CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP049289	Bradyrhizobium sp. 6(2017) strain 1S3 chromosome, complete genome	2 crisprs	csa3,WYL,DEDDh,cas3,PrimPol	1	1	12	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049289_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049289_1

2160739-2160823

Orphan

Consensus_repeat	Method
CCCGTCGTGATGACGGCAAAGCTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP049289_1

>merge|NZ_CP049289|1|2160739-2160823|CRISPRCasFinder
CCCGTCGTGATGACGGCAAAGCTCAGTGCCGGTTCGCCGGTCCGATAGAACTTAATCCGCCCGTCGTGATGACGGCACAGCTCAG

>NZ_CP049289|1|1|2160739-2160823|CRISPRCasFinder
CCCGTCGTGATGACGGCAAAGCTCAG	TGCCGGTTCGCCGGTCCGATAGAACTTAATCCG
CCCGTCGTGATGACGGCACAGCTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049289.1\|WP_165129005.1\|2157112_2157367_+\|HNH-endonuclease	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124295.1\|2164938_2165331_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124263.1\|2157545_2159192_+\|terminase-large-subunit	unknown	unknown	gnl\|CDD\|226974
NZ_CP049289.1\|WP_035976644.1\|2154072_2154762_-\|DJ-1/PfpI-family-protein	unknown	unknown	gnl\|CDD\|153233
NZ_CP049289.1\|WP_165124303.1\|2168182_2168980_-\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|372592
NZ_CP049289.1\|WP_165124278.1\|2160834_2162130_+\|phage-major-capsid-protein	unknown	unknown	gnl\|CDD\|377449
NZ_CP049289.1\|WP_165124268.1\|2159196_2159475_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124298.1\|2165523_2166543_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271177
NZ_CP049289.1\|WP_165124258.1\|2156831_2157059_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124281.1\|2162144_2162711_+\|HK97-family-phage-prohead-protease	unknown	unknown	gnl\|CDD\|309640
NZ_CP049289.1\|WP_029080230.1\|2167212_2167599_+\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318
NZ_CP049289.1\|WP_165124272.1\|2159667_2159943_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124285.1\|2162710_2163937_+\|phage-portal-protein	unknown	unknown	gnl\|CDD\|377413
NZ_CP049289.1\|WP_165124275.1\|2160057_2160624_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379171
NZ_CP049289.1\|WP_165124292.1\|2164531_2164942_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_156928514.1\|2153640_2153997_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_165124255.1\|2155983_2156832_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_029080229.1\|2167672_2168080_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293126
NZ_CP049289.1\|WP_165124289.1\|2163933_2164527_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377467
NZ_CP049289.1\|WP_165124252.1\|2154912_2155941_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311

Protein	Function_ID	Function_description	E-value
NZ_CP049289.1\|WP_165124263.1\|2157545_2159192_+\|terminase-large-subunit	gnl\|CDD\|226974	COG4626, COG4626, Phage terminase-like protein, large subunit [General function prediction only].	2.80415e-83
NZ_CP049289.1\|WP_035976644.1\|2154072_2154762_-\|DJ-1/PfpI-family-protein	gnl\|CDD\|153233	cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	1.40578e-53
NZ_CP049289.1\|WP_165124303.1\|2168182_2168980_-\|lytic-murein-transglycosylase	gnl\|CDD\|372592	pfam13406, SLT_2, Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.	2.42661e-71
NZ_CP049289.1\|WP_165124278.1\|2160834_2162130_+\|phage-major-capsid-protein	gnl\|CDD\|377449	pfam05065, Phage_capsid, Phage capsid family. Family of bacteriophage hypothetical proteins and capsid proteins.	1.81444e-34
NZ_CP049289.1\|WP_165124298.1\|2165523_2166543_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.02703e-18
NZ_CP049289.1\|WP_165124275.1\|2160057_2160624_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|379171	pfam13411, MerR_1, MerR HTH family regulatory protein.	4.40983e-07
NZ_CP049289.1\|WP_029080230.1\|2167212_2167599_+\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	1.9404e-35
NZ_CP049289.1\|WP_165124285.1\|2162710_2163937_+\|phage-portal-protein	gnl\|CDD\|377413	pfam04860, Phage_portal, Phage portal protein. Bacteriophage portal proteins form a dodecamer and is located at a five-fold vertex of the viral capsid. The portal complex forms a channel through which the viral DNA is packaged into the capsid, and exits during infection. The portal protein is though to rotate during DNA packaging. Portal proteins from different phage show little sequence homology, so this family does not represent all portal proteins.	1.39031e-100
NZ_CP049289.1\|WP_165124281.1\|2162144_2162711_+\|HK97-family-phage-prohead-protease	gnl\|CDD\|309640	pfam04586, Peptidase_S78, Caudovirus prohead serine protease. Family of Caudovirus prohead serine proteases also found in a number of bacteria possibly as the result of horizontal transfer.	2.24056e-42
NZ_CP049289.1\|WP_029080229.1\|2167672_2168080_-\|hypothetical-protein	gnl\|CDD\|293126	pfam16518, GrlR, T3SS negative regulator,GrlR. GrlR is a family of protobacterial type III secretion system negative regulators. Structurally, GrlR consists of a typical beta-barrel fold with eight beta-strands containing an internal hydrophobic cavity and a plug-like loop on one side of the barrel. Strong hydrophobic interactions between the two beta-barrels maintain its dimeric architecture. A unique surface-exposed EDED (Glu-Asp-Glu-Asp) motif is identified to be critical for GrlA-GrlR interaction and for the repressive activity of GrlR. The locus of enterocyte effacement (LEE) is essential for virulence of enterohaemorrhagic Escherichia coli (EHEC) and enteropathogenic E. coli (EPEC). It encodes some 20 genes including an overall regulator ler and two others, GrlR and GrlA, that form the type three secretion system for infection. GrlR comlexes with GrlA to repress expression of ler. GrlA is found in family pfam00462.	0.00209769
NZ_CP049289.1\|WP_165124289.1\|2163933_2164527_+\|hypothetical-protein	gnl\|CDD\|377467	pfam05135, Phage_connect_1, Phage gp6-like head-tail connector protein. This family of proteins contain head-tail connector proteins related to gp6 from bacteriophage HK97. A structure of this protein shows similarity to gp15 a well characterized connector component of bacteriophage SPP1.	0.00345268
NZ_CP049289.1\|WP_165124252.1\|2154912_2155941_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	6.16618e-89

>NZ_CP049289.1|WP_165124275.1|2160057_2160624_+|MerR-family-transcriptional-regulator
MNATLARKLRFSDAAYAINTTPKTLRNWLQRGVVNIHTPQQEGGWTEYSFIDIAILALVRSLVSWGVSVPTASNIANKIMTDFFPDLLRLKDPENMPAGVLASIWSNQRLHLVQEGDDWRIRHVALYDSKIDSIRNKGFNPGLPSGIAALRREIEPAPVFLTIDVETILRTAFERANESVNEGQDDQE
>NZ_CP049289.1|WP_165124272.1|2159667_2159943_+|hypothetical-protein
MGDPDFLFYDETHFHLDPREGRVLIGLSRAETDEFAQLNRAAFEYLINKVRQGTIREKHAATRRRNELLNKHLQAMFALQALNSDVKPVRH
>NZ_CP049289.1|WP_165124268.1|2159196_2159475_-|hypothetical-protein
MTTTVRTKRRAKSASKPTVRPAELRRVIDDLYSRLNDQMYVAEALQKAARPNGETLVAAYPMLKVIELAAAAHAAAVKEMWSIALRARNYRP
>NZ_CP049289.1|WP_165124263.1|2157545_2159192_+|terminase-large-subunit
MGLRGIGAKPVRTASKPKGKKKSDLEAWQAEGLTRAQRVVRFVEGLRITSGVFAGQPFKLRPWQTEIIEAIYAVDENGRRIKRQVLLTIPRKNGKTQLAAALALCHLVGPEAEQRGQVYSAAADRKQAALILKELIAFVRGDQKLMDRIIIREHSKTLEDVETGSTYEALSSDAKKAHGLNVSFAVMDELAQWPKRDLYDALTTGGAARAEPLFMTISTQSHDKNSVMSELVQYGRRVLDGTIVDDTFLPVIFAAPDDADPWSPETWRACNPALGDFRSMEEMQSAAEQAKSLPAREPSFRLLYLNQPVDASARFLNAKDWNACKVDMTAGLFGQMQWSKQRCILGLDLSSTTDLTALAAWFPATNDLMAWFWMPADNLEEAERRDHVPYRLWARQGHIETTPGRAIDKTFVVHRLGELTKEFDVQFCAADRWRLDEIKRLMVEDGIKMELVEHGQGWRDMGPAIDAVETAVLRRQLRHPGHPVLDMCVSNAVTVSDPTGARKLVKERATGRIDGLIAATMAIGAAVKTAPKAKSVYATRGLLSVVAR
>NZ_CP049289.1|WP_165129005.1|2157112_2157367_+|HNH-endonuclease
MVDGFTCVVRGCGQPAKVVDHIITRRKGGPDTVENTRSLCDWHDRQIKEMGDGRRRNGGRLVVKGCFADGTPRDPNHPWHTGGK
>NZ_CP049289.1|WP_165124258.1|2156831_2157059_+|hypothetical-protein
MRKSKPTRKLATQSLGGWVSVAPIRDWTDGSEVYVLAYRSKSGELWWQSAHIADRQNADVAAATLGDFLGARVLF
>NZ_CP049289.1|WP_165124255.1|2155983_2156832_+|hypothetical-protein
MEGWTLHNENKVVSCKTVDNGTQDNQGLTEETQNALLLGNTAALVLYNDINACQSPAQLDAVVRLIYEKYGAGLLNDDQASYLHSCVTRRRPVSQRTITGKFAKIGTLNGRVSRFLPRQRQRSPDRKASRDRRRMLGGSSALPDNLRHYYTEGQRAVLCIVAGEIKRQGVCDLPIDKIAALAGVCRTTVQTAMHEARRLSHIKITERPVRGRKHLSNLVEIVSPEWRTWIKRGPSSARAIGSKPVILVSTTKNTVRKKEGLGDELERGRGSGPPQTLMRRSA
>NZ_CP049289.1|WP_165124252.1|2154912_2155941_+|helix-turn-helix-domain-containing-protein
MSAEINRRVSVLVFPGFELLDLSGPLCAFNLASEIHRAPYRLEVISVHGGTIASASGVPIHTLKASRGRSVDTLLIVGGAPDSAVDGDADTVALIRKLAPRARRVASVCTGAFLLAAAGLLDGRSVTTHWRYAAGLQRRFPRVRVDADKIFVRDGNVWTSAGITSGIDLTLALIEDDFGIEVSKAVARDMVVYHRRSGGQSQFSTLLELEPSSDRVRDALNFAREHLHEPLPVDRMAAAARISARQFARLFLKETGDTPARVVERLRAEAALPRIQEGTEPIDIVARKVGFGDKDRMRRAFLRIYGQPPRALRRATTVSKAASLPDSRDPFGSQAPRRSGTK
>NZ_CP049289.1|WP_035976644.1|2154072_2154762_-|DJ-1/PfpI-family-protein
MKVLALAFPGFTFIDLAGPMQAFMMLPGFSSQIVWQDKGIVDSDAGVSVQATEDFGSCWKDPDILFVPGNTRSLFKQLQDDRTLDFIAGVGSRATWITSVCNGSLLLGAAGLLKGYKAASYWYTREHLALFGAIPTDARYVIDRNRATGGGMTAGIDFGLAMIGQIAGEAVGRVAELSFEYAPRPPFGTGRPELADPATLAHTTEIVKQLMPVQELEGVRARCSTMGRL
>NZ_CP049289.1|WP_156928514.1|2153640_2153997_-|hypothetical-protein
MQQIFIELYNYRPAWAKCPESERTDFVTKVAEAVKGLKSAGVDVVAYGLNSPATDRRAPYDFFCVYRVPNVEFQREFERQVAASGWYEYFEQVNVSGDADDFEAVLLGNARMVRPASS
>NZ_CP049289.1|WP_165124278.1|2160834_2162130_+|phage-major-capsid-protein
MLKLHELQEARTTAVTNMRALADLAETEKRDLTPAEEKTFGDLKTSIADLDKKIGRAQTLADAERSAPAIMHGRLGDGQYEERARDFSITKAIRGLLPADLGGGGVDIGFEREISAEVAKRSGRKFEGLAVPDQVFLQEQRTLLVGSSAADLVPNPHRADLFIDRLRNSLVAQRLGATYLDGLVGSPIDIPRQTGSSSAQWVAEDGSLTETDASFDDVNLTPKTVGAMTSYSRRTLLNASPSIEQIVRNDLAQIIAQAIDQKAMTGDGTSNTPTGILHATGVNDMAQDGTPTWEDILAFIAAVEGDNALGGSLGWVMNPYVKKKLRSTAKVASTDSVMLMEAVNELAGYAAYSTNALPGSVPGDSPAVGGTIIFGDWSQLLIASWTGVDILLNPYETTAYAKGRVLVRAMKDVDVAVRHGEAFAFEDGVTT
>NZ_CP049289.1|WP_165124281.1|2162144_2162711_+|HK97-family-phage-prohead-protease
MTTFERRVALELRAGGDKKSPRLVGHAAVFNSPSQDLGGFTEIIRPGAFARSLASVDYDQLALVQHMPQLVLGRRSAGTLRLSEDQRGLAFEIDVPETSAARDLLVSVQRGDVRGASFAFSTPKNGDRWEVRGEKVIRELLDVNLHEVTITAQPAYVDTSVALRSLEKFQQPARRLAVKALRRFLETV
>NZ_CP049289.1|WP_165124285.1|2162710_2163937_+|phage-portal-protein
MEAAVISTEKRSAPTTWDLLRTGTDYGADAGVATTVHLAENLSVVTACTTAISETAGMLPLHVYQKLPDGSRVEAPDHPVARLFSDGPNEWQTAPEFIEMMTAHCLLRGNSYAGIRRNNRGEPIGLDPFHPDLVSLVEIPRTGRYAYDVSLRQGGTRRFLPEEMLHLKDRSDDGIVGKSRLARARETFGSAIATERYAASTFKNGAAMSGILSHPEAIGAEAADRLQKDFKQTYSGADKAGSVAVLEEGLKWQQISVSPDDAQMLESRKFSTMALARIYRVPPPVIGEFEGGNYSSISEVGRWFYSHTMQPWLNKWEKLICHSLFTAIGRRTYEVEFDCDLLLRGDMLTRFQAYRIARETGIYNANELRKFEKANPRKDAGGDEYFAPANMQQEQTGQPVADRGVAQP
>NZ_CP049289.1|WP_165124289.1|2163933_2164527_+|hypothetical-protein
MITVTTPATKFNLIDVSTARSALSITDNSDDAALTAFVNRASDVIARHCRRTFALETVTEQFRPDKYLGELILSRYPVIEITSITEGADALANTDYEVANDSGIVSRLYGDRPCHWSRHKITVVYSAGFDLPTSAPDALQHACVQLVKSYYMSADRDPMVRSEMSDNISSASYFGGSDHLPPDVRGLLVQFRNFRTR
>NZ_CP049289.1|WP_165124292.1|2164531_2164942_+|hypothetical-protein
MLNPGNRALAQRAVTTAITGEAQTAFTDLGGIQAATIEAQFQYGSGGTTAKVWVQVSLDLGQTWIDVACFAFTTASATKVINLSGMTPVTTAITPSDGAMADNTYQDGIMGSSWRAKVTTTGTYANTNVVVRLEGR
>NZ_CP049289.1|WP_165124295.1|2164938_2165331_+|hypothetical-protein
MKNAHLARLDRQLRLRGEAVQLQRQVGTTTQSLTKADVRGVVKTLGIQQLIGGISQTNYTVIISPTDLRRAGWPGAITAAIPSGLVSNKDNAIPTISDKMWFRGAIKTISRADAIYDGDECVRIELTCTG
>NZ_CP049289.1|WP_165124298.1|2165523_2166543_+|tyrosine-type-recombinase/integrase
MVKVDLKGIAKVTSKGQVYYYAWRKGPRLRGEPGSPEFMASYNEAIENRRAPDTDRFRSLVTLYKGSDDYKKLADSTKRNWAPWLDKIGQHFGELRIAQFDRPEKIRPIIRRWRNQWADKPRTADYGLQVLSRVLSYGVDPLGKIAGNPCEGIKQIYSTNRSEIIWTETDIALLKQTCSADVGHAVDLAAHTGLRLGDLLRLSWSHVGEDAITITTGKSKHRRTAIIPLYDDLRRVLASIPKRSTTILTNVRRRPWTTNGFGTAFDRAKIVAKMKGHDLHFHDLRGTAVTKLYIAGIPERVIAEVMAWSEDEVAKIIRRYVGRTAATQALIQQINKKGT
>NZ_CP049289.1|WP_029080230.1|2167212_2167599_+|YciI-family-protein
MLYAILAYHVEAEVKSWTAEEDAAVMTGLREVHQRLKGRLGPAVRLGDTRKASTLRGPGHGMVIDGPFSETKEQLLGFYVIDCADEAAAIAAARDLRSVNPSAVYEIRALKVYIPGAPFPETAGPSDA
>NZ_CP049289.1|WP_029080229.1|2167672_2168080_-|hypothetical-protein
MLKNGTYAAWFRTSLADGTGIVHVADGRLWGSDAIMLYSGTYEVDGERFSAVLTTRRHSDGHATVFGTDDLVVRLEGVFSGAIATCTGRADAIPDLAFEVTLIPSQEVTPEPPPDLPLPKFDPSRLPKLSKRSSR
>NZ_CP049289.1|WP_165124303.1|2168182_2168980_-|lytic-murein-transglycosylase
MVRGWLIAASAFAAVAMVATLGVEANAAQCGNGPGGFESWKEQFAGEARAKGVGGTAIDALMQSHYASATIAADRGQRSFGLSLEQFMAKRGSATIVARGRSLKQSQAALFASIQQRYGVPPGPLIAIWGMESGFGSQRGNQNMLSSIATLAYDCRRPEFFTDQLYAALKLIDRGTLSGSTRGSMHGEIGQTQFMPKNVLAYGTGNLDVAANALNSTANFLRAHGWRAGAGYQPGEPNFAAIEAWNAAGVYQKAIAIMGRQIDGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP049289_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049289_2

3907017-3907105

Orphan

Consensus_repeat	Method
GGATTTTTGTTTTGACGCGTTTTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP049289_2

>merge|NZ_CP049289|2|3907017-3907105|CRISPRCasFinder
GGATTTTTGTTTTGACGCGTTTTCTTCACGCGAACCGGCATCCACTTCACTCGAAAACGCTCTGGATTTTTGTTTTGGCGCGTTTTCTT

>NZ_CP049289|2|2|3907017-3907105|CRISPRCasFinder
GGATTTTTGTTTTGACGCGTTTTCTT	CACGCGAACCGGCATCCACTTCACTCGAAAACGCTCT
GGATTTTTGTTTTGGCGCGTTTTCTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049289.1\|WP_029080349.1\|3898134_3899628_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
NZ_CP049289.1\|WP_165125712.1\|3913171_3914158_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176173
NZ_CP049289.1\|WP_029080350.1\|3899748_3900198_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|369571
NZ_CP049289.1\|WP_156928531.1\|3911063_3912044_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223521
NZ_CP049289.1\|WP_029080360.1\|3912040_3913009_+\|dipeptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236898
NZ_CP049289.1\|WP_165125710.1\|3905525_3906944_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|349922
NZ_CP049289.1\|WP_165125708.1\|3900458_3901487_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|373110
NZ_CP049289.1\|WP_029080430.1\|3909227_3910184_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP049289.1\|WP_029080353.1\|3902447_3902822_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP049289.1\|WP_029080357.1\|3907405_3909199_+\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173878
NZ_CP049289.1\|WP_029080358.1\|3910149_3911067_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP049289.1\|WP_029080352.1\|3901584_3902451_+\|serine-protease	unknown	unknown	gnl\|CDD\|223343
NZ_CP049289.1\|WP_029080355.1\|3903910_3905272_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277347
NZ_CP049289.1\|WP_165129138.1\|3914266_3915199_+\|class-A-beta-lactamase	unknown	unknown	gnl\|CDD\|185339
NZ_CP049289.1\|WP_165125706.1\|3893714_3895169_+\|beta-glucosidase	unknown	unknown	gnl\|CDD\|274539
NZ_CP049289.1\|WP_029080354.1\|3903648_3903861_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049289.1\|WP_084518417.1\|3916941_3918651_-\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|199835
NZ_CP049289.1\|WP_165125714.1\|3915334_3916249_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|222984
NZ_CP049289.1\|WP_029080348.1\|3897396_3898122_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|378924
NZ_CP049289.1\|WP_029080363.1\|3916287_3916839_-\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225418

Protein	Function_ID	Function_description	E-value
NZ_CP049289.1\|WP_029080349.1\|3898134_3899628_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	9.57082e-41
NZ_CP049289.1\|WP_029080350.1\|3899748_3900198_-\|cupin-domain-containing-protein	gnl\|CDD\|369571	pfam07883, Cupin_2, Cupin domain. This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel).	1.17088e-19
NZ_CP049289.1\|WP_156928531.1\|3911063_3912044_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.18153e-178
NZ_CP049289.1\|WP_029080360.1\|3912040_3913009_+\|dipeptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|236898	PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional.	1.08329e-160
NZ_CP049289.1\|WP_165125710.1\|3905525_3906944_+\|amidohydrolase	gnl\|CDD\|349922	cd05673, M20_Acy1L2_AbgB, M20 Peptidase Aminoacylase 1-like protein 2 aminobenzoyl-glutamate utilization protein B subfamily. Peptidase M20 family, ACY1L2 aminobenzoyl-glutamate utilization protein B (AbgB) subfamily. This group contains mostly bacterial amidohydrolases, including gene products of abgB that catalyze the cleavage of p-aminobenzoyl-glutamate, a folate catabolite in Escherichia coli, to p-aminobenzoate and glutamate. p-Aminobenzoyl-glutamate is a natural end product of folate catabolism, and its utilization is initiated by the abg region gene product, AbgT, by enabling uptake of its into the cell in a concentration-dependent, saturable manner. It is subsequently cleaved by AbgA and AbgB (sometimes referred to as AbgAB).	0
NZ_CP049289.1\|WP_165125708.1\|3900458_3901487_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|373110	pfam14525, AraC_binding_2, AraC-binding-like domain. This domain is related to the AraC ligand binding domain pfam02311.	2.28912e-30
NZ_CP049289.1\|WP_029080430.1\|3909227_3910184_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.17098e-115
NZ_CP049289.1\|WP_029080353.1\|3902447_3902822_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	1.88978e-19
NZ_CP049289.1\|WP_029080357.1\|3907405_3909199_+\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173878	cd08513, PBP2_thermophilic_Hb8_like, The substrate-binding component of ABC-type thermophilic oligopeptide-binding protein Hb8-like import systems, contains the type 2 periplasmic binding fold. This family includes the substrate-binding domain of an ABC-type oligopeptide-binding protein Hb8 from Thermus thermophilius and its closest homologs from other bacteria. The structural topology of this substrate-binding domain is similar to those of DppA from Escherichia coli and OppA from Salmonella typhimurium, and thus belongs to the type 2 periplasmic binding fold protein (PBP2) superfamily. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. The type 2 periplasmic binding proteins are soluble ligand-binding components of ABC or tripartite ATP-independent transporters and chemotaxis systems. Members of the PBP2 superfamily function in uptake of a variety of metabolites in bacteria such as amino acids, carbohydrate, ions, and polyamines. Ligands are then transported across the cytoplasmic membrane energized by ATP hydrolysis or electrochemical ion gradient. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.0517e-169
NZ_CP049289.1\|WP_029080358.1\|3910149_3911067_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.42975e-87
NZ_CP049289.1\|WP_029080352.1\|3901584_3902451_+\|serine-protease	gnl\|CDD\|223343	COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones].	5.8539e-30
NZ_CP049289.1\|WP_029080355.1\|3903910_3905272_-\|hypothetical-protein	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.24619e-07
NZ_CP049289.1\|WP_165129138.1\|3914266_3915199_+\|class-A-beta-lactamase	gnl\|CDD\|185339	PRK15442, PRK15442, beta-lactamase TEM; Provisional.	1.5091e-83
NZ_CP049289.1\|WP_165125706.1\|3893714_3895169_+\|beta-glucosidase	gnl\|CDD\|274539	TIGR03356, BGL, beta-galactosidase.	0
NZ_CP049289.1\|WP_165125712.1\|3913171_3914158_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176173	cd08484, PBP2_LTTR_beta_lactamase, The C-terminal substrate-domain of LysR-type transcriptional regulators for beta-lactamase genes, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators, BlaA and AmpR, that are involved in control of the expression of beta-lactamase genes. Beta-lactamases are responsible for bacterial resistance to beta-lactam antibiotics such as penicillins. BlaA (a constitutive class A penicillinase) belongs to the LysR family of transcriptional regulators, while BlaB (an inducible class C cephalosporinase or AmpC) can be referred to as a penicillin-binding protein, but it does not act as a beta-lactamase. AmpR regulates the expression of beta-lactamases in many enterobacterial strains and many other gram-negative bacilli. In contrast to BlaA, AmpR acts an activator only in the presence of the beta-lactam inducer. In the absence of the inducer, AmpR acts as a repressor. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.77079e-102
NZ_CP049289.1\|WP_084518417.1\|3916941_3918651_-\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|199835	cd10277, PQQ_ADH_I, Ethanol dehydrogenase, a bacterial quinoprotein (PQQ-dependent type I alcohol dehydrogenase). This bacterial family of homodimeric ethanol dehydrogenases utilize pyrroloquinoline quinone (PQQ) as a cofactor. It represents proteins whose expression may be induced by ethanol, and which are similar to quinoprotein methanol dehydrogenases, but have higher specificities for ethanol and other primary and secondary alcohols. Dehydrogenases with PQQ cofactors, such as ethanol, methanol, and membrane-bound glucose dehydrogenases, form an 8-bladed beta-propeller.	1.72347e-159
NZ_CP049289.1\|WP_165125714.1\|3915334_3916249_+\|hypothetical-protein	gnl\|CDD\|222984	PHA03100, PHA03100, ankyrin repeat protein; Provisional.	4.62933e-24
NZ_CP049289.1\|WP_029080348.1\|3897396_3898122_+\|alpha/beta-hydrolase	gnl\|CDD\|378924	pfam12697, Abhydrolase_6, Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.	2.12739e-13
NZ_CP049289.1\|WP_029080363.1\|3916287_3916839_-\|c-type-cytochrome	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	5.88426e-14

>NZ_CP049289.1|WP_165125710.1|3905525_3906944_+|amidohydrolase
MDNRSDVWRGVDTITPRFIELSDRVWAMPEVCYTEARSSAEHLAELRHQGFRITENLADIPTAVMGEWGEGGPVIAFLGEYDALPGLSQEAGVAEPRPVESGGHGHGCGHNLLGSSALLAATAVKDWLAANKVPGRVRYYGCPAEEGGAAKAFMVRCGAFEDADIAITWHPHSFWEVAVTPSLANTRADFSFTGRTSHAAASPHLGRSALDAVELMNVGVNYMREHMPSDARVHYALLDTGGIAPNVVQAHARVRYSIRARDLPGMNELVERVHKIAQGAALMTETKVEMKIISAVSNILPNTPLEQTLHRIMEDLGPPHFDDADKDFAGKIRATLTDKDIASVYYAIGMEPTDRPLADFLVPIDAKRNPLIGSTDVGDVSWVVPTVQVHAPTVAIGTPFHTWQVVAQGKTPAAHKAMVQAAKAMAGLGVKALLEPELIEAAKADLKKRTTRTPYISPLPANVAPPLDMSVA
>NZ_CP049289.1|WP_029080355.1|3903910_3905272_-|hypothetical-protein
MNDSIPALLPRHSGHQFVLYADSCSGVAGALHERTFASVNDVVRRLHPRPEFILFPGDEIIGLTADAGALRAQWRHWLDTEMSWLDRREVPMWHTTGNHTTYDAMSEAVFREVLKLPHNGPSGQEGLSYWVRRDDLLMVFVHTLWSGLGGEGHVETDWLEAVLAQHGDARHKLVLGHHPVFPINGYSGAYQREIGHEYSARFWDILVRADVTAYLCSHILAFDVQVHRGVLQLCTAGAGTAHRMPEGVEYLHCVQAALDQSGLRYQVLDTEGVVRERLAWPLPSFDQASWSPLPRGASPAPLSGAAPPATAIALKLSGRTAAAAAAPQTLLCTPAPGMIAPLWLGLRGPKQTLTLILGREQVRSPHYWIGPELGADADFALDVAFYPDMGPGGVLWRRSGDTRWTSCTAISATGLERFSWPAVWSVGCGEGGPDDRRYAGPRLEIAASVIALS
>NZ_CP049289.1|WP_029080354.1|3903648_3903861_+|hypothetical-protein
MKKLIYRHRDIEYTLINIEPDTWSWSFDINGKTKRGTTRARLDLLAQRRVCTLIDRELRSAERTKPREPG
>NZ_CP049289.1|WP_029080353.1|3902447_3902822_+|LuxR-family-transcriptional-regulator
MSSEPASDIVIALEIDDPVLADRLATLLGSVAGLRLAAPGEQATAAIVARNREAAGAGDFELTPRELDVLALLAEGASNKMIAQRLGISVHTAKFHVGSLLDKLDATGRTDAVAHAARRGVINL
>NZ_CP049289.1|WP_029080352.1|3901584_3902451_+|serine-protease
MTEPTTLASLSSALSETIARAAPAVVSVHSHRARASGFVWKAGLVVTADEALADEGEVEIQFADGSRRPATVTGRDHTTDVALLRVGGDVAPIKLSTEIPALGSLAVIVAADRGAPSARLGMVSLSGAPWRSLRGGEIDARIELDVRLRYSQQGGLALNAAGEPFGMAVLGPRRVLTIPAATIERVATQLEKSGRIARGYLGVGLQPVRLDEGLGAMVMNVDKVGPSAAAGIRQGDVIVAVNGEKLSGVRALSRGLGPQSVGTVVELTVHRGGEPLNVKVTVGERPET
>NZ_CP049289.1|WP_165125708.1|3900458_3901487_+|AraC-family-transcriptional-regulator
MTATGNEVSARASSTRTRLTDFARVATARVDDAAEAIGRIFCPHELTPVDHSERGFSAHHNCAGFDGFSVNYVAYGGSVAINPGCLDRFFLLQMPLSGSASIRTAARELTTGPQRCASLLSPTIPTEMTWRGDCAQLIVLLDRKLVEHRAAALGGVAVRPVEFDPAVELTGPLGQMLSARIEQLVTLAEQLGPRKTLSAIAAADWRESFLNVLLNEQRHSLSSAIDVFNGRTEAQPAALKRVRAYLETCATEPLDLAELAEIAGTGIRALQLGFRRHFGTTVSEMLLDIRLAHLNARLKTARPGERIVDIAFDLGFTHLSRMASAYRAKFGETPKATLQRLS
>NZ_CP049289.1|WP_029080350.1|3899748_3900198_-|cupin-domain-containing-protein
MGTLEKGITRTGTGYGGKTWNILGQVYYPKAVTDSTFAFETNSDPGQFVPVHVHPTQDEFILVQEGVLDLKLDGVWVQAKAGDLVRMPRGIPHGYFNKSDKPARALFWVSPMQKLEALFDKLHNLQDPAEAVRISAQHEVDFLPPEAND
>NZ_CP049289.1|WP_029080349.1|3898134_3899628_-|NAD(P)/FAD-dependent-oxidoreductase
MVKQKHVCVIGAGISGLAAGKAFAGRGHKVTIIERSGDLGGVWEPARSYPDVQTQSPKDLYRYTDKAMPEAYPEWPKGPQVHAYLRDYARSHGLDGAMRFDTSVETMKRRADGRPGWTLELRSTDGATGQEDFDFVAVCTGQFNEPQTLPLPGEDGFKAQGGQILHSSQYSDPALAKGRKVVVLGGSKSATDIAVNAVNSGASEVTIVFREPVWRIPYFVGGLVNFKRILYIRAQEQMFASWGIGPMARLAHAVAKPLVWANWRGLESMLKMQLKLKQCDMVPKERIEDGVNCSVPIATPDFYPMVADGRIKAVRGTFDHYDGKTIVMSGGQRVAADIAVLAIGYKLGVPFLPEEYQRKLVEPDGQYRLYRLIANPDLPDMGFVGFNSSFCTVLCADLAANWLVRYADGQLAQQPSAAEMHDNIAMMLNFKRVERPAAGVYGGLCVAPYHFKHFDELLADIGTKASRRNPLVEKFTPPDADAYARFLATAPEYKAVA
>NZ_CP049289.1|WP_029080348.1|3897396_3898122_+|alpha/beta-hydrolase
MSTYVLVHGAWHTGAEFEPVAAAIRRDGHVVHTPTIRGNRSGDRKDSGLPEAIQSIVDYLAEHDLKDIVLVGHSYGGMVITGVADAAGDRIRRLVYWNAFVPNNGECLNDMVPSHYRGLFDAIYAERGDGSVVLPFPIWREAFINDADLETAQRAYDKLNPHPLKTFQDKIALKTNPAEMPIAKSYVNCTEDTAMPHSLPWHPRLSEKLGLFRLVQVPGSHELCFSNPERLAQAFLDAGRD
>NZ_CP049289.1|WP_165125706.1|3893714_3895169_+|beta-glucosidase
MFGQFSRRQFAGLAGLSALGLSAPAEAANRAPRPNGTSFPAGFVWGTATSSYQVEGAVNEDGRGPSIWDTFTHTSGKIEDGSTGDRANDHYHRYKEDVRLIKELGARAYRFSIAWPRVFPDGTGAPNPKGLDFYNRLVDELLANGIEPYATLYHWDLPQALQDRVGGWRSRDTSMAFGDYAGYVAQRLTDRVKNIFTLNEVGRFLPFGYALGVDAPGLKLPPAEVNQARHNVALAHGLAVQAIRAKGRAGTRVGPAENITACVPAINTPENIRATEIATRELNAGFLGAILEGKYTEAFLQYAGADAPKFTAEELKIISQPNDFVGLNIYAPHCYVLATDSAPGWKPLPMPASFPHMSSDWLRIAPETIYWAPRIAAKLWNIKSIYISENGTSGEDKVQPDGQIYDLDRIMFLRNYLAQLQRATADGVPVHGYFLWSLMDNFEWIFGYEKRFGLYRVDFETQARVPKLSAAFYRDVIARNAIGV
>NZ_CP049289.1|WP_029080357.1|3907405_3909199_+|peptide-ABC-transporter-substrate-binding-protein
MFDKNLRGMIDDVRDGRMDRRAFVKRMIAVGLTAPMANQVLSLGGVAMAQSPSPYKPTKRGGGGPLKLLWWQGPTLLNPHFATGTKDQDGSRIFYEPLASWDTEGKLNPILAAEIPSIQNGGLAADAKSVVWKLKPGVKWHDGKPFTADDAVFNFEYCSDPATAAVSVGSYGDVSSVEKIDDLTIRVVFKKPTPFWANAFVGAYGCIIPKHLFAEYKGSKSREAPNNLKPVGTGPYKFVEFKPGDQIRGEINPDYHMANRPYFDTFELKGGGDAVSAARAIIQTGEYDYAWNMQVEDEVLLRLEKGGKGKTVYAPGGDIEFIAINFTDPNTEVDGERSSMKTKHPILSDPRARQALALLVDRDSVKKAIYGRAGRTTASYLNGPEEFVSKNTKWEFSIEKAAALLDEAGWKVGSDGIREKDGKKLKLLYQTSINGPRQKTQAIVKQACQKAGIDVELKSVVASVFFSSDVANPDTYAKFFADIEMFQIPMTQPDPALHMRRYHSRNIATKENKWQGGNFPRWANKDFDAAVDAAENEIDPLKRADLYIKCNDLMWQDNVVIPVMHRIKVGAASNTLRPVISGWANDLDNLQDWYRDA
>NZ_CP049289.1|WP_029080430.1|3909227_3910184_+|ABC-transporter-permease
MSQYILRRLLIAIPSLLGISLVLFVVLALAPGDPFSELATNPNVPPEVQAALRAKFGLDDPIYLRYLHWLAAMAQGDWGFSFVSRMNVDTLILQRLPATLYIIGSAQLLALLIAIPVGVYAATRPYSLFDQIANTFAFIGFSLPTFFTGILFILVFSVKLDWLPFVYTDVPGSGIKWALEMIRQAIMPVMVLGLFQAASMTRFVRSAMLDVIRLDYVTTARAKGLGQAKVIVKHVMRNAMIPVVTLIALQMPAVFGGAIVTEQIFRIPGIGSLLISSILANDTPVIMAVTFVFACLVVLFNLIADVLYGWLDPRISFR
>NZ_CP049289.1|WP_029080358.1|3910149_3911067_+|ABC-transporter-permease
MAGLTLASPSAERRGYSPWRETWRRYRRHKPAVVSAVLLSVLILAVVIGPFIWRVAINDVDVVAGLQGPSLAHPFGTDDLGQDLLARMIYGGRISLAVGLAAMLVSVFVGTLIGALAGMSRGALGYGLMWLTDLFLSLPQLPLLLLLIYLFRDGLRAVFGPEGGIFILIVLVIGGLRWMPVARLVRAQFLSLREKEFVEAARALGASPVRQVVRHILPNALGPVIIAGTIDVAAAIIAESTLSFLGLGFPPDTPTWGRILYDAKDFLDIGPHWALFPGGAIFIAVVAINFIGDGLRDALDARKVI
>NZ_CP049289.1|WP_156928531.1|3911063_3912044_+|ATP-binding-cassette-domain-containing-protein
MMALLEIKGLKTHFTTDDGILQAVDGVDISINRGETLCVVGESGCGKTVTAMSILKLIAMPPGKIVAGEIIFEGRDLVPLTSHELDDIRAKEIGFIFQEPMTSLNPVLTIGEQISESLRRHEAVTRKQALERTIEMLKLVQIPNAEGRVHHYPHQFSGGMRQRVMIAMALACRPKLVIADEPTTALDVTIQAQILDLLQDMKERLGMAVMLITHAMGVVAETAQRVVVMYAGKVVEEAGVDELFADPRHPYTQGLIRSIPRIDLDAEHKTRLEAIGGSVPILINPPPGCRFAPRCKHAMSICTEQEPRLREIAPGHRMACHLGDAS
>NZ_CP049289.1|WP_029080360.1|3912040_3913009_+|dipeptide-ABC-transporter-ATP-binding-protein
MSEPLLRVSNLKKHFPVLGGLLSREVGQVYAVDGVSFSINRGETLGLVGESGCGKSTTGRCVLRLIEPTSGEVVFDGKSVMGLGGGDLRAMRRNMQLVFQDPFASLNPRMTVGTILAEPLIIHNLVSSASEREDRVARLLVKVGLKADHMRRYPHEFSGGQRQRIAIARALTLEPKLIVCDEPVSALDVSIQAQVINLLEDLQAELNLTYLFVAHDLSVVEHISDRVAVMYLGRIVELAKASDLYRNPQHPYTKALLSAVPVPDPKAKKLRIRLKGDVPSPMNPPKGCHFHTRCPIAEERCRQTAPQLLEGSNGHSVACHLA
>NZ_CP049289.1|WP_165125712.1|3913171_3914158_-|LysR-family-transcriptional-regulator
MRRHLPLNALRAFEASARLLSFTRAGMELRVTQTAISHQVKQLEELLGASLFRRLPRGLVLTDEGLALLPVLSDALDRIGAAIDRIEAKGTREVVTVGCVTTFATGWLLQRVDRFKRAHPYIDLRLLTNNNRVDIAGDGLDLALRFGDGSWHGTEAIHLLSAPLSPVCCPDAASRLRKPSDLAQEFLLRSYRAEEWPLWFAVAGAPCPKIQGPIFDSSVAMAEAAARGVGVGLVPIAMFGNELASGRLLRPFAAEVPAGSYWLTWLKSREVTPGMRAFRDWLLDTLRADASAAEEGTDASASRPKAKTKAKPKAKPKAKTNAAKKRRR
>NZ_CP049289.1|WP_165129138.1|3914266_3915199_+|class-A-beta-lactamase
MTRRTFGLRAVGLAMSCTLPRPSAAAEQSAAAGRSAAAGPSGPGLRLQQEFARVELATSGRLGVAALDMETGLRASQRGDERFPMCSTFKALASAAVLHRVDRGESSLDQRVQIEAKDILANSPVTKEHVASGMTLAEICEAAITRSDNTAGNMILREIGGPAGLTSFFRTIGDNVSRLDRWELALNEGVSGDPRDTTSPVAMLKNLQRVVIGDVLQATSRQRLIAWMVANKTGDARLRAGVPRDWRVGDKSGTGERGTYNDIGVFWPPGRKPIVVTVYLTGASAPMDKCNEVIANVARAVANASTGQTG
>NZ_CP049289.1|WP_165125714.1|3915334_3916249_+|hypothetical-protein
MYRRIALAALLVAGSIQSSLAAADPARCRELIRKYDTDKAQLSAVEISLTLFAAASADCINLATELLDHGASVDARDRLGARPLSHAARSGHLDMVDLLLARGAPVDARNLAGSTALYFAAERGHAAIVQRLIDRGADVNLTGRSGASPVAAAAYAGRDMVVRMLLAHGADGRKADDTGKPPVVYAAAGGQLGIVKQLLALGIDVNARYANDLTLLMWAAGPDETVPEAQALEIVSYLLDAGARVDDRDARGRTALMIAAEGNHPAIAKALLAHGADAALADKAGKHAADLTILSALREELTPR
>NZ_CP049289.1|WP_029080363.1|3916287_3916839_-|c-type-cytochrome
MICSAALLLMAAEVRAETIAEKVQVCAGCHGENGKPIDKTIPTIWGQQAGYLYIQLRDFKRGDRKSEIMQPIATQFERDDMLAIAEYFSQKPWPDLGQPSAPKDVAEKAVSASRSVGCPACHLDRFQGDGTVPRLAGMGRDYLAKTIADFRTRARGNNPGMSDLMLATSPDDLAALVEYLAGL
>NZ_CP049289.1|WP_084518417.1|3916941_3918651_-|PQQ-binding-like-beta-propeller-repeat-protein
MTVKGLAAFAAAVGVGVLSTAAIGQEVKQEKQSVLGNANVPPVTQEQLNAADKNAKDFLLTNGNYAQTRFYPGKQISRDNVKNLHVAWIFQTDVKESLETSPIVVDGVMYVTTSFSHVYALDAKTGQQLWHYAHKMGPITVYCCGPNNRGVQVLGDRVYLATLDSKLMALNAKTGEVVWTTNIADPELGYSETMAPTVVKDKVLIGTNGGEYGIRGFVRAYDAKTGKQLWNFNTIPENSVGVWATKDATGRDMHRNIQAEKDMLAKIGDPYAKLGGGVWQNPSVDLATNRIYFVVGNPSPDLDGSNRPGDNLYTNSLVSLDLDTGKYVCHFQYIAHDVWDLDAVSPTVLVNVKDKDGKTIPGVIHAGKTGHIYVHDRKDCSLIRFSEAMVPQENMWVLPTKEGARMLPGANGGVEWSPIATDPGQELAYAINLHQPMTYHVESSAYPNGKLWLGGAFKVIPSEKQSGNITAVNYNTGKIKWQVKTPEPMIGGILATAGGLVFTGEGNGKFAAYNSSNGKELWSFRAGAGVNAPPSSYMIGGKQYIVVGAGGNTQIDYKRGNNIIAFTLN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	6265340-6265376	1	0.973
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	1025271-1025307	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	2307993-2308029	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	2486812-2486848	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	2985495-2985531	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	3618366-3618402	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	3990663-3990699	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	4361070-4361106	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	5631899-5631935	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	6668056-6668092	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	6908815-6908851	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	413455-413491	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	2935315-2935351	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	3382077-3382113	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	5142413-5142449	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	7217581-7217617	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	8713094-8713130	2	0.946
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP049289.1	9523132-9523168	2	0.946

1. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 6265340-6265376, mismatch: 1, identity: 0.973

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcatccacttcgctcgaaaacgctct	Protospacer
**********************.**************

2. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 1025271-1025307, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

3. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 2307993-2308029, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

4. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 2486812-2486848, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

5. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 2985495-2985531, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

6. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 3618366-3618402, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcgtccacttcgctcgaaaacgctct	Protospacer
*************.********.**************

7. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 3990663-3990699, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

8. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 4361070-4361106, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

9. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 5631899-5631935, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

10. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 6668056-6668092, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

11. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 6908815-6908851, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcgtccacttcgctcgaaaacgctct	Protospacer
*************.********.**************

12. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 413455-413491, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

13. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 2935315-2935351, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

14. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 3382077-3382113, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

15. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 5142413-5142449, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcaaaccggcatccacttcgctcgaaaacgctct	Protospacer
*****.****************.**************

16. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 7217581-7217617, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggtatccacttcgctcgaaaacgctct	Protospacer
************.*********.**************

17. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 8713094-8713130, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcgtccacttcgctcgaaaacgctct	Protospacer
*************.********.**************

18. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to position: 9523132-9523168, mismatch: 2, identity: 0.946

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcgtccacttcgctcgaaaacgctct	Protospacer
*************.********.**************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049289_2	2.1\|3907043\|37\|NZ_CP049289\|CRISPRCasFinder	3907043-3907079	37	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	161724-161760	4	0.892

1. spacer 2.1|3907043|37|NZ_CP049289|CRISPRCasFinder matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.892

cacgcgaaccggcatccacttcactcgaaaacgctct	CRISPR spacer
cacgcgaaccggcatccacttcgctcgaaaacgggca	Protospacer
**********************.**********  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1013966 : 1023573

uncultured_Mediterranean_phage(100.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165123511.1\|1013966_1014992_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.4e-23	42.7
WP_165123513.1\|1014988_1015810_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	8.0e-30	34.6
WP_029082692.1\|1015889_1016723_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.3e-43	50.3
WP_028332136.1\|1016871_1017105_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	4.2e-08	63.6
WP_029082691.1\|1017264_1017810_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_029082690.1\|1017806_1018613_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	7.8e-54	47.2
WP_029082689.1\|1018808_1020140_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.4e-102	49.7
WP_029082688.1\|1020248_1020560_-	hypothetical protein	NA	NA	NA	NA
WP_029082687.1\|1021333_1022101_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.2e-37	37.0
WP_029082686.1\|1022185_1022563_-	response regulator	NA	NA	NA	NA
WP_051346499.1\|1022955_1023573_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.5e-28	47.5

DBSCAN-SWA_2

2157545 : 2202139

Enterobacteria_phage(12.5%)

plate,protease,terminase,capsid,head,portal,integrase

attL 2155947:2155994|attR 2166592:2166639

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2155947:2155994	attL	NA	NA	NA	NA
WP_165124263.1\|2157545_2159192_+\|terminase	terminase large subunit	K7P7I2	Enterobacteria_phage	2.3e-92	40.1
WP_165124268.1\|2159196_2159475_-	hypothetical protein	NA	NA	NA	NA
WP_165124272.1\|2159667_2159943_+	hypothetical protein	NA	NA	NA	NA
WP_165124275.1\|2160057_2160624_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_165124278.1\|2160834_2162130_+\|capsid	phage major capsid protein	A0A2I5ARA4	Synechococcus_phage	5.1e-55	37.8
WP_165124281.1\|2162144_2162711_+\|head,protease	HK97 family phage prohead protease	B4UTP2	Rhizobium_phage	6.8e-28	43.7
WP_165124285.1\|2162710_2163937_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	1.3e-60	36.2
WP_165124289.1\|2163933_2164527_+	hypothetical protein	F8TVA2	EBPR_siphovirus	2.6e-14	33.2
WP_165124292.1\|2164531_2164942_+	hypothetical protein	NA	NA	NA	NA
WP_165124295.1\|2164938_2165331_+	hypothetical protein	NA	NA	NA	NA
WP_165124298.1\|2165523_2166543_+\|integrase	tyrosine-type recombinase/integrase	F8TUV0	EBPR_podovirus	9.6e-49	36.7
WP_029080230.1\|2167212_2167599_+	YciI family protein	NA	NA	NA	NA
2166592:2166639	attR	NA	NA	NA	NA
WP_029080229.1\|2167672_2168080_-	hypothetical protein	NA	NA	NA	NA
WP_165124303.1\|2168182_2168980_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_035976643.1\|2169229_2169589_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_029080227.1\|2169604_2169991_+	VOC family protein	NA	NA	NA	NA
WP_165124306.1\|2170243_2170453_+	hypothetical protein	NA	NA	NA	NA
WP_029080225.1\|2170895_2171123_-	hypothetical protein	NA	NA	NA	NA
WP_084518414.1\|2171085_2171265_-	hypothetical protein	NA	NA	NA	NA
WP_029080223.1\|2171915_2172311_+	NUDIX hydrolase	NA	NA	NA	NA
WP_029080222.1\|2172384_2173575_-	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	1.2e-15	29.9
WP_165124310.1\|2174144_2177324_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
WP_029080221.1\|2177666_2178911_-	amidohydrolase family protein	NA	NA	NA	NA
WP_029080220.1\|2178944_2180300_-	MFS transporter	NA	NA	NA	NA
WP_165124314.1\|2180423_2181350_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029080218.1\|2181542_2183951_+	hypothetical protein	NA	NA	NA	NA
WP_029080217.1\|2184595_2186362_+	caspase (peptidase)	NA	NA	NA	NA
WP_029080216.1\|2186579_2187227_-	DUF4384 domain-containing protein	NA	NA	NA	NA
WP_035976638.1\|2187247_2189026_-	hypothetical protein	NA	NA	NA	NA
WP_029080214.1\|2189166_2190888_-	hypothetical protein	NA	NA	NA	NA
WP_029080213.1\|2191044_2191326_+	hypothetical protein	NA	NA	NA	NA
WP_029080212.1\|2191415_2192396_+	DUF4424 domain-containing protein	NA	NA	NA	NA
WP_165124317.1\|2192404_2194213_-	protein kinase	A0A2R8FF19	Brazilian_cedratvirus	1.6e-17	34.1
WP_029080210.1\|2194209_2194986_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_029080209.1\|2194992_2195694_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_165124320.1\|2195690_2199239_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_165124341.1\|2199284_2200805_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_029080206.1\|2200801_2202139_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

DBSCAN-SWA_3

2778338 : 2787356

Hokovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165124651.1\|2778338_2780231_-	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	2.0e-28	27.8
WP_165124653.1\|2780264_2781263_-	NAD-dependent epimerase/dehydratase family protein	A0A2K9L4U8	Tupanvirus	5.5e-41	34.6
WP_165124655.1\|2781400_2782462_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	3.3e-52	34.5
WP_165124657.1\|2782461_2783520_-	NAD-dependent epimerase/dehydratase family protein	M1I5F1	Acanthocystis_turfacea_Chlorella_virus	4.6e-30	28.6
WP_165124659.1\|2783522_2784455_-	NAD-dependent epimerase/dehydratase family protein	A0A0E3IB24	Synechococcus_phage	1.6e-18	29.2
WP_165124661.1\|2784468_2785416_-	NAD-dependent epimerase/dehydratase family protein	A0A1V0SKV4	Klosneuvirus	2.6e-16	25.7
WP_165124662.1\|2785439_2787356_-	asparagine synthase (glutamine-hydrolyzing)	A0A0G2Y369	Acanthamoeba_polyphaga_mimivirus	2.4e-29	29.1

DBSCAN-SWA_4

3225712 : 3280356

Enterobacteria_phage(25.0%)

plate,terminase,capsid,portal,tail,integrase

attL 3223455:3223472|attR 3272740:3272757

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3223455:3223472	attL	NA	NA	NA	NA
WP_165125079.1\|3225712_3227128_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9SGU9	Bradyrhizobium_phage	2.0e-36	32.7
WP_165125082.1\|3227238_3227565_+	hypothetical protein	NA	NA	NA	NA
WP_084518550.1\|3228347_3228557_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	1.1e-07	54.4
WP_165125085.1\|3228898_3229201_+	hypothetical protein	NA	NA	NA	NA
WP_165125088.1\|3229517_3230249_+	hypothetical protein	NA	NA	NA	NA
WP_165125091.1\|3230241_3231186_+	ATP-binding protein	NA	NA	NA	NA
WP_165125094.1\|3235405_3235597_+	hypothetical protein	NA	NA	NA	NA
WP_165125097.1\|3236110_3236542_+	hypothetical protein	NA	NA	NA	NA
WP_029085257.1\|3236627_3236873_+	DUF768 domain-containing protein	NA	NA	NA	NA
WP_029085258.1\|3236925_3237171_-	hypothetical protein	NA	NA	NA	NA
WP_165125100.1\|3237434_3237638_-	hypothetical protein	NA	NA	NA	NA
WP_165125103.1\|3238682_3238850_+	hypothetical protein	NA	NA	NA	NA
WP_029085267.1\|3239499_3239748_+	hypothetical protein	NA	NA	NA	NA
WP_165125106.1\|3248519_3250466_+	glycosyltransferase	NA	NA	NA	NA
WP_165125109.1\|3251139_3251844_+	hypothetical protein	NA	NA	NA	NA
WP_029085690.1\|3251940_3252345_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	6.7e-14	35.8
WP_156929198.1\|3252345_3252711_-	hypothetical protein	NA	NA	NA	NA
WP_156929197.1\|3252703_3253369_-	hypothetical protein	NA	NA	NA	NA
WP_051346915.1\|3253704_3255603_-	collagen-like protein	NA	NA	NA	NA
WP_029085687.1\|3255599_3255944_-	hypothetical protein	NA	NA	NA	NA
WP_029085686.1\|3255947_3256532_-	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_029085685.1\|3256544_3257840_-	hypothetical protein	A0A068CE15	Rhizobium_phage	9.1e-12	28.4
WP_051346914.1\|3257855_3258623_-	DUF2313 domain-containing protein	NA	NA	NA	NA
WP_084518904.1\|3258622_3259735_-\|plate	baseplate J/gp47 family protein	A0A0C4UQU9	Shigella_phage	1.7e-30	29.3
WP_051346913.1\|3259738_3260257_-	hypothetical protein	NA	NA	NA	NA
WP_029085683.1\|3260260_3261025_-	hypothetical protein	NA	NA	NA	NA
WP_029085682.1\|3261036_3262107_-	hypothetical protein	NA	NA	NA	NA
WP_029085681.1\|3262112_3262781_-	hypothetical protein	A0A2P9JZK2	Alteromonadaceae_phage	1.3e-06	37.5
WP_029085680.1\|3262777_3263329_-	hypothetical protein	Q8W619	Enterobacteria_phage	1.4e-14	34.2
WP_165125111.1\|3263325_3265725_-	hypothetical protein	NA	NA	NA	NA
WP_165125113.1\|3265724_3265919_-	hypothetical protein	NA	NA	NA	NA
WP_165125115.1\|3265888_3266293_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_051346911.1\|3266319_3266685_-	hypothetical protein	Q8W622	Enterobacteria_phage	5.3e-10	32.7
WP_165125117.1\|3266717_3267119_-	hypothetical protein	M1FN90	Enterobacteria_phage	3.2e-32	63.0
WP_165125119.1\|3267125_3268286_-\|tail	phage tail protein	B5TK67	Pseudomonas_phage	5.8e-58	38.9
WP_156929196.1\|3268311_3268629_-	hypothetical protein	NA	NA	NA	NA
WP_029085677.1\|3268625_3269270_-	hypothetical protein	NA	NA	NA	NA
WP_029085676.1\|3269271_3269628_-	hypothetical protein	NA	NA	NA	NA
WP_029085675.1\|3269618_3269987_-	hypothetical protein	NA	NA	NA	NA
WP_029085674.1\|3269979_3270624_-	hypothetical protein	NA	NA	NA	NA
WP_165129071.1\|3270623_3271703_-	collagen-like protein	NA	NA	NA	NA
WP_051346909.1\|3272019_3273474_-\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	8.9e-16	26.8
3272740:3272757	attR	NA	NA	NA	NA
WP_029085673.1\|3273470_3273818_-	hypothetical protein	NA	NA	NA	NA
WP_165125121.1\|3273850_3275950_-\|capsid	phage major capsid protein	A0A2H4PRG1	Proteus_phage	1.4e-09	35.8
WP_165125123.1\|3276013_3276292_-	hypothetical protein	NA	NA	NA	NA
WP_165125125.1\|3276370_3276682_-	HNH endonuclease	B5WZZ4	Pseudomonas_phage	4.7e-15	48.8
WP_165125127.1\|3276678_3278253_-\|terminase	terminase large subunit	K7P7T5	Enterobacteria_phage	1.1e-99	43.1
WP_165125129.1\|3278230_3278722_-\|terminase	phage terminase small subunit P27 family	A0A0R6PDL0	Moraxella_phage	6.7e-16	31.0
WP_165125131.1\|3279466_3279664_-	hypothetical protein	NA	NA	NA	NA
WP_165125133.1\|3279660_3280356_-	ParB N-terminal domain-containing protein	K4HZA5	Acidithiobacillus_phage	5.7e-29	50.4

DBSCAN-SWA_5

3995405 : 4049279

Agrobacterium_phage(16.67%)

protease,transposase,integrase

attL 3991802:3991820|attR 4063523:4063541

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3991802:3991820	attL	NA	NA	NA	NA
WP_029080424.1\|3995405_3997607_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2L0V0F4	Agrobacterium_phage	4.3e-139	41.9
WP_029080425.1\|3997587_3998391_+	hypothetical protein	NA	NA	NA	NA
WP_029080426.1\|3998462_3998738_-	hypothetical protein	NA	NA	NA	NA
WP_165125752.1\|3998738_4003571_+	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_029080428.1\|4003637_4003967_+	hypothetical protein	NA	NA	NA	NA
WP_165123366.1\|4004101_4004743_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_165125755.1\|4004884_4006246_-	hypothetical protein	NA	NA	NA	NA
WP_029085054.1\|4006472_4006724_+	hypothetical protein	NA	NA	NA	NA
WP_084518823.1\|4006863_4008267_+	GTPase HflX	NA	NA	NA	NA
WP_051346821.1\|4008322_4009345_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_029085052.1\|4009883_4010324_-	hypothetical protein	NA	NA	NA	NA
WP_035978396.1\|4010357_4010975_-	hypothetical protein	NA	NA	NA	NA
WP_051346864.1\|4012008_4012614_+	cytochrome b	NA	NA	NA	NA
WP_029085040.1\|4012982_4013489_-	hypothetical protein	NA	NA	NA	NA
WP_165125758.1\|4014606_4015494_+	hypothetical protein	NA	NA	NA	NA
WP_165125761.1\|4016111_4016573_+	hypothetical protein	NA	NA	NA	NA
WP_165125764.1\|4016798_4016981_-	hypothetical protein	NA	NA	NA	NA
WP_165125766.1\|4017149_4017824_+	recombinase family protein	H9A0X7	Staphylococcus_phage	1.3e-14	35.3
WP_165125769.1\|4018011_4018209_+	hypothetical protein	NA	NA	NA	NA
WP_165125772.1\|4018684_4018984_+	hypothetical protein	NA	NA	NA	NA
WP_165125775.1\|4018980_4020513_+	hypothetical protein	NA	NA	NA	NA
WP_165125778.1\|4020524_4021031_+	hypothetical protein	NA	NA	NA	NA
WP_165125781.1\|4021045_4021207_-	hypothetical protein	NA	NA	NA	NA
WP_165125784.1\|4021205_4021367_+	hypothetical protein	NA	NA	NA	NA
WP_165125787.1\|4021549_4021759_+	cold shock domain-containing protein	NA	NA	NA	NA
WP_165125790.1\|4021765_4022296_+	hypothetical protein	NA	NA	NA	NA
WP_165125793.1\|4022279_4022540_+	hypothetical protein	NA	NA	NA	NA
WP_165125796.1\|4022558_4024079_-	hypothetical protein	NA	NA	NA	NA
WP_165125799.1\|4024208_4024415_-	hypothetical protein	NA	NA	NA	NA
WP_165125802.1\|4025129_4025390_-	hypothetical protein	NA	NA	NA	NA
WP_165125805.1\|4026253_4026481_-	hypothetical protein	NA	NA	NA	NA
WP_165125808.1\|4027327_4027684_+	hypothetical protein	NA	NA	NA	NA
WP_165125811.1\|4027851_4028010_+	hypothetical protein	NA	NA	NA	NA
WP_165125814.1\|4028006_4028228_+	hypothetical protein	NA	NA	NA	NA
WP_165129140.1\|4028231_4028477_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_165125817.1\|4028473_4029520_+\|integrase	tyrosine-type recombinase/integrase	B0VK72	Azospirillum_phage	1.5e-25	32.5
WP_165125820.1\|4029763_4031149_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_165125823.1\|4035027_4035423_+\|transposase	transposase	NA	NA	NA	NA
WP_029084864.1\|4035419_4035767_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	4.9e-29	52.8
WP_165125826.1\|4037400_4037868_+	peptidoglycan-binding protein	A0A2L0HNW5	Microbacterium_phage	2.2e-08	37.7
WP_029085180.1\|4038505_4039042_-	hypothetical protein	NA	NA	NA	NA
WP_029085208.1\|4039629_4039920_-	hypothetical protein	NA	NA	NA	NA
WP_029085209.1\|4040359_4040776_+	hypothetical protein	NA	NA	NA	NA
WP_156929135.1\|4040934_4041507_-	hypothetical protein	NA	NA	NA	NA
WP_165125828.1\|4041771_4042122_+\|transposase	transposase	NA	NA	NA	NA
WP_029085162.1\|4043028_4043223_+	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_156929117.1\|4045247_4045505_+	hypothetical protein	NA	NA	NA	NA
WP_165125830.1\|4048206_4048551_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	1.0e-10	32.7
WP_165125832.1\|4049048_4049279_+\|transposase	transposase	NA	NA	NA	NA
4063523:4063541	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4062018 : 4146182

Pseudomonas_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165125842.1\|4062018_4062219_+\|transposase	transposase	NA	NA	NA	NA
WP_165129142.1\|4062533_4062731_+	hypothetical protein	NA	NA	NA	NA
WP_165125844.1\|4064447_4064795_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.6e-34	57.5
WP_084518735.1\|4064879_4065194_-\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	3.1e-06	59.1
WP_029084575.1\|4065978_4066965_-	hypothetical protein	NA	NA	NA	NA
WP_084518734.1\|4066961_4067948_-	endo alpha-1,4 polygalactosaminidase	NA	NA	NA	NA
WP_029084573.1\|4068687_4070043_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_051346738.1\|4070068_4071793_-	type I secretion system permease/ATPase	A0A2H4UU96	Bodo_saltans_virus	7.1e-12	22.3
WP_165125847.1\|4071894_4076409_-	hypothetical protein	NA	NA	NA	NA
WP_165125850.1\|4078219_4078501_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_156928992.1\|4078497_4078824_+	hypothetical protein	NA	NA	NA	NA
WP_165123002.1\|4080193_4080340_+	hypothetical protein	NA	NA	NA	NA
WP_029084570.1\|4080784_4081012_-	hypothetical protein	NA	NA	NA	NA
WP_035978365.1\|4081994_4082321_-	hypothetical protein	NA	NA	NA	NA
WP_165123004.1\|4082596_4083064_-	DUF927 domain-containing protein	NA	NA	NA	NA
WP_029084984.1\|4083285_4083735_-	DUF927 domain-containing protein	NA	NA	NA	NA
WP_029084985.1\|4083886_4084165_-	hypothetical protein	NA	NA	NA	NA
WP_165125853.1\|4084352_4084538_-	hypothetical protein	NA	NA	NA	NA
WP_029084989.1\|4085504_4085807_-	hypothetical protein	NA	NA	NA	NA
WP_029084990.1\|4085846_4086857_-	hypothetical protein	NA	NA	NA	NA
WP_156929076.1\|4087126_4087522_-	hypothetical protein	NA	NA	NA	NA
WP_156929077.1\|4087849_4088095_+	hypothetical protein	NA	NA	NA	NA
WP_165125856.1\|4088245_4089589_-\|transposase	IS1380 family transposase	NA	NA	NA	NA
WP_165125859.1\|4089880_4091137_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_165129144.1\|4092162_4093557_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.5e-20	34.7
WP_165125862.1\|4093835_4095452_+	EAL domain-containing protein	A0A2D0W9B6	Bordetella_phage	3.4e-08	40.4
WP_051346801.1\|4096846_4097797_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029084903.1\|4098143_4099175_+	transporter substrate-binding domain-containing protein	A0A1B1IT51	uncultured_Mediterranean_phage	5.1e-50	35.4
WP_165125865.1\|4099231_4100428_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_029084901.1\|4100427_4101561_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_029084900.1\|4101602_4102352_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.6e-31	39.0
WP_165125868.1\|4102428_4103721_+	serine hydroxymethyltransferase	G9I092	Helicoverpa_zea_nudivirus	1.8e-47	35.2
WP_084518803.1\|4103900_4104554_+	hypothetical protein	NA	NA	NA	NA
WP_165125871.1\|4104608_4104866_+	VOC family protein	NA	NA	NA	NA
WP_165125874.1\|4106357_4106795_+\|transposase	transposase	NA	NA	NA	NA
WP_165129146.1\|4106821_4107148_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.7e-13	35.6
WP_051346740.1\|4110856_4111822_+	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_165125878.1\|4113831_4115118_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_165129148.1\|4115114_4115897_-	EamA family transporter	NA	NA	NA	NA
WP_165125881.1\|4116962_4118021_-	fatty acid desaturase family protein	NA	NA	NA	NA
WP_084518813.1\|4126961_4127183_-	hypothetical protein	A0A1X9SH55	Bradyrhizobium_phage	5.0e-11	65.5
WP_029084971.1\|4129916_4130099_+	hypothetical protein	NA	NA	NA	NA
WP_029084970.1\|4130821_4131427_+	response regulator	NA	NA	NA	NA
WP_165125884.1\|4132613_4133711_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_063619008.1\|4134474_4135158_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_035978447.1\|4135278_4135902_+	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_165125887.1\|4136148_4137501_+	oxygen-independent coproporphyrinogen III oxidase	NA	NA	NA	NA
WP_029085164.1\|4138239_4140585_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_029085215.1\|4143862_4144714_+	hypothetical protein	NA	NA	NA	NA
WP_084518863.1\|4145494_4145674_-	hypothetical protein	NA	NA	NA	NA
WP_165125890.1\|4145643_4145766_-\|transposase	transposase	NA	NA	NA	NA
WP_165125893.1\|4145903_4146182_-\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	3.6e-06	55.6

DBSCAN-SWA_7

5383627 : 5450967

Bradyrhizobium_phage(14.29%)

integrase,transposase,tRNA

attL 5377438:5377456|attR 5450898:5450916

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5377438:5377456	attL	NA	NA	NA	NA
WP_029077859.1\|5383627_5385268_-\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_165126531.1\|5385447_5386485_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_029077861.1\|5386576_5387167_-	SCO family protein	NA	NA	NA	NA
WP_029077862.1\|5387183_5387372_-	hypothetical protein	NA	NA	NA	NA
WP_029077863.1\|5387502_5387970_-	hypothetical protein	A0A1X9SH89	Bradyrhizobium_phage	1.4e-15	40.7
WP_029077864.1\|5388247_5389906_+	FAD-binding dehydrogenase	NA	NA	NA	NA
WP_029077865.1\|5390121_5390739_+	hypothetical protein	NA	NA	NA	NA
WP_165126534.1\|5390992_5391361_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_029077868.1\|5393002_5393926_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_029077869.1\|5394069_5394420_+	RidA family protein	NA	NA	NA	NA
WP_051345953.1\|5394511_5395453_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_165126537.1\|5395854_5396922_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_029077871.1\|5397028_5397937_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029077872.1\|5398041_5398731_+	RNA polymerase sigma factor	NA	NA	NA	NA
WP_029077873.1\|5398825_5399347_+	DUF4142 domain-containing protein	NA	NA	NA	NA
WP_029077874.1\|5399358_5399679_+	amicyanin	NA	NA	NA	NA
WP_029077875.1\|5399772_5400135_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_029077876.1\|5400260_5401058_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_165126540.1\|5401166_5402336_+	cytochrome P450	NA	NA	NA	NA
WP_029077878.1\|5402342_5403272_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
WP_029077879.1\|5403297_5404464_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
WP_029077880.1\|5404710_5405730_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_084518239.1\|5406280_5406523_-	DUF3551 domain-containing protein	NA	NA	NA	NA
WP_165126543.1\|5407275_5409039_+	modification methylase EcaI	A0A2L1IZ21	Streptomyces_phage	3.7e-117	47.1
WP_165126546.1\|5409679_5410972_-	beta-lactamase family protein	NA	NA	NA	NA
WP_165126549.1\|5411631_5411895_-	hypothetical protein	NA	NA	NA	NA
WP_165126552.1\|5412552_5413008_+\|transposase	transposase	A0A1B0YZU7	Pseudomonas_phage	3.4e-06	61.4
WP_165126555.1\|5413271_5413871_+	hypothetical protein	NA	NA	NA	NA
WP_165126558.1\|5413974_5414193_+	DUF3768 domain-containing protein	NA	NA	NA	NA
WP_165129196.1\|5414645_5416118_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	3.0e-96	41.8
WP_092304020.1\|5416240_5416597_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.9e-13	33.3
WP_165125874.1\|5416593_5417031_-\|transposase	transposase	NA	NA	NA	NA
WP_165126561.1\|5417643_5418297_-	hypothetical protein	NA	NA	NA	NA
WP_165126564.1\|5418686_5419091_-	hypothetical protein	NA	NA	NA	NA
WP_165126567.1\|5419106_5419787_-	hypothetical protein	NA	NA	NA	NA
WP_165126570.1\|5420406_5421570_-	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_165126573.1\|5421907_5422153_+	hypothetical protein	NA	NA	NA	NA
WP_165126576.1\|5422305_5422626_+	DUF3768 domain-containing protein	L7TKV8	Rhizobium_phage	2.0e-16	44.0
WP_165126579.1\|5423608_5425474_-	ATP-binding protein	NA	NA	NA	NA
WP_165126582.1\|5425460_5426495_-	hypothetical protein	NA	NA	NA	NA
WP_165129198.1\|5427586_5429053_+	SAM-dependent DNA methyltransferase	NA	NA	NA	NA
WP_165126585.1\|5429036_5429996_+	hypothetical protein	NA	NA	NA	NA
WP_165126588.1\|5430047_5431757_+	hypothetical protein	NA	NA	NA	NA
WP_165126591.1\|5432048_5433095_-\|integrase	site-specific integrase	A0A2D2W4Z2	Ralstonia_phage	5.8e-17	32.6
WP_165126594.1\|5433218_5433467_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_165126597.1\|5433914_5435633_+	hypothetical protein	NA	NA	NA	NA
WP_165126600.1\|5435895_5437089_+	hypothetical protein	NA	NA	NA	NA
WP_165126603.1\|5437203_5438172_-	recombinase family protein	NA	NA	NA	NA
WP_165126606.1\|5439368_5440409_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_165126609.1\|5440415_5442686_-	terpene cyclase/mutase family protein	NA	NA	NA	NA
WP_165126612.1\|5442733_5443498_-	terpene cyclase/mutase family protein	NA	NA	NA	NA
WP_165126615.1\|5444429_5444648_-	hypothetical protein	NA	NA	NA	NA
WP_165126618.1\|5445153_5446506_+	hypothetical protein	NA	NA	NA	NA
WP_165126621.1\|5446870_5447503_+	hypothetical protein	NA	NA	NA	NA
WP_165126624.1\|5447845_5448610_+	ThiF family adenylyltransferase	NA	NA	NA	NA
WP_165126627.1\|5448666_5449131_+	hypothetical protein	NA	NA	NA	NA
WP_165126630.1\|5449182_5449869_+	hypothetical protein	NA	NA	NA	NA
WP_165126633.1\|5450444_5450786_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_165126636.1\|5450796_5450967_-\|transposase	IS3 family transposase	NA	NA	NA	NA
5450898:5450916	attR	NA	NA	NA	NA

DBSCAN-SWA_8

8142337 : 8185411

Shigella_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165124207.1\|8142337_8142739_+\|transposase	transposase	Q76S41	Shigella_phage	8.8e-06	52.7
WP_165124204.1\|8142735_8143083_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.1e-33	57.5
WP_165124201.1\|8143129_8144782_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.5e-64	33.5
WP_165128023.1\|8144766_8145138_-	hypothetical protein	NA	NA	NA	NA
WP_029085035.1\|8146252_8148214_-	glycoside hydrolase family 127 protein	NA	NA	NA	NA
WP_165123021.1\|8148872_8149220_+	hypothetical protein	NA	NA	NA	NA
WP_029085033.1\|8149520_8150204_-\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_029085032.1\|8150490_8151639_-	N-methyl-L-tryptophan oxidase	NA	NA	NA	NA
WP_165128013.1\|8151808_8152381_-	hypothetical protein	NA	NA	NA	NA
WP_029085031.1\|8152454_8152673_-	hypothetical protein	NA	NA	NA	NA
WP_029085079.1\|8156099_8156321_-	hypothetical protein	NA	NA	NA	NA
WP_156929100.1\|8156845_8157271_-	hypothetical protein	NA	NA	NA	NA
WP_084518836.1\|8157824_8158091_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_029085083.1\|8159759_8159951_+	hypothetical protein	NA	NA	NA	NA
WP_092304020.1\|8162227_8162584_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.9e-13	33.3
WP_165123109.1\|8162580_8163018_-\|transposase	transposase	NA	NA	NA	NA
WP_029085263.1\|8164199_8164523_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_029085234.1\|8166454_8166982_+	RidA family protein	NA	NA	NA	NA
WP_156929149.1\|8167230_8167422_+	hypothetical protein	NA	NA	NA	NA
WP_029085235.1\|8167956_8168376_-	hypothetical protein	NA	NA	NA	NA
WP_165128025.1\|8168650_8169997_-\|transposase	IS5 family transposase	K4ICS3	Acidithiobacillus_phage	4.2e-44	41.3
WP_165123022.1\|8172949_8173543_+	Flp family type IVb pilin	NA	NA	NA	NA
WP_165129317.1\|8174659_8174947_-	hypothetical protein	NA	NA	NA	NA
WP_029085131.1\|8175590_8175902_-	hypothetical protein	NA	NA	NA	NA
WP_029085130.1\|8176030_8177164_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_063619010.1\|8177353_8177620_-	hypothetical protein	NA	NA	NA	NA
WP_156929153.1\|8178037_8178319_-	hypothetical protein	NA	NA	NA	NA
WP_156929097.1\|8180964_8181294_-	hypothetical protein	NA	NA	NA	NA
WP_029085060.1\|8185273_8185411_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_9

8238689 : 8263095

Burkholderia_virus(25.0%)

capsid,transposase,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165128065.1\|8238689_8239802_+\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_029084510.1\|8239831_8240155_+	hypothetical protein	NA	NA	NA	NA
WP_156928974.1\|8240270_8241488_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	2.3e-17	27.0
WP_156929136.1\|8243312_8244197_+	type III secretion protein	NA	NA	NA	NA
WP_165128067.1\|8244234_8245287_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_165128069.1\|8245329_8245674_-	hypothetical protein	NA	NA	NA	NA
WP_029084774.1\|8245686_8245998_-	hypothetical protein	K7PM05	Enterobacterial_phage	1.1e-11	37.5
WP_165128071.1\|8245994_8247605_-\|terminase	terminase large subunit	K7P7T5	Enterobacteria_phage	1.2e-101	44.3
WP_051346768.1\|8247558_8247981_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_165128073.1\|8248797_8249490_-	ParB N-terminal domain-containing protein	K4HZA5	Acidithiobacillus_phage	2.0e-29	49.3
WP_165128075.1\|8249750_8250074_+	hypothetical protein	NA	NA	NA	NA
WP_165128077.1\|8250464_8251190_+	hypothetical protein	NA	NA	NA	NA
WP_165128079.1\|8251168_8251495_+	hypothetical protein	NA	NA	NA	NA
WP_156929034.1\|8251595_8251823_-	hypothetical protein	NA	NA	NA	NA
WP_029084777.1\|8252319_8253207_+	hypothetical protein	NA	NA	NA	NA
WP_165128081.1\|8254964_8255585_+	hypothetical protein	NA	NA	NA	NA
WP_165128083.1\|8262222_8263095_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_10

8360682 : 8450947

Stx2-converting_phage(20.0%)

protease,transposase,integrase

attL 8431292:8431315|attR 8464297:8464320

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165124207.1\|8360682_8361084_+\|transposase	transposase	Q76S41	Shigella_phage	8.8e-06	52.7
WP_165124204.1\|8361080_8361428_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.1e-33	57.5
WP_165124201.1\|8361474_8363127_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.5e-64	33.5
WP_029084862.1\|8365711_8366089_-	hypothetical protein	NA	NA	NA	NA
WP_165128133.1\|8366358_8366571_-	hypothetical protein	NA	NA	NA	NA
WP_035978291.1\|8368026_8368533_-	avidin	NA	NA	NA	NA
WP_165129323.1\|8370582_8371221_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_165128135.1\|8371129_8371705_-	hypothetical protein	NA	NA	NA	NA
WP_165128137.1\|8374241_8375645_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.6e-20	35.3
WP_165128139.1\|8377318_8378074_+	hypothetical protein	NA	NA	NA	NA
WP_165128141.1\|8380255_8381014_+	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	1.7e-05	43.3
WP_165128143.1\|8382118_8383147_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_165128145.1\|8383460_8383868_-	hypothetical protein	NA	NA	NA	NA
WP_165128147.1\|8383828_8384680_-	hypothetical protein	NA	NA	NA	NA
WP_165128149.1\|8385717_8386536_+\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
WP_165128151.1\|8388588_8389791_+	cytochrome P450	NA	NA	NA	NA
WP_029084614.1\|8389883_8391173_+	cytochrome P450	NA	NA	NA	NA
WP_029084613.1\|8391174_8391483_+	ferredoxin	NA	NA	NA	NA
WP_165128153.1\|8391469_8392306_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.1e-13	30.4
WP_029084611.1\|8392305_8393649_+	cytochrome P450	S4VQU1	Pandoravirus	8.0e-11	33.3
WP_029084610.1\|8393797_8394793_+	farnesyl-diphosphate synthase	NA	NA	NA	NA
WP_029084609.1\|8394863_8395088_+	hypothetical protein	NA	NA	NA	NA
WP_029084608.1\|8395084_8396635_+	hypothetical protein	NA	NA	NA	NA
WP_029084607.1\|8396631_8397534_+	hypothetical protein	NA	NA	NA	NA
WP_165128155.1\|8400290_8403950_+	hypothetical protein	NA	NA	NA	NA
WP_165129325.1\|8404682_8407391_-	hypothetical protein	NA	NA	NA	NA
WP_084518847.1\|8411237_8411930_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_156929106.1\|8413650_8413809_-	hypothetical protein	NA	NA	NA	NA
WP_156929107.1\|8413872_8414505_-	hypothetical protein	NA	NA	NA	NA
WP_165128157.1\|8418609_8419095_+\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	1.9e-07	36.9
WP_165128159.1\|8419075_8419429_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	6.1e-19	45.2
WP_165128161.1\|8423773_8427022_-	CusA/CzcA family heavy metal efflux RND transporter	NA	NA	NA	NA
WP_165128163.1\|8427025_8428186_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_029084808.1\|8428196_8428478_-	metal-sensing transcriptional repressor	NA	NA	NA	NA
8431292:8431315	attL	NA	NA	NA	NA
WP_165128165.1\|8431473_8433708_+	hypothetical protein	NA	NA	NA	NA
WP_165128167.1\|8433977_8438315_+	hypothetical protein	NA	NA	NA	NA
WP_029085048.1\|8440227_8440527_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_165129327.1\|8440563_8440956_-	helicase	NA	NA	NA	NA
WP_029085049.1\|8440965_8441484_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_035978391.1\|8442781_8444539_-	E3 ubiquitin--protein ligase	NA	NA	NA	NA
WP_165128169.1\|8446643_8447078_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_165128171.1\|8447707_8447899_-	hypothetical protein	NA	NA	NA	NA
WP_165128173.1\|8448175_8448421_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_165128175.1\|8449702_8450947_+\|integrase	site-specific integrase	A0A221SAN4	Ralstonia_phage	1.2e-37	28.8
8464297:8464320	attR	NA	NA	NA	NA

DBSCAN-SWA_11

9428110 : 9436161

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029078031.1\|9428110_9428842_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-13	27.2
WP_029078030.1\|9428825_9429530_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-12	26.1
WP_029078029.1\|9429680_9429947_-	hypothetical protein	NA	NA	NA	NA
WP_051345956.1\|9429994_9430498_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029078027.1\|9430490_9431150_-	aldolase	A0A077SK32	Escherichia_phage	4.4e-47	47.8
WP_029078026.1\|9431306_9432218_+	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.4e-67	49.2
WP_029078025.1\|9432230_9433013_+	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_165128689.1\|9433009_9434299_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.3e-71	40.9
WP_029078023.1\|9434469_9436161_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.3e-12	31.3

DBSCAN-SWA_12

9706411 : 9713769

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_051346461.1\|9706411_9707656_+	glycosyltransferase family 92 protein	E3T539	Cafeteria_roenbergensis_virus	1.6e-13	32.8
WP_029082374.1\|9708002_9708557_-	hypothetical protein	NA	NA	NA	NA
WP_029082373.1\|9708783_9709851_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	2.8e-91	51.4
WP_029082372.1\|9709840_9710752_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	6.5e-97	61.1
WP_029082371.1\|9710861_9711416_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.4e-48	52.5
WP_029082370.1\|9711415_9712327_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-28	34.8
WP_029082369.1\|9712461_9713769_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	6.5e-82	40.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049289

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection