CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP049251	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed4, complete sequence	0 crisprs	csa3	0	0	0
NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1 crisprs	csa3,DEDDh	2	7	0
NZ_CP049252	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0	2
NZ_CP049250	Rhizobium rhizoryzae strain DSM 29514 chromosome, complete genome	0 crisprs	cas3,DEDDh,csa3,WYL	0	0	2
NZ_CP049247	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1
NZ_CP049248	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2780724 : 2794095

uncultured_Mediterranean_phage(70.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062554634.1\|2780724_2783292_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.2e-63	49.4
WP_062554635.1\|2783364_2783715_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_165136122.1\|2783913_2784786_+	ATP-binding protein	NA	NA	NA	NA
WP_165136125.1\|2784849_2786439_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.4e-14	32.0
WP_156379165.1\|2786609_2787263_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1J0MC37	Streptomyces_phage	1.7e-11	36.4
WP_165136128.1\|2787259_2788027_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.2e-38	37.9
WP_165136131.1\|2788030_2789314_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-97	46.2
WP_062554641.1\|2789411_2790242_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	9.9e-44	40.4
WP_165136134.1\|2790238_2791144_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_062554642.1\|2791186_2791396_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	6.3e-08	61.7
WP_165136137.1\|2791437_2792550_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.7e-09	32.3
WP_165136140.1\|2792579_2793293_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-38	44.6
WP_165137205.1\|2793279_2794095_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	4.1e-34	34.4

DBSCAN-SWA_2

3205355 : 3216828

Paracoccus_phage(28.57%)

tail,head,protease,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165136619.1\|3205355_3209168_-	hypothetical protein	A0A0K1LL82	Rhodobacter_phage	3.9e-212	38.5
WP_062552820.1\|3209527_3209962_-	peptidase P60	F4YXU4	Roseobacter_phage	2.4e-25	43.0
WP_165136622.1\|3209958_3210834_-	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	9.1e-56	42.2
WP_165136625.1\|3210830_3211469_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	5.1e-48	47.6
WP_165136628.1\|3211719_3212298_-\|tail	phage tail tape measure protein	A5LH38	Enterobacteria_phage	8.8e-07	40.2
WP_165136631.1\|3212306_3212537_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_165136634.1\|3212533_3212929_-	gene transfer agent family protein	NA	NA	NA	NA
WP_165136638.1\|3212928_3213336_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_062552826.1\|3213378_3213786_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_062552827.1\|3213782_3214121_-\|head	phage head closure protein	NA	NA	NA	NA
WP_165136641.1\|3214122_3214692_-	hypothetical protein	NA	NA	NA	NA
WP_165136644.1\|3214966_3216250_-\|capsid	phage major capsid protein	Q3HQT0	Burkholderia_phage	6.3e-82	44.2
WP_165136647.1\|3216255_3216828_-\|head,protease	HK97 family phage prohead protease	A0A2H4JAI0	uncultured_Caudovirales_phage	1.6e-29	45.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP049249

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049249_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049249_1

1016824-1017372

Orphan

Consensus_repeat	Method
GCCGCCGCCNTTNCCGCCNCCGTTGCCGCC	CRT

8 spacers

The CRISPR arrays of NZ_CP049249_1

>merge|NZ_CP049249|1|1016824-1017372|CRT
GCCGCCGCCATTGCCGCCACCGTTGCCGCCGCCGTTGCCGCCGCCGTTCCCACCGCCATTGCCGCCGCCATTGCCGCCACCATTGCCGCCACCGTTGCCGCCGCCGTTGCCGCCGCCGTTCCCACCGCCATTGCCGCCGCCATTGCCGCCACCATTGCCGCCGCCATTGCCGCCACCATTGCCGCCGCCGTTGCCGCCGCCATTGCCGCCACCGTTGCCACCGCCATTGCCACCGCCGTTGCCACCGCCGTTACCGCCGCCATTGCCGCCACCGTTACCGCCGCCATTGCCGCCACCGTTGCCGCCGCCGTTCCCACCGCCGTTACCGCCGCCGTTCCCACCGCCGTTACCGCCGCCATTGCCGCCGCCATTGCCGCCGCCGTTGCCACCGCCATTGCCACCGCCATTGCCGCCGCCGTTACTACCGCCGCTACCGCCGCCATTGCCGCCACCGTTCCCACCGCCGTTGCCGCCGCCGTTACCGCCACCGTTGCCGCCACCGTTGTTGCTGCCGCCGTTGCCGCCGCCGTTACCGCCGCCGTTGCCGCC

>NZ_CP049249|1|1|1016824-1017372|CRT
GCCGCCGCCATTGCCGCCACCGTTGCCGCC	GCCGTTGCCGCCGCCGTTCCCACCGCCATT
GCCGCCGCCATTGCCGCCACCATTGCCGCC	ACCGTTGCCGCCGCCGTTGCCGCCGCCGTTCCCACCGCCATT
GCCGCCGCCATTGCCGCCACCATTGCCGCC	GCCATTGCCGCCACCATTGCCGCCGCCGTT
GCCGCCGCCATTGCCGCCACCGTTGCCACC	GCCATTGCCACCGCCGTTGCCACCGCCGTTACCGCCGCCATTGCCGCCACCGTT
ACCGCCGCCATTGCCGCCACCGTTGCCGCC	GCCGTTCCCACCGCCGTTACCGCCGCCGTTCCCACCGCCGTTACCGCCGCCATT
GCCGCCGCCATTGCCGCCGCCGTTGCCACC	GCCATTGCCACCGCCATT
GCCGCCGCCGTTACTACCGCCGCTACCGCC	GCCATTGCCGCCACCGTTCCCACCGCCGTT
GCCGCCGCCGTTACCGCCACCGTTGCCGCC	ACCGTTGTTGCTGCCGCCGTT
GCCGCCGCCGTTACCGCCGCCGTTGCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049249.1\|WP_165131916.1\|1028691_1029702_+\|porin	unknown	unknown	gnl\|CDD\|308243
NZ_CP049249.1\|WP_165131883.1\|1008672_1009599_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224005
NZ_CP049249.1\|WP_062557092.1\|1006382_1007510_+\|BMP-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380618
NZ_CP049249.1\|WP_062557086.1\|1012924_1013593_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP049249.1\|WP_165131892.1\|1013585_1013927_+\|allophanate-hydrolase	unknown	unknown	gnl\|CDD\|226328
NZ_CP049249.1\|WP_165131913.1\|1026910_1028422_+\|malonyl-CoA-synthase	unknown	unknown	gnl\|CDD\|181011
NZ_CP049249.1\|WP_165131901.1\|1019523_1021098_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173867
NZ_CP049249.1\|WP_165131889.1\|1011380_1012925_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226364
NZ_CP049249.1\|WP_165131907.1\|1023962_1024949_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236898
NZ_CP049249.1\|WP_165132396.1\|1018723_1019374_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP049249.1\|WP_062557088.1\|1010647_1011349_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP049249.1\|WP_062557080.1\|1022092_1022950_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP049249.1\|WP_165131910.1\|1024941_1025568_+\|lysophospholipase	unknown	unknown	gnl\|CDD\|239946
NZ_CP049249.1\|WP_165131895.1\|1013987_1016765_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP049249.1\|WP_062557076.1\|1025658_1026918_+\|malonyl-CoA-decarboxylase	unknown	unknown	gnl\|CDD\|368376
NZ_CP049249.1\|WP_165131880.1\|1007527_1008673_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226962
NZ_CP049249.1\|WP_165131886.1\|1009620_1010637_+\|formamidase	unknown	unknown	gnl\|CDD\|183950
NZ_CP049249.1\|WP_165131904.1\|1022946_1023966_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP049249.1\|WP_165131877.1\|1005424_1006114_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP049249.1\|WP_062557081.1\|1021154_1022096_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674

Protein	Function_ID	Function_description	E-value
NZ_CP049249.1\|WP_165131916.1\|1028691_1029702_+\|porin	gnl\|CDD\|308243	pfam02530, Porin_2, Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.	4.94077e-88
NZ_CP049249.1\|WP_165131883.1\|1008672_1009599_+\|ABC-transporter-permease	gnl\|CDD\|224005	COG1079, COG1079, Uncharacterized ABC-type transport system, permease component [General function prediction only].	1.14553e-84
NZ_CP049249.1\|WP_062557092.1\|1006382_1007510_+\|BMP-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380618	cd19963, PBP1_BMP-like, periplasmic binding component of a basic membrane lipoprotein (BMP) from Brucella abortus and its close homologs in other bacteria. Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria. These outer membrane proteins include Med, a cell-surface localized protein regulating the competence transcription factor gene comK in Bacillus subtilis, and PnrA, a periplasmic purine nucleoside binding protein of an ATP-binding cassette (ABC) transport system in Treponema pallidum. All contain the type 1 periplasmic sugar-binding protein-like fold.	1.35752e-129
NZ_CP049249.1\|WP_062557086.1\|1012924_1013593_+\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	2.99557e-50
NZ_CP049249.1\|WP_165131892.1\|1013585_1013927_+\|allophanate-hydrolase	gnl\|CDD\|226328	COG3806, ChrR, Transcriptional activator [Transcription].	2.13803e-24
NZ_CP049249.1\|WP_165131913.1\|1026910_1028422_+\|malonyl-CoA-synthase	gnl\|CDD\|181011	PRK07514, PRK07514, malonyl-CoA synthase; Validated.	0
NZ_CP049249.1\|WP_165131901.1\|1019523_1021098_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173867	cd08502, PBP2_NikA_DppA_OppA_like_16, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP049249.1\|WP_165131889.1\|1011380_1012925_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226364	COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only].	0
NZ_CP049249.1\|WP_165131907.1\|1023962_1024949_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	5.47759e-139
NZ_CP049249.1\|WP_165132396.1\|1018723_1019374_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	3.32301e-51
NZ_CP049249.1\|WP_062557088.1\|1010647_1011349_+\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	1.11759e-53
NZ_CP049249.1\|WP_062557080.1\|1022092_1022950_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.34655e-81
NZ_CP049249.1\|WP_165131910.1\|1024941_1025568_+\|lysophospholipase	gnl\|CDD\|239946	cd04502, SGNH_hydrolase_like_7, Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.	2.15495e-56
NZ_CP049249.1\|WP_165131895.1\|1013987_1016765_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	6.38029e-101
NZ_CP049249.1\|WP_062557076.1\|1025658_1026918_+\|malonyl-CoA-decarboxylase	gnl\|CDD\|368376	pfam05292, MCD, Malonyl-CoA decarboxylase C-terminal domain. This family consists of several eukaryotic malonyl-CoA decarboxylase (MLYCD) proteins. Malonyl-CoA, in addition to being an intermediate in the de novo synthesis of fatty acids, is an inhibitor of carnitine palmitoyltransferase I, the enzyme that regulates the transfer of long-chain fatty acyl-CoA into mitochondria, where they are oxidized. After exercise, malonyl-CoA decarboxylase participates with acetyl-CoA carboxylase in regulating the concentration of malonyl-CoA in liver and adipose tissue, as well as in muscle. Malonyl-CoA decarboxylase is regulated by AMP-activated protein kinase (AMPK).	1.65231e-125
NZ_CP049249.1\|WP_165131880.1\|1007527_1008673_+\|ABC-transporter-permease	gnl\|CDD\|226962	COG4603, COG4603, ABC-type uncharacterized transport system, permease component [General function prediction only].	4.14229e-86
NZ_CP049249.1\|WP_165131886.1\|1009620_1010637_+\|formamidase	gnl\|CDD\|183950	PRK13287, amiF, formamidase; Provisional.	0
NZ_CP049249.1\|WP_165131904.1\|1022946_1023966_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	3.11116e-161
NZ_CP049249.1\|WP_165131877.1\|1005424_1006114_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	4.7402e-44
NZ_CP049249.1\|WP_062557081.1\|1021154_1022096_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.39961e-111

>NZ_CP049249.1|WP_165131895.1|1013987_1016765_-|EAL-domain-containing-protein
MTTGRLRSVLSYIPRIGLIMLMLLIPVGAFRPVTGLVDQLLSDLRFSLLQRNASQQVVFLAIDKESLDKVGVWPWPRSVYADILTVLSQSDPKDIFFDIDFSTPSAPQEDGKLAEALENAGGGVILPIFKQHAKAAETSTVELTRPIDQFGKVAWPAFANVELDDAGLVSHFSTSDQADGLRVQSVAAALASYSGRDGVFPIDFSIRPSTVPTYSVSDLLSGKVPPSRLDGKTVVIGAYATELKDIYPVPVHGALAGPLIHILATETILQNRLLTAPDQHGAELFLAAMVVVLALAARRASVLVALAAAGLAVLGVEAAAFWVQQSGRMYLETGQIWMIVLIGLCLFIGEKFDFNRFLLRRAFADRRLARTVLQQIIAESSDAVIVFDDQLNIIEASQSTELHWQRGNAKGSRLGDCIPSDLFEAVKRMVTAYGLDQGKSLTQTVHFSTEAGDETRYFEAALTLSPRILHLESGRTDHSSFVGSLIVRDQTAQRLHELELLRLSQTDELTGLLNRREFASRLGNQDTPVIVAAIGFHRFEVVAKVLGSALSDQLLQALAARLASLPKIHLVGRLGPNSFVVSASLNEEGAATRLIDAIAETFAQPVDLGSSPIPVDVRIGLFRTQTLAEHPSLILDYCAAALESAYKIGSHWWRAFDPELARRQERARKLENDMREGLRRGEFHLLYQPQVDLKTGAVRGAEALLRWDHCDAGPVSPAEFVPVAEASGFIRELGRFALFEACRQASKWPDHMTVAVNVSGIQIQDAGLLEEVQLALLESGLAPKRLHLEITESAFVEGSRAVLDLIGNIRAMGISVALDDFGTGYSSLSYMTAMPLDKLKIDQSFVKRLSTDPASLVIIQSVLSMAHGLNLRAIAEGIETREEWDILKALGCQEGQGYLFGRPMRSEDLVALAIPSDQLHQRLAG
>NZ_CP049249.1|WP_165131892.1|1013585_1013927_+|allophanate-hydrolase
MAETIRSGFHAGGWKELAFEAFREGVTIHWIRRFEGEAPGVALLKYEAGASVPRHLHVGLETILVLEGSQSDETGRYPTGSFIVNAPGSEHSVWSEDGCVVLIQWDRPVQILN
>NZ_CP049249.1|WP_062557086.1|1012924_1013593_+|cysteine-hydrolase
MPTIKALPFDFRFEPASTALIVIDMQRDFIEPGGFGETLGNDVSRVSVIVPDVKRLIEGCRREGLTVIHTMECHRPDLSDLPDAKRNRGNPTLRIGDAGPMGRILIAGEAGTEIVTELAPLPGEIVIEKPGKGAFYATGLSQVLAERGITHLIFAGVTTEVCVQTTMREANDRGFNCLLVEEATASYFPEFKQAALEMIRAQGGIVGWTAHLADFLEGVNHG
>NZ_CP049249.1|WP_165131889.1|1011380_1012925_+|ABC-transporter-ATP-binding-protein
MTGITAGPTTGKALSLETVGMTMRFGSFTALDDVSIKVKAGSFHALLGENGAGKSTLVKCIMGFYRQTSGQLMVEDREVSVASPKDAAALGLGMVYQHFTLVPSLTGAENLVISRNDVPGVISWKMEREALDAFIQTMPFRIPLDRPVRELAAGEKQKLEIIRQLYLGRRFLILDEPTSVLTPAEADDMLGLVRGMTQQGDLSVLMISHKFHEVMKFADAVSVLRRGKHIGSGSTSELNPHDMAAMMIGNVKLAELDSRLPIKNDARTVLELKDLRAKDRSGLKTIEVEALGIKAGEIVGIAGISGNGQKELAETLAGQRKAETGEILVEAKPYQATRKESRQFRVRFIPEEPLQNACAPKMSVMENLSLRSFDIDPSGKPRFFLDRAAMRAKADALIAAFKVKTASPSSPIASLSGGNVQRAVLARELTGEVDLLIVSNPCFGLDFSAVAEIRARIMKARNSGTAVLLFSEDLDELMEMSDRILVMSDGKLVYETPARGADISIIGSHMAGHG
>NZ_CP049249.1|WP_062557088.1|1010647_1011349_+|cysteine-hydrolase
MDTLTNTATNFVSADPYPWPYNGKLRPDNTVLIIIDMQTDFCGPGGYVDHMGYDLSLVRAPIEPIKAVLAAMRDKGYHIIHTREGHRPDLADLPANKRWRSQRINAGIGDAGPCGRILVRGEPGWDIIDELKPLEGETIIDKPGKGSFCATDLELILNQRRIENIILTGITTDVCVHTTMREANDRGFECLLLEDCCGATDYGNHLAAIKMVKMQGGVFGSVSNSKALIEALP
>NZ_CP049249.1|WP_165131886.1|1009620_1010637_+|formamidase
MNGLGGLNKSEHGVGIGLVQLQLPVTVTKEDLARQTQRVVELVGKARRNQPGMDLVIFPEYALHGLSMDINPEIMCTLDGPEVAAFKAACKEHHIWGCFSIMELNPGGMPYNSGIIIDDQGELKLYYRKMHPWVPVEPWEPGDTGIPVITGPKGAKIALIICHDGMFPEMARECAYKGAEIMIRTAGYTAPIRDSWRFTNQSNAFCNLMVTANVCMSGSDGTFDSMGEGMICNFDGSIIAHGTSGRPDEIITAEVRPDLVREARLGWGVENNIYQFGHRGYVAVAGGAQDCPYTYMHDLAAGRYRLPWEDGVKVTDGTSCGFEKPTRRFGEITKTAAE
>NZ_CP049249.1|WP_165131883.1|1008672_1009599_+|ABC-transporter-permease
MEETALGLWGVPLAILAGAIRVSTPFIFVSLGETLTERSGRINLGLEGTLVFGAMSAYAVAVLTQSAWLGVLAAMMAGAVFGLLHGFICKFPKVNDIAIGIAMMQFGLGLAFFLGKPFIQPVAPKLPSIPLGGWSALPQVQAALTINVLFIVGLILTFSIAWMLKNTRIGLILRVVGDSSDAARAMGINPNTVRLLATAAGGALAAIGGAYLSLFYPGSWNERISSGQGLMAVALVIFARWNPKGCLFASLLFGGAGALGPALQSVGITQGYYLFYAAPYVLTLIILIMTSSPTTRLSGAPEELSLTK
>NZ_CP049249.1|WP_165131880.1|1007527_1008673_+|ABC-transporter-permease
MAAEIDISSVASATRRFTLSRLQEELARRLEPLAITFLAILAGMGLFSLFLLALGKSPLQFVQLVYAGGFGTWFSLQNAFSRAAPFLLTALCVALPARLGLTVIGGEGALALGGLGAAAIAVPMLSVSHGWPLWIAMGIAGSVVGGLWIAFAGALKHYRGVNETISSLLLTYIGIAVMNHLIEGVLRDPASLNKPSTFPLPANAMFGKIWGMDVHWGFAIGIVCCVLAWVLIERTTIGFAARVSGGNLRAAQIQGLPVGKLIVGFTFLAGAFAGLAGMIEVAAVQGSANGSIIAGYGYTGILVAFLARHNPLAIIPVSILLGGVAAAGGLIQRRMGLPDATVLVLQGTLFISVLFFETLYGRFKLFNPEMWRTTRAGKDGE
>NZ_CP049249.1|WP_062557092.1|1006382_1007510_+|BMP-family-ABC-transporter-substrate-binding-protein
MIKLPSVSRRQFLQTTLAGAAAAATPGLLSSAAFAATPLTIGFIYVGPKDDYGYNQAHAEGAAALKSIEGITLVEEENVPETVDVQKTMESMINLDGAKLLFPTSFGYFDPHVLAMAKKYPDAQFRHCGGLWTKEKHPANVGSYFGYIHQGQYLNGITAGYASKSKKIGFVAAKPIPQVLQNINAFLLGARSVDPSITCQVIFTGEWSLAVKEAEATNALIDQGADVITCHVDSPKVVAQTAAGRGAFVCGYHANQSALAGDKYLTGAEWAWGNVYTDFIKTMQAGKPIGNFVRGGLKDGFVKMSPLGKAVSADARAKFEATQKTMLGGNFAVFKGGLKDNKGNVVVPAGKDYTEQAIELESMNYLVEGVIGSVA
>NZ_CP049249.1|WP_165131877.1|1005424_1006114_-|GntR-family-transcriptional-regulator
MEKVIGIVRELVRTGDTVEQLVRAISDLIISGDLQPGAKLDEGGLASRFQVSRTPVREALRQLCAMGLVERPPNRSAIVTNVSDDFLSSMFEAMAELEAICARLSAERMTTQEREELESLHRDSFDIVKTGASEDYAAFNTEFHNRLYSGAHNAHIQETVLQTRARLAPFRRAQFRLEGRLQHSWDEHEGIVRAILNRDGAAASCAAYSHVSIVGDASRTFASSTATRN
>NZ_CP049249.1|WP_165132396.1|1018723_1019374_-|GntR-family-transcriptional-regulator
MRSNGTPSLRDQIEEAIVSGTYRPGDRLEEQSLAEQYGVSRTPVREALRQLQEAGLVDIKPRRGAAVTIVGPSELIHMFEVMGGLEAMAGRLASRRLDEASRKELLDSHEACRAAVNQGSDAYYYENERFHMAIYKASGNPFLEEQARALHRRLKPYRRIQLRSLNRIEQSFAEHDRIVTAIVNGNSNEAEQALWDHITIQADRFHDFLAGLSREG
>NZ_CP049249.1|WP_165131901.1|1019523_1021098_+|ABC-transporter-substrate-binding-protein
MISKALKTLTAATVLSLGMLAAAQAESVLRIRDVGDIQQMDPLLSTNYPMRDMSYLLWDTLFAMDANFEVKPQMVDKYSMSADGKVYDFTLRDKLVFHDGAPVTSADVIASVNRWMTKDSLGQEIAKRLDKIEATGTNSLRITLKEPFAQLLNGLGRMTAYPLFIMPERIAKTPIGEKLPALVGSGPFKLVEWQPGVKFVVEKFKDYVPRSEPASNLAGGKVVKVDRIERITIPDDTSAVNALLAGEIDFVTEVPYDQLSIIESDKNFVVASKPLLGKSLQIVLNHTQPPLNNIKVRQAVQLALNQQDFMSTLLGDRKDLYKLCAAIFMCDAPYATDINSDRYMKPSVEKAKALLKEAGYDGTPITFLHPTDQLFQRDMGTVLVQALRKAGFTVDDRQIDLATMFSRRNNKGTPAEGGWNMFLTAFGGDAMMDPLTNPYVTGACEKAFVGWPCDQDLQARWKSFLLADGQAARKDAAVKIQERANEIVTFIPMGQYYGVSGWSKSVSGMISSPLHLYWNIEKKQ
>NZ_CP049249.1|WP_062557081.1|1021154_1022096_+|ABC-transporter-permease
MSNFVVRRLLSVIPIAFIVLITVFLLLHIGPGDPAALIAGENATRDQIEAIRERLFLDRPLLEQLFLYLSNVARFDLGQSVYSGFPVVQLILQRVEPTAMLAVSTLTLSVLIAVPMGVWGAWRAGSAIDTFLIVASVIGFSVPVFVIGYVLVDLFALRAGWLPVQGYKPLSTGLWNCLRSITLPSITLSFLFSALVARITRATMLEVLAEDYIRTARAKGAGNGRILMVHALKNIGVPVVTVVGTSFAALLGGVVITESVFNIPGMGRLTVDAILTRDYPVVQGVLIVFSFVLIAVNLLVDLSYALFDPRVRQ
>NZ_CP049249.1|WP_062557080.1|1022092_1022950_+|ABC-transporter-permease
MTTVPSPATPLARLRRPGLAVSLSIAALSIVILMAIFGPLIFGLGNDLNPTMRLKPPSALAWFGTDNLGRDVFVRTISGARNSVTVGVSTAIVVLAIGGTLGVVAGYFNWVDRIVMRLADGLMAIPGILLAIALVSVLGGGLVTVIIAISVPEIPRTARLMRSVVLSIRELPFITAAISVGSSTPKILLQHIVPNAIGMLSVQATYVCAAAILSEAALSFLGVGTPPDVPSWGNVIASGKEYFRLAPWIIAFPGLLLSIMVLSINILGDRLRDRFDPRLAARRAS
>NZ_CP049249.1|WP_165131904.1|1022946_1023966_+|ABC-transporter-ATP-binding-protein
MTVEPFLSVRNLTVGFGPQGAIRAVREVSFDLQAGKTLCLVGESGSGKSVTATSIMGLHKPGSARVEADRMRLDGIDLLDCDEKQLARLRGSLMGMIFQDPMSSLNPALTIGFQLREALLLHEKMSTRAANARVMDVLQLVRIPDATRRMTAYPHQLSGGMRQRIMIAMALICRPRLLIADEPTTALDVTVQAQILWLLSELQREFGTAIIFITHDLGVVAEIADDVAVMYAGSLVERGPVHSIFQQPAHGYTAGLLRATAEFVPGEPSRGRLEEIPGNVPSFSLLPKGCSFVDRCRFAAQSCRQRMPDWRDAGAGHSSRCDQPVVYGAAAISNVEATT
>NZ_CP049249.1|WP_165131907.1|1023962_1024949_+|ATP-binding-cassette-domain-containing-protein
MTADTNVLRAENLVRHFKTGKGQTVHAVNDVSLSIAPGETLALVGESGCGKSTLGRMIMGLDRPDKGSVKLLGQDLSGMGRRELHEARRSVQMIFQDPSASLDPRWTAEAIVREPLDNFRIGTSAERREQVLQLLGKVGLRSDQAKRYPHELSGGQRQRLGIARALATRPRLVVADEPVSALDVSIRAQVINLLCDLRDEMELSLLFISHDIGVVSHISKRIAVMYLGRIVEAGETSVVLNAPQHPYTVGLLQSVPRPRPAERRQRAPLEGDPPSPINLPSGCAFRTRCPLAVDLCASVVPPLRSIAPGRFSACHRAEEMTNKELLNV
>NZ_CP049249.1|WP_165131910.1|1024941_1025568_+|lysophospholipase
MFEFPTPLATNRFEDDVVAILTRLQRGHLPERPIAFYGSSSFRLWGTMQQDLRSLDIVNLGFGGGTNLSGRHYLHKLLIPLQPQRVVLYFGENDIANDGLTGKSTFQNLQALLDDIRRALPSAAIFVLGTKQSPTRWIYADEVDEYNSLTASCCQERGDATFVDASAGLIGENGRPMGRYYQPDFIHLNAGGYAVWADILRDVPGLLT
>NZ_CP049249.1|WP_062557076.1|1025658_1026918_+|malonyl-CoA-decarboxylase
MSVLSDVLDLVFRRTMRVTVPAQATAAAMPRLIEDLLSSKGEITGVMTARHILDRYNVMTDAEKLQFFTHLAEDLDLDHADLETALHALKAKPDRKSYDRFLAAAEPRRQELARRLNRMPGATRLLVDMRADLLRLVPPDDPIARIDSDFRHLFASWFNRGFLVLRRISWESPAHILEKIIRYEAVHAITSWEDLRRRVEPEDRRCFAFFHPAMPDEPLIFVEVALTKGIASSVQSLLSDDRTPLAAHEADTAIFYSISNCQVGLAGISFGNSLIKQVVNDLTAELPGLSTFSTLSPMPLFSRWLLEQGFDASDWTKPQLLAAAAYYLTSARRNDGHHYDPVARFHLGNGALVHAVHAQADTSQRGKKDSLGVMTNYLYDLARLEQNHESFANQKQVAASPPVQTLTQSFQSVEVLQNA
>NZ_CP049249.1|WP_165131913.1|1026910_1028422_+|malonyl-CoA-synthase
MPNLLYDTLFAPGRDSDRTFLTDVSGQALSYRDFHALAARQANVLASAGLVPGDRLAVQVEKTPEALALYAACVMAGIVFLPLNTAYTLSELDYFITDSGARAVVCGAETAADLKARSAASISVLTLDAEGKGSLTDLAASQPPTFAVAERVESDLAALLYTSGTTGRSKGAMLSHSNLLSNARTLADLWRFDSRDVLLHALPIFHTHGLFVACNVTLIAQASLIFLPKFDLPTIMRMLPQASVLMGVPTFYTRLLGNAAFTRDLVAHMRLFISGSAPLLAETHVEFEARTGHRILERYGMTETNMSVSNPYDGERRAGTVGFPLPDVELLITDPESGAILPAGETGMIEVRGPNVFKGYWGMPEKTKAELRENGFFITGDIGRVDEDGYVHIVGRAKDLIISGGLNIYPKEIEMLLDEQPGVLESAVVGVPHPDFGEAVLAFIVARPGQSPDTKAISEAASTNLARFKQPRDIILLDELPRNTMGKVQKAALRERYKNRYVE
>NZ_CP049249.1|WP_165131916.1|1028691_1029702_+|porin
MNIKSLLLGSAAALAAVSGAQAADAIVAAQPEPMEYVRVCDAFGAGFFYIPGSETCLKIGGYVRFQTGFGRDLSGTSDWDSFTRAQLEIDARSDTELGTLRGFIGLRGDADNSSNRGVNVDQAFIELGGLKVGYFYNWWDDGLSGETDILASHTTQYNAIRYTYTAGAFYAGVAVDELEGVIHGTNRDNNVGIEGIIGGAFGPAKVALLGGYDTDQEEGAVRVIATAELGPGTLGLAAAWASGQNAYYDTSEWTVAAEYAVKVTDRFKITPGGQYFWNLDSTATGGFNGDRDGWRAGLTFDYQLATNLSTKVAVNYQDFDNQQEQWTGFVRLQRAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP049249_1	1.6\|1017214\|18\|NZ_CP049249\|CRT	1017214-1017231	18	NZ_CP049249.1	1016818-1016835	1	0.944
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249.1	1016818-1016847	2	0.933

1. spacer 1.6|1017214|18|NZ_CP049249|CRT matches to position: 1016818-1016835, mismatch: 1, identity: 0.944

gccattgccaccgccatt	CRISPR spacer
gccattgccgccgccatt	Protospacer
*********.********

2. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to position: 1016818-1016847, mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccaccgtt	Protospacer
************.***********.*****

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016854-1016883	0	1.0
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016926-1016955	0	1.0
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016842-1016883	0	1.0
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016914-1016955	0	1.0
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016986-1017015	0	1.0
NZ_CP049249_1	1.4\|1017046\|54\|NZ_CP049249\|CRT	1017046-1017099	54	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017046-1017099	0	1.0
NZ_CP049249_1	1.5\|1017130\|54\|NZ_CP049249\|CRT	1017130-1017183	54	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017130-1017183	0	1.0
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017262-1017291	0	1.0
NZ_CP049249_1	1.8\|1017322\|21\|NZ_CP049249\|CRT	1017322-1017342	21	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017322-1017342	0	1.0
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390809-390838	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016830-1016859	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016890-1016919	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016962-1016991	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017106-1017135	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017178-1017207	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121490-121519	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121550-121579	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121418-121447	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121442-121471	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121526-121555	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121586-121615	1	0.967
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP017105	Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence	1051616-1051645	1	0.967
NZ_CP049249_1	1.8\|1017322\|21\|NZ_CP049249\|CRT	1017322-1017342	21	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	71083-71103	1	0.952
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017118-1017147	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017142-1017171	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017190-1017219	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390797-390826	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	444886-444915	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445501-445530	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232716-232745	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232728-232757	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233052-233081	2	0.933
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	733700-733729	2	0.933
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390797-390838	2	0.952
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016902-1016931	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016818-1016847	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017214-1017243	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121610-121639	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121394-121423	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	601019-601048	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	446203-446232	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	444946-444975	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	238622-238651	2	0.933
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	1145445-1145474	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016830-1016859	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017022-1017051	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017106-1017135	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	342813-342842	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445525-445554	2	0.933
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445549-445578	2	0.933
NZ_CP049249_1	1.8\|1017322\|21\|NZ_CP049249\|CRT	1017322-1017342	21	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	28582-28602	2	0.905
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP033036	Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence	58379-58408	3	0.9
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232716-232757	3	0.929
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	444886-444927	3	0.929
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121478-121507	3	0.9
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390833-390862	3	0.9
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	238610-238639	3	0.9
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_012853	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence	213608-213637	3	0.9
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	162563-162592	3	0.9
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP036360	Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence	378409-378438	3	0.9
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1016902-1016931	3	0.9
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017118-1017147	3	0.9
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_048792	Serratia phage Moabite, complete genome	33888-33917	4	0.867
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121382-121411	4	0.867
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233139-233168	4	0.867
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP022264	Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence	127085-127114	4	0.867
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_042036	Mycobacterium phage Rockstar, complete genome	32745-32774	4	0.867
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232776-232805	5	0.833
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP015030	Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence	395480-395509	5	0.833
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	390914-390943	5	0.833
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	843687-843716	5	0.833
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP014276	Martelella sp. AD-3 plasmid unnamed1, complete sequence	233408-233437	5	0.833
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MT270409	Phaeobacter phage MD18, complete genome	134847-134876	5	0.833
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_042036	Mycobacterium phage Rockstar, complete genome	32745-32774	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	121382-121411	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MH047632	Mycobacterium phage Puppy, complete genome	32939-32968	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MT310878	Mycobacterium phage MK4, complete genome	32736-32765	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MH047633	Mycobacterium phage Pistachio, complete genome	32867-32896	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MH051259	Mycobacterium phage TNguyen7, complete genome	33286-33315	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	KY464936	Mycobacterium phage Idleandcovert, complete genome	33320-33349	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MT310881	Mycobacterium phage JF2, complete genome	31452-31481	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MN586063	Mycobacterium phage Isca, complete genome	32751-32780	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	KC172839	Mycobacterium phage BTCU-1, complete genome	32897-32926	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	AP018485	Mycobacterium phage B1 DNA, complete genome	31452-31481	5	0.833
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MT310880	Mycobacterium phage JF4, complete genome	31452-31481	5	0.833
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391193-391222	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391256-391285	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445381-445410	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233127-233156	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX640831	Mycobacterium phage Margo, complete genome	33305-33334	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP024587	Roseomonas sp. FDAARGOS_362 plasmid unnamed3, complete sequence	45772-45801	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	303109-303138	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	528069-528098	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1521191-1521220	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	306746-306775	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445228-445257	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	390701-390730	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	387978-388007	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MN234179	Gordonia phage Pipp, complete genome	49256-49285	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF185718	Arthrobacter phage Colucci, complete genome	37312-37341	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	534025-534054	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	255118-255147	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP018442	Undibacterium sp. YM2 plasmid pUYM01, complete sequence	134037-134066	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	LR743530	Xanthomonas phage Suba genome assembly, chromosome: 1	28435-28464	6	0.8
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP042825	Rhizobium sp. WL3 plasmid unnamed2, complete sequence	660463-660492	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391094-391123	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	LR743530	Xanthomonas phage Suba genome assembly, chromosome: 1	28435-28464	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP024444	Moraxella osloensis strain NP7 plasmid pNP7-1, complete sequence	197230-197259	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP040258	Moraxella osloensis strain MOXF1 plasmid pMOXF1, complete sequence	186018-186047	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MT897909	Mycobacterium phage Maru, complete genome	61305-61334	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	KP027208	Mycobacterium phage Pipsqueak, complete genome	60710-60739	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MG925350	Mycobacterium phage Mosaic, complete genome	60870-60899	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	KX758539	Mycobacterium phage Jaan, complete genome	34618-34647	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MN062706	Mycobacterium phage Heathen, complete genome	32942-32971	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	EU744250	Mycobacterium virus Pukovnik, complete genome	34118-34147	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_042328	Mycobacterium virus HelDan, complete genome	33194-33223	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_031279	Mycobacterium phage Bactobuster, complete genome	34266-34295	6	0.8
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MF373840	Mycobacterium phage Fred313, complete genome	32886-32915	6	0.8
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP049249	Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence	1017361-1017390	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	920968-920997	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MH020248	Mycobacterium phage Panamaxus, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MN062712	Mycobacterium phage Pocahontas, complete genome	33276-33305	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MG812492	Mycobacterium phage Lambert1, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MK284519	Mycobacterium phage Norbert, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MK524496	Mycobacterium phage Veracruz, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MH976517	Mycobacterium phage Popcicle, complete genome	33276-33305	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KT326767	Mycobacterium phage Texage, complete genome	33280-33309	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KM592966	Mycobacterium phage QuinnKiro, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX670828	Mycobacterium phage Todacoro, complete genome	33279-33308	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MK494127	Mycobacterium phage Noella, complete genome	33280-33309	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	12789-12818	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1350824-1350853	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	136379-136408	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	678190-678219	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP022369	Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence	268984-269013	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MT104474	Pseudomonas phage MR14, complete genome	18962-18991	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP038031	Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence	108560-108589	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	595338-595367	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	451884-451913	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445324-445353	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	232953-232982	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	233040-233069	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	382480-382509	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MH319761	Marine virus AG-345-O18 Ga0172273_15 genomic sequence	690-719	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1385271-1385300	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	1203183-1203212	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	KX855962	Arthrobacter phage HumptyDumpty, complete genome	37597-37626	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF185721	Arthrobacter phage Kabreeze, complete genome	37597-37626	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF185723	Arthrobacter phage RosiePosie, complete genome	37600-37629	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF668274	Arthrobacter phage JayCookie, complete genome	37733-37762	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MK494107	Arthrobacter phage Chipper1996, complete genome	37599-37628	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF185724	Arthrobacter phage Scavito, complete genome	37598-37627	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MN204499	Arthrobacter phage Mordred, complete genome	37597-37626	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MF185725	Arthrobacter phage Tophat, complete genome	37599-37628	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MG765278	Lactobacillus phage Silenus, complete genome	32314-32343	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	MH809528	Lactobacillus phage Sabazios, complete genome	31894-31923	7	0.767
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	439313-439342	7	0.767
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	KX683423	Mycobacterium phage BabyRay, complete genome	33225-33254	7	0.767
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	452051-452080	7	0.767
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	74302-74331	7	0.767
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MN159079	Aeromonas phage D9, partial genome	126098-126127	7	0.767
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MN102098	Aeromonas phage D3, complete genome	43213-43242	7	0.767
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391133-391162	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP023550	Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence	153689-153718	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_023714	Mycobacterium phage LinStu, complete genome	80506-80535	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	GQ303262	Mycobacterium phage LRRHood, complete genome	79897-79926	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MT889395	Mycobacterium phage Shifa, complete genome	78871-78900	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MH910040	Mycobacterium phage Sauce, complete genome	79595-79624	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MN062707	Mycobacterium phage Grungle, complete genome	76927-76956	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX831080	Mycobacterium phage Lukilu, complete genome	80907-80936	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_028869	Mycobacterium phage HyRo, complete genome	79605-79634	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MF919513	Mycobacterium phage Koguma, complete genome	78089-78118	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	JN204348	Mycobacterium phage Sebata, complete genome	81064-81093	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	189837-189866	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	31371-31400	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	451428-451457	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP046254	Sphingobium sp. CAP-1 plasmid p1, complete sequence	8172-8201	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	573417-573446	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KU998238	Gordonia phage Splinter, complete genome	36528-36557	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_048789	Corynebacterium phage Stiles, complete genome	13315-13344	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_030911	Gordonia phage Vendetta, complete genome	36528-36557	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP013419	Burkholderia sp. MSMB0266 plasmid pMSMB0266, complete sequence	7769-7798	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP041018	Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence	62682-62711	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	CP042595	Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence	179140-179169	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_041912	Aquamicrobium phage P14, complete genome	13949-13978	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_LR723676	Rhizobium sp. TCK plasmid 2	169977-170006	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	484836-484865	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1219172-1219201	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2067230-2067259	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP028919	Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence	197620-197649	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	581285-581314	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP022767	Ralstonia solanacearum strain T78 plasmid pRsT78, complete sequence	102451-102480	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	580496-580525	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	916531-916560	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	2079086-2079115	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	643195-643224	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1569913-1569942	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP005085	Sphingobium sp. TKS plasmid pTK1, complete sequence	303906-303935	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP031358	Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence	306729-306758	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	602317-602346	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	602345-602374	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	1203147-1203176	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	166961-166990	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	602345-602374	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	602345-602374	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	602345-602374	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	602345-602374	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	KU197014	Xanthomonas phage XAJ2, complete genome	18781-18810	8	0.733
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KP792123	Escherichia coli strain MG1655 YFP plasmid ESBL242, complete sequence	36301-36330	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	391349-391378	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	581285-581314	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	580496-580525	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1219172-1219201	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MN131137	Aeromonas phage D6, complete genome	42541-42570	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_048780	Corynebacterium phage StAB, complete genome	13537-13566	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MK977706	Corynebacterium phage Dina, complete genome	13533-13562	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MH926061	Corynebacterium phage Troy, complete genome	13531-13560	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_048791	Corynebacterium phage Adelaide, complete genome	13544-13573	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_048069	Corynebacterium phage SamW, complete genome	13531-13560	8	0.733
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NC_048790	Corynebacterium phage Lederberg, complete genome	13531-13560	8	0.733
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	342801-342830	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	374215-374244	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MH513985	Mycobacterium phage Tomathan, complete genome	33079-33108	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX758538	Mycobacterium phage Kerberos, complete genome	33079-33108	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_021318	Mycobacterium phage Chy5, complete genome	33495-33524	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NC_021338	Mycobacterium phage Chy4, complete genome	33153-33182	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	22652-22681	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX752698	Mycobacterium phage Tonenili, complete genome	83162-83191	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	MK494087	Mycobacterium phage DBQu4n, complete genome	33079-33108	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX897981	Mycobacterium phage StarStuff, complete genome	33082-33111	9	0.7
NZ_CP049249_1	1.1\|1016854\|30\|NZ_CP049249\|CRT	1016854-1016883	30	KX574455	Mycobacterium phage Pomar16, complete genome	33120-33149	9	0.7
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	445489-445530	9	0.786
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	250069-250098	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	245048-245077	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	295788-295817	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	2049048-2049077	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP018471	Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence	465-494	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP018675	Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence	142007-142036	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032993	Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence	89404-89433	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP032995	Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence	26376-26405	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX518744	Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence	24022-24051	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX518743	Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence	91102-91131	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	121571-121600	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KY401053	Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence	76116-76145	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KY751925	Klebsiella pneumoniae strain M16-13 plasmid pM16-13, complete sequence	103971-104000	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KY019259	Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence	114033-114062	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	101443-101472	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP029493	Escherichia coli strain HS30-1 plasmid pHS30-1, complete sequence	45170-45199	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU665641	Klebsiella pneumoniae strain AO-15200 plasmid pG06-VIM-1, complete sequence	24185-24214	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU743384	Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence	106153-106182	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU950310	Pseudomonas syringae pv. actinidiae strain SR198 plasmid pMG2_SR198, complete sequence	24947-24976	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX009061	Pseudomonas syringae pv. actinidiae strain RT652 plasmid pUR_RT652, complete sequence	6744-6773	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX421096	Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence	117971-118000	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX009059	Pseudomonas syringae pv. actinidiae strain RT685 plasmid pMG1_RT685, complete sequence	124922-124951	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU341381	Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence	114031-114060	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU355873	Escherichia coli strain FAM22871 plasmid pFAM22871_1, complete sequence	131911-131940	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KY019258	Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence	114032-114061	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KT282968	Escherichia coli strain EC012 plasmid pEC012, complete sequence	16600-16629	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX839207	Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence	179471-179500	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KU987453	Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence	85507-85536	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX156773	Escherichia coli strain K-12 plasmid R16a, complete sequence	137711-137740	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KX246266	Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence	91937-91966	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP025455	Salmonella enterica subsp. enterica serovar Agona strain USDA-ARS-USMARC-76334 plasmid pSAG-76334, complete sequence	4195-4224	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP047288	Proteus cibarius strain G11 plasmid p152, complete sequence	44194-44223	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP052795	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence	160990-161019	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KR014106	Aeromonas hydrophila strain WCHAH01 plasmid pKPC2, complete sequence	31061-31090	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KP975076	Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence	6380-6409	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	143569-143598	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KM409652	Escherichia coli strain REL5382 plasmid pB15, complete sequence	4195-4224	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_KT334335	Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence	109736-109765	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_014231	Escherichia coli plasmid pKC394, complete sequence	7137-7166	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_020087	Klebsiella pneumoniae plasmid pK1HV, complete sequence	35446-35475	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	LT221038	Yersinia pseudotuberculosis strain Yps.R2, plasmid pYps.R2 complete sequence	36659-36688	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP010146	Escherichia coli strain D5 plasmid A, complete genome	104876-104905	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP042628	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence	89073-89102	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP021755	Klebsiella pneumoniae strain AR_0113 plasmid unitig_4, complete sequence	42736-42765	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP048042	Serratia liquefaciens strain JL02 plasmid unnamed1, complete sequence	24513-24542	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP011839	Klebsiella pneumoniae strain KP5 plasmid pSg1-NDM, complete sequence	38705-38734	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP010233	Escherichia coli strain S30 plasmid B, complete sequence	33908-33937	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	142739-142768	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP017989	Klebsiella pneumoniae strain 825795-1 plasmid unnamed4, complete sequence	33276-33305	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	KY000037	Agrobacterium sp. strain LBA4404 plasmid pTi_LBA4404, complete sequence	6037-6066	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	102876-102905	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	142770-142799	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP045132	Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence	61648-61677	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP040457	Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence	235385-235414	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	9366-9395	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP038508	Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence	233932-233961	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP018646	Salmonella enterica subsp. enterica serovar Enteritidis strain 79-2359 plasmid pSE79-2359, complete sequence	30365-30394	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP035216	Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence	212405-212434	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	KY075659	Escherichia coli strain GD80 plasmid pGD80-2, complete sequence	87184-87213	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP027184	Acinetobacter baumannii strain AR_0052 plasmid unnamed2, complete sequence	9836-9865	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP027184	Acinetobacter baumannii strain AR_0052 plasmid unnamed2, complete sequence	40236-40265	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP052802	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence	192279-192308	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	101442-101471	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NZ_MN366357	Bacterium plasmid pALTS28, complete sequence	59951-59980	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	NC_009980	Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence	7158-7187	9	0.7
NZ_CP049249_1	1.3\|1016986\|30\|NZ_CP049249\|CRT	1016986-1017015	30	CP033558	Acinetobacter nosocomialis strain 2012C01-137 plasmid p2012C01-137-1, complete sequence	13986-14015	9	0.7
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP053858	Rhizobium pusense strain 76 plasmid pR76, complete sequence	374215-374244	9	0.7
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP025547	Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence	300167-300196	9	0.7
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	MK376956	Gordonia phage WilliamBoone, complete genome	77585-77614	9	0.7
NZ_CP049249_1	1.7\|1017262\|30\|NZ_CP049249\|CRT	1017262-1017291	30	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	969501-969530	10	0.667
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	342801-342842	11	0.738
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	KX640831	Mycobacterium phage Margo, complete genome	33293-33334	11	0.738
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MH020248	Mycobacterium phage Panamaxus, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MN062712	Mycobacterium phage Pocahontas, complete genome	33264-33305	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MG812492	Mycobacterium phage Lambert1, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MK284519	Mycobacterium phage Norbert, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MK524496	Mycobacterium phage Veracruz, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MH976517	Mycobacterium phage Popcicle, complete genome	33264-33305	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	KT326767	Mycobacterium phage Texage, complete genome	33268-33309	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	KM592966	Mycobacterium phage QuinnKiro, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	KX670828	Mycobacterium phage Todacoro, complete genome	33267-33308	12	0.714
NZ_CP049249_1	1.2\|1016914\|42\|NZ_CP049249\|CRT	1016914-1016955	42	MK494127	Mycobacterium phage Noella, complete genome	33268-33309	12	0.714
NZ_CP049249_1	1.4\|1017046\|54\|NZ_CP049249\|CRT	1017046-1017099	54	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1730578-1730631	13	0.759
NZ_CP049249_1	1.4\|1017046\|54\|NZ_CP049249\|CRT	1017046-1017099	54	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	434922-434975	13	0.759

1. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttcccaccgccatt	Protospacer
******************************

2. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttcccaccgccatt	Protospacer
******************************

3. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgttgccgccgccgttgccgccgccgttcccaccgccatt	Protospacer
******************************************

4. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgttgccgccgccgttgccgccgccgttcccaccgccatt	Protospacer
******************************************

5. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccattgccgccgccgtt	Protospacer
******************************

6. spacer 1.4|1017046|54|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccattgccaccgccgttgccaccgccgttaccgccgccattgccgccaccgtt	CRISPR spacer
gccattgccaccgccgttgccaccgccgttaccgccgccattgccgccaccgtt	Protospacer
******************************************************

7. spacer 1.5|1017130|54|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccgttcccaccgccgttaccgccgccgttcccaccgccgttaccgccgccatt	CRISPR spacer
gccgttcccaccgccgttaccgccgccgttcccaccgccgttaccgccgccatt	Protospacer
******************************************************

8. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccaccgttcccaccgccgtt	Protospacer
******************************

9. spacer 1.8|1017322|21|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

accgttgttgctgccgccgtt	CRISPR spacer
accgttgttgctgccgccgtt	Protospacer
*********************

10. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 1, identity: 0.967

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccattcccaccgccatt	Protospacer
***************.**************

11. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccgttgccgccgccgtt	Protospacer
***************.**************

12. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccattgccgccaccgtt	Protospacer
************************.*****

13. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccattgccgccgccatt	Protospacer
***************************.**

14. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccgttgccgccgccgtt	Protospacer
***************.**************

15. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccgtt	Protospacer
************.*****************

16. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccattgccgccgccgtt	Protospacer
.*****************************

17. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccattgccgccgccgtt	Protospacer
.*****************************

18. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccgccaccattgccgccgccgtt	Protospacer
***.**************************

19. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccgccaccattgccgccgccgtt	Protospacer
***.**************************

20. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccgccaccattgccgccgccgtt	Protospacer
***.**************************

21. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccgccaccattgccgccgccgtt	Protospacer
***.**************************

22. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP017105 (Rhizobium gallicum strain IE4872 plasmid pRgalIE4872d, complete sequence) position: , mismatch: 1, identity: 0.967

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccgtt	Protospacer
************.*****************

23. spacer 1.8|1017322|21|NZ_CP049249|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 1, identity: 0.952

accgttgttgctgccgccgtt	CRISPR spacer
gccgttgttgctgccgccgtt	Protospacer
.********************

24. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgttgccgccgccgttcccaccgccgtt	Protospacer
.**************************.**

25. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttcccaccgccgtt	Protospacer
******.********************.**

26. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccattgccgccgccgttgccaccgccatt	Protospacer
***.************** ***********

27. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccgccgccatt	Protospacer
****************** **.********

28. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccgccgccatt	Protospacer
****************** **.********

29. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccaccgccgtt	Protospacer
****************** ********.**

30. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccaccgccgtt	Protospacer
****************** ********.**

31. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccaccgccgttgccaccgccatt	Protospacer
*********.******** ***********

32. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccaccgccgtt	Protospacer
****************** ********.**

33. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgcccccgttaccaccgccatt	Protospacer
************ ***** ***********

34. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.952

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccgccgccattcccaccgccatt	Protospacer
.**************************.**************

35. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccgttgccgccgccgtt	Protospacer
.**************.**************

36. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccaccgtt	Protospacer
************.***********.*****

37. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccaccgccattgccgccgccgtt	Protospacer
*********.**.*****************

38. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accgttgccgccaccattgccgccgccgtt	Protospacer
.**.**************************

39. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccgccaccattgccgccaccgtt	Protospacer
***.********************.*****

40. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccttt	Protospacer
************.************** **

41. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccttt	Protospacer
************.************** **

42. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccgttgccgccgccgtt	Protospacer
************.**.**************

43. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccaccattgccgccaccatt	Protospacer
************************.**.**

44. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccatt	Protospacer
************.**************.**

45. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccaccgttgccgccgccgtt	Protospacer
****************** **.********

46. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccaccgttgccaccgccatt	Protospacer
****************** ********.**

47. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccaccgttgccgccgccgtt	Protospacer
****************** **.********

48. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccgccgttgccaccgccgtt	Protospacer
************.***** ***********

49. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccgttgccgccaccgttgccaccgccgtt	Protospacer
***.************** ***********

50. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 2, identity: 0.933

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccgttgccgccaccgttgccaccgccgtt	Protospacer
***.************** ***********

51. spacer 1.8|1017322|21|NZ_CP049249|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 2, identity: 0.905

accgttgttgctgccgccgtt	CRISPR spacer
gacgttgttgctgccgccgtt	Protospacer
. *******************

52. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP033036 (Agrobacterium fabrum strain 12D13 plasmid pAt12D13a, complete sequence) position: , mismatch: 3, identity: 0.9

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
cccgttgccgccgccgttcccaccaccgtt	Protospacer
 ***********************.**.**

53. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 3, identity: 0.929

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccaccgccgttgccaccgccatt	Protospacer
.********************.******** ***********

54. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 3, identity: 0.929

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccgccgccgttgccgccgccatt	Protospacer
.***************************** **.********

55. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccgccgttgccgccgccgtt	Protospacer
.***********.**.**************

56. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgccgccgcc	Protospacer
************.***************..

57. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccattgccgccaccatt	Protospacer
.***********************.**.**

58. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_012853 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132503, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ggaattgccgccaccattgccgccgctgtt	Protospacer
*  ***********************.***

59. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattaccgccgccgct	Protospacer
************.*****.*********.*

60. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP036360 (Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattaccgccgccgct	Protospacer
************.*****.*********.*

61. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
accattgccgccaccgttgccgccgccgtt	Protospacer
.***************** **.********

62. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.9

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
accgttgccgccgccgttcccaccgccgtt	Protospacer
.**.********.*****************

63. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_048792 (Serratia phage Moabite, complete genome) position: , mismatch: 4, identity: 0.867

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gctattgccgccgccgttaccaccaccatt	Protospacer
**..************** *****.*****

64. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 4, identity: 0.867

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccgttgccgccgctatt	Protospacer
.**************.**********..**

65. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 4, identity: 0.867

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgttgccaccaccattgccgccgccgcc	Protospacer
***.*****.******************..

66. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP022264 (Xanthomonas citri pv. vignicola strain CFBP7111 plasmid plA, complete sequence) position: , mismatch: 4, identity: 0.867

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accactgccgccaccactgccgccgccgct	Protospacer
.***.***********.***********.*

67. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_042036 (Mycobacterium phage Rockstar, complete genome) position: , mismatch: 4, identity: 0.867

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctggccgccaccgttgccaccgccgtt	Protospacer
**  * ************ ***********

68. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.833

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccaccgccgttgccaccgccgcc	Protospacer
*********.******** ********...

69. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP015030 (Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence) position: , mismatch: 5, identity: 0.833

gccgttgccgccgccgttcccac-cgccatt	CRISPR spacer
gccgttgccgccgcagttcccgcgcaccgt-	Protospacer
************** ******.* *.**.*

70. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.833

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accgttgccgccgccattgccgccgccgcc	Protospacer
.**.********.***************..

71. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 5, identity: 0.833

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccatggccgccaccattgccaccgccacc	Protospacer
***** ***************.*****...

72. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP014276 (Martelella sp. AD-3 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gctcttgccgcaaccattgccgccgacgat	Protospacer
**. ******* ************* ** *

73. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MT270409 (Phaeobacter phage MD18, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gcctccgccgccacccttgccgccgccggt	Protospacer
*** ..********* ************ *

74. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_042036 (Mycobacterium phage Rockstar, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gcgctggccgccaccgttgccaccgccgtt	Protospacer
**  * *********.*****.********

75. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
accattgccgccaccgttgccgccgctatt	Protospacer
.***************** **.****..**

76. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MH047632 (Mycobacterium phage Puppy, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

77. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MT310878 (Mycobacterium phage MK4, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

78. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MH047633 (Mycobacterium phage Pistachio, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

79. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MH051259 (Mycobacterium phage TNguyen7, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

80. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to KY464936 (Mycobacterium phage Idleandcovert, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

81. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MT310881 (Mycobacterium phage JF2, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

82. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MN586063 (Mycobacterium phage Isca, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

83. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to KC172839 (Mycobacterium phage BTCU-1, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

84. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to AP018485 (Mycobacterium phage B1 DNA, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

85. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MT310880 (Mycobacterium phage JF4, complete genome) position: , mismatch: 5, identity: 0.833

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccgccgtt	Protospacer
**  * .*********** ***********

86. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgttgccgccgccgttgccgccgccgcc	Protospacer
.***************** **.*****...

87. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgttgccgccgccgttgccgccgccgcc	Protospacer
.***************** **.*****...

88. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accgccaccgccgccgttgccgccgccatt	Protospacer
.***...*********** **.********

89. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
accggaaccgccgccgttgccaccaccatt	Protospacer
.***  .*********** *****.*****

90. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX640831 (Mycobacterium phage Margo, complete genome) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgctggc	Protospacer
******.*********** *******.. .

91. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP024587 (Roseomonas sp. FDAARGOS_362 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
aacgttgccgccgccgtgaccaccgccctc	Protospacer
. ***************  ******** *.

92. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccagcgccgccgccgttcccgccgccagg	Protospacer
***. .***************.******

93. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgcccttcccgtcgagatc	Protospacer
*************** *****..**  **.

94. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattaccgccaccattaccgccatcatt	Protospacer
.*****.***********.*****..*.**

95. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattaccgccaccattaccgccatcatt	Protospacer
.*****.***********.*****..*.**

96. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccgccgccgccaccatggccgccgccgcc	Protospacer
***...*********** **********..

97. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgcccttggc	Protospacer
************.*********** ..* .

98. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccaccattctt	Protospacer
************.********.**... **

99. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MN234179 (Gordonia phage Pipp, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cacatcgccgccaccattgccgccgcccac	Protospacer
  ***.*********************  .

100. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF185718 (Arthrobacter phage Colucci, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccccgaa	Protospacer
 .****** *************** ***

101. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccggcaccattgccggagctttg	Protospacer
********** ***********  **. *

102. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gaaatcgccaccaccattgccgccgccatc	Protospacer
*  **.***.*****************.*.

103. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP018442 (Undibacterium sp. YM2 plasmid pUYM01, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccaatggcgccaccattgccgccacacct	Protospacer
**** ** ****************.*  .*

104. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to LR743530 (Xanthomonas phage Suba genome assembly, chromosome: 1) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccgttaccgccggtatt	Protospacer
.**************.**.****** ..**

105. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP042825 (Rhizobium sp. WL3 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccatcgccgccaccatttccgcgccactt	Protospacer
*****.************ ****  *  **

106. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccggaaccgccgccgttgccaccgccgtt	Protospacer
***.  .*****.***** ***********

107. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to LR743530 (Xanthomonas phage Suba genome assembly, chromosome: 1) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
accattgccgccaccgttaccgccggtatt	Protospacer
.***************** **.*** ..**

108. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP024444 (Moraxella osloensis strain NP7 plasmid pNP7-1, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccaccaccgttgccaccttcgcc	Protospacer
*********.******** ***** .**..

109. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP040258 (Moraxella osloensis strain MOXF1 plasmid pMOXF1, complete sequence) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccaccaccgttgccaccttcgcc	Protospacer
*********.******** ***** .**..

110. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MT897909 (Mycobacterium phage Maru, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ggctttgacgccaccgttcgcaccgccgcc	Protospacer
* * *** *********** ********..

111. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to KP027208 (Mycobacterium phage Pipsqueak, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ggctttgacgccaccgttcgcaccgccgcc	Protospacer
* * *** *********** ********..

112. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MG925350 (Mycobacterium phage Mosaic, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ggctttgacgccaccgttcgcaccgccgcc	Protospacer
* * *** *********** ********..

113. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to KX758539 (Mycobacterium phage Jaan, complete genome) position: , mismatch: 6, identity: 0.8

gccattg-ccgccaccgttcccaccgccgtt	CRISPR spacer
-ctgctgaccgccaccgttaccgccgccgtt	Protospacer
 *...** *********** **.********

114. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MN062706 (Mycobacterium phage Heathen, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccaccgtt	Protospacer
**  * .*********** *****.*****

115. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to EU744250 (Mycobacterium virus Pukovnik, complete genome) position: , mismatch: 6, identity: 0.8

gccattg-ccgccaccgttcccaccgccgtt	CRISPR spacer
-ctgctgaccgccaccgttaccgccgccgtt	Protospacer
 *...** *********** **.********

116. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_042328 (Mycobacterium virus HelDan, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccaccgtt	Protospacer
**  * .*********** *****.*****

117. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_031279 (Mycobacterium phage Bactobuster, complete genome) position: , mismatch: 6, identity: 0.8

gccattg-ccgccaccgttcccaccgccgtt	CRISPR spacer
-ctgctgaccgccaccgttaccgccgccgtt	Protospacer
 *...** *********** **.********

118. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MF373840 (Mycobacterium phage Fred313, complete genome) position: , mismatch: 6, identity: 0.8

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gcgctgaccgccaccgttgccaccaccgtt	Protospacer
**  * .*********** *****.*****

119. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP049249 (Rhizobium rhizoryzae strain DSM 29514 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgctgttgccaccgtttcc	Protospacer
**************.*** ******.. ..

120. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccacgccggcc	Protospacer
****************** ****  * ...

121. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MH020248 (Mycobacterium phage Panamaxus, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

122. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MN062712 (Mycobacterium phage Pocahontas, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

123. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MG812492 (Mycobacterium phage Lambert1, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

124. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MK284519 (Mycobacterium phage Norbert, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

125. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MK524496 (Mycobacterium phage Veracruz, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

126. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MH976517 (Mycobacterium phage Popcicle, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

127. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KT326767 (Mycobacterium phage Texage, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

128. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KM592966 (Mycobacterium phage QuinnKiro, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

129. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX670828 (Mycobacterium phage Todacoro, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

130. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MK494127 (Mycobacterium phage Noella, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttaccgccgccgttgccaccgttggc	Protospacer
******.*********** ******... .

131. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gacagcgccgccgccgttcccgccgccagg	Protospacer
* *. .***************.******

132. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gtggttgccgccgccgcccccaccgccgcc	Protospacer
*. *************..*********...

133. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gtggttgccgccgccgcccccaccgccgcc	Protospacer
*. *************..*********...

134. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gacagcgccgccgccgttcccgccgccagg	Protospacer
* *. .***************.******

135. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP022369 (Azospirillum sp. TSH58 plasmid TSH58_p05, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gacagcgccgccgccgttcccgccgccagg	Protospacer
* *. .***************.******

136. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MT104474 (Pseudomonas phage MR14, complete genome) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgcagccgttgccaccacgcac	Protospacer
*********** ****** *****.*   .

137. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP038031 (Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgtcgccgccgccgctcccacggactgc	Protospacer
*****.**********.****** * *  .

138. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcattgctgccaccactgccgccgttgct	Protospacer
  ******.*******.********..*.*

139. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcattgctgccaccactgccgccgttgct	Protospacer
  ******.*******.********..*.*

140. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
atgaccgccgccgccgttgccgccgccgtt	Protospacer
.. *..******.**.**************

141. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accggaaccgccgccgttgccgccgccgtt	Protospacer
.**.  .*****.**.**************

142. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accggaaccgccgccgttgccgccgccgtt	Protospacer
.**.  .*****.**.**************

143. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgcttttggc	Protospacer
************.**********. ..* .

144. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MH319761 (Marine virus AG-345-O18 Ga0172273_15 genomic sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gtttccaccgccaccattgccgccaccgtt	Protospacer
*.. ...*****************.*****

145. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ccaggggccgccgccattgccgccgcggtt	Protospacer
 * .  ******.************* ***

146. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccgttgccgccattgcc	Protospacer
************.**.********...*..

147. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to KX855962 (Arthrobacter phage HumptyDumpty, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

148. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF185721 (Arthrobacter phage Kabreeze, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

149. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF185723 (Arthrobacter phage RosiePosie, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

150. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF668274 (Arthrobacter phage JayCookie, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

151. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MK494107 (Arthrobacter phage Chipper1996, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

152. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF185724 (Arthrobacter phage Scavito, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

153. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MN204499 (Arthrobacter phage Mordred, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

154. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MF185725 (Arthrobacter phage Tophat, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcattgcggccaccattgccgcccctgaa	Protospacer
 .****** *************** *.*

155. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MG765278 (Lactobacillus phage Silenus, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gttattgccgccaccaatgccgccggaagt	Protospacer
*..************* ********  . *

156. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to MH809528 (Lactobacillus phage Sabazios, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gttattgccgccaccaatgccgccggaagt	Protospacer
*..************* ********  . *

157. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gacggacccgccaaccttgccgccgccgtt	Protospacer
* *.   ****** * **************

158. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to KX683423 (Mycobacterium phage BabyRay, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ctgaccgccaccaccgttgccaccgccgtt	Protospacer
 . *..***.******** ***********

159. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccgcctcccccaccgttcccaccgccgcg	Protospacer
***... ** ******************.

160. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccaccgctgccacgccccaa	Protospacer
****************.* ****  **

161. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MN159079 (Aeromonas phage D9, partial genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gttaccaccgccaccgttaccaccaccgtt	Protospacer
*..*...*********** *****.*****

162. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MN102098 (Aeromonas phage D3, complete genome) position: , mismatch: 7, identity: 0.767

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gttaccaccgccaccgttaccaccaccgtt	Protospacer
*..*...*********** *****.*****

163. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttaccgccgccgccgttgccgccgccatg	Protospacer
*.....************ **.*******

164. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP023550 (Rhodobacter sp. CZR27 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
cgcccccccgccgccgttcccgccgccatc	Protospacer
  * .. **************.*******.

165. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

166. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

167. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

168. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

169. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

170. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

171. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

172. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

173. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccgttgcc	Protospacer
*..*************** ******.....

174. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
cccgccgccgccgccgttcccaccgggcag	Protospacer
 ***..*******************

175. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctcgcgctcgccgccgttcccagcgccatc	Protospacer
 .**.  .************** ******.

176. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
tgcgggttcgccgccattcccaccgccatg	Protospacer
  **   .*******.*************

177. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP046254 (Sphingobium sp. CAP-1 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
tgcgggatcgccgccattcccaccgccatg	Protospacer
  **  ..*******.*************

178. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
tgcgggatcgccgccattcccaccgccatg	Protospacer
  **  ..*******.*************

179. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KU998238 (Gordonia phage Splinter, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccccggttcga	Protospacer
****************** ** * *..

180. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_048789 (Corynebacterium phage Stiles, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gatcgcgccgccgccgttgccaccgcccat	Protospacer
* .  .************ ********  *

181. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_030911 (Gordonia phage Vendetta, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccccggttcga	Protospacer
****************** ** * *..

182. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP013419 (Burkholderia sp. MSMB0266 plasmid pMSMB0266, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
cgtgctgccgccgccgtcgccaccgccacc	Protospacer
  .*.************. *********..

183. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP041018 (Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
tgcgggatcgccgccattcccaccgccatg	Protospacer
  **  ..*******.*************

184. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to CP042595 (Streptomyces albogriseolus strain LBX-2 plasmid pSALBX2, complete sequence) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ccctgcaccgccgccgtgcccaccgccacc	Protospacer
 **  ..********** **********..

185. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_041912 (Aquamicrobium phage P14, complete genome) position: , mismatch: 8, identity: 0.733

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccggtgccgccgccgatcccacggaaggc	Protospacer
**** *********** ****** *  . .

186. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_LR723676 (Rhizobium sp. TCK plasmid 2) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gcaattgccgccgccattgccgcctttccg	Protospacer
** *********.*********** .. .

187. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgctttttgc	Protospacer
************.**********. ..  .

188. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
accattgccgccaccgtttccgcccttggc	Protospacer
.**************.** ***** ..* .

189. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
tgatttgccggcaccattgccgccgacgag	Protospacer
    ****** ************** **

190. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP028919 (Gemmobacter sp. HYN0069 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ttatttgccgccacgattgccgccgcccga	Protospacer
 .  ********** ************

191. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ttagtgaccgccaccgtttccgccgccgtt	Protospacer
 . .* .********.** ***********

192. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP022767 (Ralstonia solanacearum strain T78 plasmid pRsT78, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

193. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ttagtgaccgccaccgtttccgccgccgtt	Protospacer
 . .* .********.** ***********

194. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

195. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gaggctgccgccaccctcgccgccgccgcc	Protospacer
*  ..********** *.**********..

196. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ctcgccaccgccaccatggccgccgccgtc	Protospacer
 .*....********** ***********.

197. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

198. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP005085 (Sphingobium sp. TKS plasmid pTK1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gatcgtgccgccgccattaccgccgccgcc	Protospacer
* .  *******.*****.*********..

199. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP031358 (Erythrobacter aureus strain YH-07 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gttgccaccgccggcattgccgccgccgtt	Protospacer
*......*****. ****************

200. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

201. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

202. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
gccattgccgccgccattgccgttgtttcc	Protospacer
************.*********..*.. ..

203. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
ttttcggccggcaccattgccgctgccgtt	Protospacer
 .. . **** ************.******

204. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

205. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

206. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

207. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
caggatgccgcgagcattgccgccgccgta	Protospacer
   . ****** * ***************

208. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to KU197014 (Xanthomonas phage XAJ2, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
tgtgccgccgccacctttgccgccgccttt	Protospacer
  ....********* *********** **

209. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KP792123 (Escherichia coli strain MG1655 YFP plasmid ESBL242, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cccattgccgccactattgccgttgatctc	Protospacer
 *************.*******..* . *.

210. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gttaccaccgccaccgttaccaccgccgcc	Protospacer
*..*...*********** *********..

211. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ttagtgaccgccaccgtttccgccgccgtt	Protospacer
 . .* .***********.**.********

212. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
ttagtgaccgccaccgtttccgccgccgtt	Protospacer
 . .* .***********.**.********

213. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
accattgccgccaccgtttccgcccttggc	Protospacer
.*****************.**.** ..* .

214. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MN131137 (Aeromonas phage D6, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gttgccaccgccaccgttgccaccaccgtt	Protospacer
*......*********** *****.*****

215. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_048780 (Corynebacterium phage StAB, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

216. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MK977706 (Corynebacterium phage Dina, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

217. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MH926061 (Corynebacterium phage Troy, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

218. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_048791 (Corynebacterium phage Adelaide, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

219. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_048069 (Corynebacterium phage SamW, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

220. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NC_048790 (Corynebacterium phage Lederberg, complete genome) position: , mismatch: 8, identity: 0.733

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gatcgcgccgccaccgttgccaccgcccat	Protospacer
* .  .************ ********  *

221. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccaccgccgttcccgtccttcgc	Protospacer
*********.***********..* ..  .

222. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccattgccgccgccgttcccgtccttcgc	Protospacer
***.*****************..* ..  .

223. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MH513985 (Mycobacterium phage Tomathan, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctgaccgccgccgccgttaccaccgccacc	Protospacer
 . ...************ *********..

224. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX758538 (Mycobacterium phage Kerberos, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctgaccgccgccgccgttaccaccgccacc	Protospacer
 . ...************ *********..

225. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_021318 (Mycobacterium phage Chy5, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctgaccgccgccgccgttaccaccgccacc	Protospacer
 . ...************ *********..

226. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NC_021338 (Mycobacterium phage Chy4, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctgaccgccgccgccgttaccaccgccacc	Protospacer
 . ...************ *********..

227. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
atgcccgccgccgccgtccccacccccatc	Protospacer
..  ..***********.****** ****.

228. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gttgttgccgccgccgttgccaccattgcc	Protospacer
*..*************** *****......

229. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to MK494087 (Mycobacterium phage DBQu4n, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctggccaccgccgccgttaccaccgccacc	Protospacer
 . *...*********** *********..

230. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX897981 (Mycobacterium phage StarStuff, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctggccaccgccgccgttaccaccgccacc	Protospacer
 . *...*********** *********..

231. spacer 1.1|1016854|30|NZ_CP049249|CRT matches to KX574455 (Mycobacterium phage Pomar16, complete genome) position: , mismatch: 9, identity: 0.7

gccgttgccgccgccgttcccaccgccatt	CRISPR spacer
ctggccaccgccgccgttaccaccgccacc	Protospacer
 . *...*********** *********..

232. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 9, identity: 0.786

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccgttgccgccgccgttgccaccgccgttgccgttgccgcc	Protospacer
.********************.******** **...***...

233. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
tccattgccgccgccatttccgccctttgc	Protospacer
 ***********.***** ***** ..  .

234. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
tccattgccgccgccatttccgccctttgc	Protospacer
 ***********.***** ***** ..  .

235. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
aggagaaccgccaccaatgccgccgccgca	Protospacer
.  *  .********* ***********.

236. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
aggagaaccgccaccaatgccgccgccgca	Protospacer
.  *  .********* ***********.

237. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP018471 (Xanthomonas vesicatoria strain LM159 plasmid pLM159.2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

238. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP018675 (Klebsiella pneumoniae strain CAV1217 plasmid pKPC_CAV1217, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

239. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032993 (Escherichia coli strain W5-6 plasmid pMCR_W5-6, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

240. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP032995 (Escherichia coli strain W5-6 plasmid p3_W5-6, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

241. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX518744 (Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

242. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX518743 (Escherichia coli strain HYEC7 plasmid pHYEC7-IncHI2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

243. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

244. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KY401053 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE380 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

245. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KY751925 (Klebsiella pneumoniae strain M16-13 plasmid pM16-13, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

246. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KY019259 (Escherichia coli strain YJMC8 plasmid pHNYJC8, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

247. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

248. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP029493 (Escherichia coli strain HS30-1 plasmid pHS30-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

249. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU665641 (Klebsiella pneumoniae strain AO-15200 plasmid pG06-VIM-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

250. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU743384 (Escherichia coli strain SA26 plasmid pSA26-MCR-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

251. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU950310 (Pseudomonas syringae pv. actinidiae strain SR198 plasmid pMG2_SR198, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

252. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX009061 (Pseudomonas syringae pv. actinidiae strain RT652 plasmid pUR_RT652, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

253. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX421096 (Salmonella enterica subsp. enterica serovar Indiana strain A3 plasmid pA3T, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

254. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX009059 (Pseudomonas syringae pv. actinidiae strain RT685 plasmid pMG1_RT685, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

255. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU341381 (Escherichia coli strain SHP45 plasmid pHNSHP45-2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

256. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU355873 (Escherichia coli strain FAM22871 plasmid pFAM22871_1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

257. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KY019258 (Escherichia coli strain LDHF400 plasmid pHNLDF400, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

258. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KT282968 (Escherichia coli strain EC012 plasmid pEC012, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

259. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX839207 (Klebsiella pneumoniae strain KP1814 plasmid pKP1814-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

260. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KU987453 (Klebsiella pneumoniae strain 05K0261 plasmid F5111, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

261. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX156773 (Escherichia coli strain K-12 plasmid R16a, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

262. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KX246266 (Escherichia coli strain AHCH67 plasmid pHNAH67, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

263. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP025455 (Salmonella enterica subsp. enterica serovar Agona strain USDA-ARS-USMARC-76334 plasmid pSAG-76334, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

264. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP047288 (Proteus cibarius strain G11 plasmid p152, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

265. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP052795 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

266. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KR014106 (Aeromonas hydrophila strain WCHAH01 plasmid pKPC2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

267. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KP975076 (Pseudomonas aeruginosa strain MRSN17623 plasmid pMRVIM0713, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

268. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

269. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KM409652 (Escherichia coli strain REL5382 plasmid pB15, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

270. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_KT334335 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST06-53 plasmid pHK0653, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

271. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_014231 (Escherichia coli plasmid pKC394, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

272. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_020087 (Klebsiella pneumoniae plasmid pK1HV, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

273. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to LT221038 (Yersinia pseudotuberculosis strain Yps.R2, plasmid pYps.R2 complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

274. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP010146 (Escherichia coli strain D5 plasmid A, complete genome) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

275. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP042628 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-1_MCR3, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

276. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP021755 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_4, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

277. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP048042 (Serratia liquefaciens strain JL02 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

278. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP011839 (Klebsiella pneumoniae strain KP5 plasmid pSg1-NDM, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

279. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP010233 (Escherichia coli strain S30 plasmid B, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

280. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

281. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP017989 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

282. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to KY000037 (Agrobacterium sp. strain LBA4404 plasmid pTi_LBA4404, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

283. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

284. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

285. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP045132 (Acinetobacter indicus strain TQ18 plasmid p18TQ-X3, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

286. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP040457 (Salmonella enterica subsp. enterica serovar Typhimurium strain TJWQ005 plasmid pTJWQ005, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

287. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

288. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP038508 (Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

289. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP018646 (Salmonella enterica subsp. enterica serovar Enteritidis strain 79-2359 plasmid pSE79-2359, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

290. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP035216 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-B, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

291. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to KY075659 (Escherichia coli strain GD80 plasmid pGD80-2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

292. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP027184 (Acinetobacter baumannii strain AR_0052 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

293. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP027184 (Acinetobacter baumannii strain AR_0052 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

294. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP052802 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

295. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

296. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NZ_MN366357 (Bacterium plasmid pALTS28, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

297. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to NC_009980 (Salmonella enterica subsp. enterica serovar Dublin plasmid pMAK2, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

298. spacer 1.3|1016986|30|NZ_CP049249|CRT matches to CP033558 (Acinetobacter nosocomialis strain 2012C01-137 plasmid p2012C01-137-1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccattgccgccgccgtt	CRISPR spacer
cgcatcgccgccaccattgctgccgggacc	Protospacer
  ***.**************.****  ...

299. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP053858 (Rhizobium pusense strain 76 plasmid pR76, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgccgccgttcccgtccttcgc	Protospacer
************.********..* ..  .

300. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP025547 (Mycobacterium paragordonae strain 49061 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gtgtcgcccgccaccgtttccaccgccgcc	Protospacer
*.  .  ***********.*********..

301. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to MK376956 (Gordonia phage WilliamBoone, complete genome) position: , mismatch: 9, identity: 0.7

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgctgccaccgttgccactcgatcc	Protospacer
********.********* ****.    ..

302. spacer 1.7|1017262|30|NZ_CP049249|CRT matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 10, identity: 0.667

gccattgccgccaccgttcccaccgccgtt	CRISPR spacer
gccattgccgcgaccgttcccgttatgaaa	Protospacer
*********** *********..... .

303. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 11, identity: 0.738

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccattgccgccgccgttgccaccgccgttcccgtccttcgc	Protospacer
.**.*****************.***********..* ..  .

304. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to KX640831 (Mycobacterium phage Margo, complete genome) position: , mismatch: 11, identity: 0.738

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgctggc	Protospacer
.**....***********.*********** *******.. .

305. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MH020248 (Mycobacterium phage Panamaxus, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

306. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MN062712 (Mycobacterium phage Pocahontas, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

307. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MG812492 (Mycobacterium phage Lambert1, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

308. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MK284519 (Mycobacterium phage Norbert, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

309. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MK524496 (Mycobacterium phage Veracruz, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

310. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MH976517 (Mycobacterium phage Popcicle, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

311. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to KT326767 (Mycobacterium phage Texage, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

312. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to KM592966 (Mycobacterium phage QuinnKiro, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

313. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to KX670828 (Mycobacterium phage Todacoro, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

314. spacer 1.2|1016914|42|NZ_CP049249|CRT matches to MK494127 (Mycobacterium phage Noella, complete genome) position: , mismatch: 12, identity: 0.714

accgttgccgccgccgttgccgccgccgttcccaccgccatt	CRISPR spacer
gccaccaccgccgccgttaccgccgccgttgccaccgttggc	Protospacer
.**....***********.*********** ******... .

315. spacer 1.4|1017046|54|NZ_CP049249|CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 13, identity: 0.759

gccattgccaccgccgttgccaccgccgttaccgccgccattgccgccaccgtt	CRISPR spacer
gccattgccaccaccgttgcccccgccgttaccgccgccgccaccattgccacc	Protospacer
************.******** *****************....**....**...

316. spacer 1.4|1017046|54|NZ_CP049249|CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 13, identity: 0.759

gccattgccaccgccgttgccaccgccgttaccgccgccattgccgccaccgtt	CRISPR spacer
gccattgccaccaccgttgcccccgccgttaccgccgccgccaccattgccacc	Protospacer
************.******** *****************....**....**...

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP049247

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2878 : 48520

Aurantimonas_phage(34.29%)

portal,tail,terminase,capsid,plate,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165130319.1\|2878_4165_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	G9E4Q1	Emiliania_huxleyi_virus	7.9e-40	29.3
WP_165130320.1\|4631_4871_+	hypothetical protein	A0A076G7I4	Sinorhizobium_phage	4.7e-07	48.9
WP_165130321.1\|5063_5747_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	2.0e-34	39.9
WP_165130322.1\|5743_6094_+	hypothetical protein	NA	NA	NA	NA
WP_165130323.1\|6306_6507_+	hypothetical protein	A0A291AUQ4	Sinorhizobium_phage	1.1e-09	59.6
WP_165130324.1\|6861_7572_+	SOS response-associated peptidase	A0A291AUP1	Sinorhizobium_phage	3.2e-43	43.3
WP_165130325.1\|7583_7820_+	hypothetical protein	NA	NA	NA	NA
WP_165130326.1\|7905_8742_-	DNA adenine methylase	A0A291AUP9	Sinorhizobium_phage	1.3e-123	77.5
WP_165130327.1\|9008_9263_+	hypothetical protein	NA	NA	NA	NA
WP_165130328.1\|9253_9583_+	BrnA antitoxin family protein	NA	NA	NA	NA
WP_165130329.1\|9626_9953_-	hypothetical protein	A0A291AUN9	Sinorhizobium_phage	1.3e-28	55.2
WP_165130330.1\|10236_10656_-	hypothetical protein	NA	NA	NA	NA
WP_165130331.1\|10655_11240_-	lysozyme	L7TM06	Rhizobium_phage	8.2e-37	45.9
WP_165130332.1\|11226_11442_-	hypothetical protein	L7TNZ5	Rhizobium_phage	4.0e-05	46.2
WP_165130333.1\|11544_12492_+	DUF4214 domain-containing protein	NA	NA	NA	NA
WP_165130334.1\|12599_13634_-	late control D family protein	A0A0A8ILC1	Aurantimonas_phage	4.1e-71	43.7
WP_165130335.1\|13636_13861_-\|tail	phage tail protein	A0A0A8IL62	Aurantimonas_phage	6.4e-06	38.6
WP_165130336.1\|13860_14304_-\|tail	phage tail protein	A0A0A8IL04	Aurantimonas_phage	1.2e-27	44.8
WP_165130337.1\|14338_16471_-\|tail	phage tail tape measure protein	A0A068C997	Rhizobium_phage	6.9e-65	37.2
WP_165130338.1\|16475_16853_-	hypothetical protein	NA	NA	NA	NA
WP_165130339.1\|16904_17414_-	hypothetical protein	NA	NA	NA	NA
WP_165130340.1\|17475_18711_-\|tail	phage tail protein	A0A0A8IL59	Aurantimonas_phage	8.7e-121	56.4
WP_165130341.1\|18812_19037_-	hypothetical protein	NA	NA	NA	NA
WP_165130342.1\|19186_19654_-	hypothetical protein	A0A1Y0SVH3	Sinorhizobium_phage	4.4e-09	34.6
WP_165130343.1\|19650_20637_-	hypothetical protein	NA	NA	NA	NA
WP_165130344.1\|20636_21371_-	hypothetical protein	NA	NA	NA	NA
WP_165130345.1\|21339_21540_-	hypothetical protein	NA	NA	NA	NA
WP_165130346.1\|21549_23838_-	hypothetical protein	A0A0A8ILB4	Aurantimonas_phage	2.0e-131	37.5
WP_165130347.1\|23834_24494_-\|tail	phage tail protein I	A0A0A8IL57	Aurantimonas_phage	1.0e-27	35.5
WP_165130348.1\|24735_25680_-\|plate	baseplate assembly protein	A0A0A8IKZ9	Aurantimonas_phage	4.5e-85	55.7
WP_165130349.1\|25676_26066_-	hypothetical protein	A0A0A8IN57	Aurantimonas_phage	2.2e-25	49.2
WP_165130350.1\|26052_26247_-	hypothetical protein	NA	NA	NA	NA
WP_165130351.1\|26276_26798_-\|plate	baseplate assembly protein	A0A0A8IL55	Aurantimonas_phage	3.8e-41	62.7
WP_165130354.1\|26787_27576_-	hypothetical protein	NA	NA	NA	NA
WP_165130356.1\|27579_27963_-	hypothetical protein	NA	NA	NA	NA
WP_165130358.1\|27969_28449_-	hypothetical protein	NA	NA	NA	NA
WP_165130360.1\|28562_29570_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.0e-55	40.7
WP_165130362.1\|29583_29967_-\|head	head decoration protein	A0A0A8IL52	Aurantimonas_phage	1.5e-10	40.6
WP_165130364.1\|29970_30555_-	hypothetical protein	NA	NA	NA	NA
WP_165130366.1\|30559_31480_-	S49 family peptidase	A0A068CE01	Rhizobium_phage	5.5e-104	61.2
WP_165130368.1\|31489_31759_-	hypothetical protein	NA	NA	NA	NA
WP_165130370.1\|31765_33400_-\|portal	phage portal protein	R9TN54	Rhizobium_phage	2.3e-225	71.2
WP_165130372.1\|33396_35364_-\|terminase	terminase	A0A291AUK9	Sinorhizobium_phage	5.6e-170	46.3
WP_165130374.1\|35365_36019_-	hypothetical protein	A0A291AUL0	Sinorhizobium_phage	1.2e-17	33.6
WP_165130419.1\|36240_36852_-	hypothetical protein	A0A0A8IL87	Aurantimonas_phage	2.5e-44	49.5
WP_165130376.1\|37058_37826_-	hypothetical protein	R9TRT9	Rhizobium_phage	7.0e-52	41.1
WP_165130378.1\|38141_39941_-	DNA primase	G8DGC0	Emiliania_huxleyi_virus	7.6e-57	32.5
WP_165130380.1\|39942_41301_-	P4 alpha zinc-binding domain-containing protein	R9TNC4	Rhizobium_phage	2.4e-95	47.3
WP_165130382.1\|41515_42061_-	3'-5' exoribonuclease	A0A2I7R2S7	Vibrio_phage	4.5e-29	38.7
WP_165130384.1\|42060_42399_-	hypothetical protein	NA	NA	NA	NA
WP_165130386.1\|43568_45014_-	hypothetical protein	A0A291AUK6	Sinorhizobium_phage	2.7e-129	52.2
WP_165130388.1\|45010_45220_-	hypothetical protein	NA	NA	NA	NA
WP_165130390.1\|45216_45732_-	hypothetical protein	NA	NA	NA	NA
WP_165130392.1\|45728_46151_-	hypothetical protein	R9TNB9	Rhizobium_phage	4.9e-07	32.1
WP_165130394.1\|46150_46348_-	hypothetical protein	NA	NA	NA	NA
WP_165130404.1\|46585_47080_-	hypothetical protein	A0A291AUJ7	Sinorhizobium_phage	8.8e-32	46.0
WP_165130421.1\|47833_48520_+	helix-turn-helix domain-containing protein	R9TRS6	Rhizobium_phage	3.6e-68	55.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP049252

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 21342

Sinorhizobium_phage(41.67%)

protease,capsid,head,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165137681.1\|4068_4293_-	hypothetical protein	NA	NA	NA	NA
WP_165137684.1\|4436_4895_-	hypothetical protein	NA	NA	NA	NA
WP_165137687.1\|4977_5280_-	hypothetical protein	NA	NA	NA	NA
WP_165137690.1\|5282_6473_-	hypothetical protein	NA	NA	NA	NA
WP_165137692.1\|6571_7051_-	hypothetical protein	NA	NA	NA	NA
WP_165137694.1\|7053_7635_-	hypothetical protein	B0VK42	Azospirillum_phage	5.3e-12	34.6
WP_165137696.1\|7634_7961_-	hypothetical protein	NA	NA	NA	NA
WP_165137698.1\|7957_8551_-	hypothetical protein	NA	NA	NA	NA
WP_165137675.1\|8554_9064_-	hypothetical protein	A0A0U2BXC8	Paracoccus_phage	1.1e-05	52.5
WP_165137700.1\|9125_10412_-\|capsid	phage major capsid protein	A0A2H4JD98	uncultured_Caudovirales_phage	7.5e-107	55.2
WP_165137702.1\|10431_11097_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	3.5e-60	52.9
WP_165137789.1\|11093_12215_-\|portal	phage portal protein	A0A0U2BXP2	Paracoccus_phage	1.1e-111	56.6
WP_165137704.1\|12334_14167_-\|terminase	terminase large subunit	A0A0U2C138	Paracoccus_phage	9.2e-143	49.2
WP_165137706.1\|14126_14588_-\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA
WP_165137708.1\|15258_15894_-	hypothetical protein	A0A068C9G5	Rhizobium_phage	2.7e-25	38.9
WP_165137710.1\|15883_17104_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_165137713.1\|17137_17416_-	hypothetical protein	A0A291AUT2	Sinorhizobium_phage	2.7e-06	40.4
WP_165137716.1\|17412_17964_-	hypothetical protein	A0A291AUS3	Sinorhizobium_phage	3.3e-19	36.4
WP_165137719.1\|17960_18620_-	hypothetical protein	A0A291AUT5	Sinorhizobium_phage	3.0e-104	79.0
WP_165137722.1\|18603_20034_-	hypothetical protein	A0A291AUK6	Sinorhizobium_phage	3.3e-132	54.4
WP_165137725.1\|20030_20510_-	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_165137728.1\|20590_20839_-	hypothetical protein	NA	NA	NA	NA
WP_165137731.1\|20841_21342_-	hypothetical protein	A0A291AUS4	Sinorhizobium_phage	4.0e-16	35.4

DBSCAN-SWA_2

24496 : 39422

Sinorhizobium_phage(22.22%)

integrase

attL 22374:22387|attR 27543:27556

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
22374:22387	attL	NA	NA	NA	NA
WP_165137746.1\|24496_25465_+	3'-5' exoribonuclease	A0A2I7R2S7	Vibrio_phage	6.1e-29	38.7
WP_165137749.1\|25465_25756_+	hypothetical protein	A0A068CE33	Rhizobium_phage	8.0e-17	55.4
WP_165137752.1\|25752_26616_+\|integrase	tyrosine-type recombinase/integrase	A0A067XRF8	Caulobacter_phage	4.6e-60	43.2
WP_165137755.1\|27061_27766_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
27543:27556	attR	NA	NA	NA	NA
WP_165137758.1\|28100_28736_+	hypothetical protein	NA	NA	NA	NA
WP_165137761.1\|29378_30044_+	ParA family protein	A0A0A8IL09	Aurantimonas_phage	2.2e-38	45.0
WP_165137764.1\|30040_30325_+	chromosome partitioning protein ParB	NA	NA	NA	NA
WP_165137767.1\|31018_31339_-	hypothetical protein	NA	NA	NA	NA
WP_165137770.1\|31322_31775_-	hypothetical protein	NA	NA	NA	NA
WP_165137773.1\|31913_32129_-	hypothetical protein	A0A291AUV7	Sinorhizobium_phage	1.1e-12	44.3
WP_165137776.1\|32130_33114_-	glycoside hydrolase family 19 protein	A0A291AUV5	Sinorhizobium_phage	5.9e-88	55.8
WP_165137779.1\|33300_34968_-	hypothetical protein	NA	NA	NA	NA
WP_165137781.1\|34964_35738_-	hypothetical protein	G0YQF8	Erwinia_phage	8.4e-05	38.2
WP_165137783.1\|35737_36592_-	hypothetical protein	NA	NA	NA	NA
WP_165137678.1\|36595_37861_-	hypothetical protein	A0A2P0VMV2	Tetraselmis_virus	6.6e-07	29.3
WP_165137785.1\|37862_39422_-	hypothetical protein	F8TV92	EBPR_siphovirus	5.5e-88	38.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049250

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP049249

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP049247

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP049252

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection