-	cupin domain-containing protein	NA	NA	NA	NA
WP_165220413.1\|3400718_3402002_-	O-acetylhomoserine aminocarboxypropyltransferase	A0A0B5JD48	Pandoravirus	5.5e-17	26.6

DBSCAN-SWA_280

3422956 : 3423295

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220489.1\|3422956_3423295_-	integration host factor subunit alpha	A0A075E147	Dickeya_phage	7.4e-06	30.2

DBSCAN-SWA_281

3431525 : 3436923

Orpheovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220510.1\|3431525_3431981_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2I2L4Y7	Orpheovirus	2.6e-06	30.0
WP_165220513.1\|3432143_3432674_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_165220516.1\|3432787_3433126_+	hypothetical protein	NA	NA	NA	NA
WP_165220519.1\|3433170_3433794_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	1.6e-17	35.6
WP_165220522.1\|3433775_3435134_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.7e-35	38.5
WP_165220525.1\|3435138_3435618_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_165220528.1\|3435633_3436923_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	3.1e-97	51.0

DBSCAN-SWA_282

3446190 : 3453497

Gordonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220557.1\|3446190_3446589_+	type II toxin-antitoxin system death-on-curing family toxin	A0A1B3AYM0	Gordonia_phage	1.0e-06	44.7
WP_165220560.1\|3446611_3448870_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	9.4e-97	40.2
WP_165220563.1\|3449058_3450249_+	YdgA family protein	NA	NA	NA	NA
WP_165220566.1\|3450332_3451811_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	7.4e-167	65.7
WP_165220568.1\|3452066_3453497_+	cytochrome P450	A0A2I2L481	Orpheovirus	4.8e-38	24.4

DBSCAN-SWA_283

3471761 : 3480490

Prochlorococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220607.1\|3471761_3472835_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	2.2e-59	40.5
WP_165220609.1\|3472831_3473488_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	5.3e-24	37.5
WP_165220611.1\|3473499_3473928_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_165220614.1\|3473927_3474335_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_165220617.1\|3474331_3474673_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165220619.1\|3474786_3475380_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_165220621.1\|3475376_3477512_-	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	1.5e-35	24.9
WP_165220623.1\|3477598_3478465_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_165220625.1\|3478484_3479228_+	ribonuclease	NA	NA	NA	NA
WP_165220627.1\|3479257_3479854_+	glutathione S-transferase	NA	NA	NA	NA
WP_165220629.1\|3479901_3480219_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.2e-18	44.2
WP_165220631.1\|3480199_3480490_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.3e-14	56.6

DBSCAN-SWA_284

3491309 : 3495139

Megavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220667.1\|3491309_3491732_-	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	1.2e-16	39.4
WP_165220669.1\|3491850_3492534_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_165220671.1\|3492683_3493193_+	damage-inducible protein DinB	NA	NA	NA	NA
WP_165220673.1\|3493252_3495139_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.1e-69	32.6

DBSCAN-SWA_285

3499493 : 3500984

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220687.1\|3499493_3500984_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.9e-45	35.3

DBSCAN-SWA_286

3509557 : 3510226

Murmansk_poxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220705.1\|3509557_3510226_-	guanylate kinase	A0A223FN12	Murmansk_poxvirus	1.8e-16	31.2

DBSCAN-SWA_287

3513862 : 3514099

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003502080.1\|3513862_3514099_-	acyl carrier protein	E3SSM9	Prochlorococcus_phage	3.8e-09	55.1

DBSCAN-SWA_288

3525977 : 3527474

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220747.1\|3525977_3527474_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	2.7e-76	36.5

DBSCAN-SWA_289

3535257 : 3540449

Mollivirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220774.1\|3535257_3536748_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.8e-49	33.5
WP_165220777.1\|3536957_3537698_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_165220780.1\|3537726_3538614_+	DMT family transporter	NA	NA	NA	NA
WP_165220783.1\|3538871_3540449_+\|tRNA	cysteine--tRNA ligase	A0A161HRB7	Powai_lake_megavirus	2.5e-40	31.5

DBSCAN-SWA_290

3551439 : 3556734

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220822.1\|3551439_3553326_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.8e-40	26.9
WP_165220825.1\|3553415_3553640_+	antitoxin MazE family protein	NA	NA	NA	NA
WP_165220827.1\|3554056_3554758_+	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_165220829.1\|3554775_3555591_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_165220831.1\|3555963_3556734_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.7e-18	30.9

DBSCAN-SWA_291

3559828 : 3560422

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221940.1\|3559828_3560422_+	HD family hydrolase	R9ZX56	Cellulophaga_phage	1.7e-13	40.8

DBSCAN-SWA_292

3564056 : 3564845

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220857.1\|3564056_3564845_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-31	37.8

DBSCAN-SWA_293

3569008 : 3569662

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220866.1\|3569008_3569662_+	HD domain-containing protein	S4W232	Pandoravirus	5.3e-08	29.2

DBSCAN-SWA_294

3576315 : 3588053

Paramecium_bursaria_Chlorella_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220887.1\|3576315_3577032_-	ribonuclease III	M1HG76	Paramecium_bursaria_Chlorella_virus	2.3e-12	27.7
WP_165220890.1\|3577031_3577778_-	signal peptidase I	NA	NA	NA	NA
WP_165220893.1\|3577849_3578272_-	holo-ACP synthase	NA	NA	NA	NA
WP_165220896.1\|3578600_3578753_-	DUF3563 family protein	NA	NA	NA	NA
WP_165220899.1\|3578890_3581125_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	D0UIJ3	Aggregatibacter_phage	8.4e-05	30.9
WP_165220902.1\|3581242_3581656_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_165220905.1\|3581941_3582520_+	NYN domain-containing protein	NA	NA	NA	NA
WP_165220908.1\|3582634_3583714_+	bifunctional transcriptional activator/DNA repair protein Ada	A0A167R6J9	Powai_lake_megavirus	1.7e-16	34.4
WP_165220911.1\|3583885_3584176_+	hypothetical protein	NA	NA	NA	NA
WP_165220926.1\|3584252_3584729_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.7e-28	49.7
WP_165220928.1\|3584876_3585761_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_165220930.1\|3585989_3588053_+	lytic transglycosylase domain-containing protein	K4NWI2	Pseudomonas_phage	2.8e-23	41.9

DBSCAN-SWA_295

3594452 : 3595565

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220948.1\|3594452_3595565_+	pyridoxal phosphate-dependent aminotransferase	A0A1X7QHI1	Faustovirus	1.4e-21	26.3

DBSCAN-SWA_296

3600444 : 3604327

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165220973.1\|3600444_3601464_+	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	1.3e-24	28.2
WP_165220976.1\|3601444_3602962_+	glycosyltransferase	NA	NA	NA	NA
WP_165220979.1\|3602962_3604327_-	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.4e-10	27.9

DBSCAN-SWA_297

3615677 : 3618809

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221008.1\|3615677_3618809_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.5e-64	23.9

DBSCAN-SWA_298

3625756 : 3628072

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221029.1\|3625756_3628072_+	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	6.2e-27	36.2

DBSCAN-SWA_299

3633320 : 3634895

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165221038.1\|3633320_3634895_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.6e-29	33.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049245

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP049244

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP049241

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection