CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP049776	Enterococcus faecalis strain ES-1 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	2	0
NZ_CP049775	Enterococcus faecalis strain ES-1 chromosome, complete genome	1 crisprs	csa3,cas3,cas14j,DinG,DEDDh	3	4	8	1
NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	1 crisprs	NA	0	4	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1141 : 66154

Streptococcus_phage(61.54%)

integrase,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002362416.1\|1141_1810_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002362413.1\|3778_4336_+	hypothetical protein	NA	NA	NA	NA
WP_000119405.1\|4256_5519_-	plasmid recombination protein	NA	NA	NA	NA
WP_002415230.1\|5808_6456_-	type A chloramphenicol O-acetyltransferase	A0A1X9I6V6	Streptococcus_phage	5.1e-72	57.7
WP_001574277.1\|7497_8874_-	tetracycline efflux MFS transporter Tet(L)	NA	NA	NA	NA
WP_001574275.1\|9067_10987_-	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	95.0
WP_001791010.1\|11002_11119_-	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_001224319.1\|11363_12296_-	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	1.1e-171	100.0
WP_033918023.1\|12292_13294_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	7.2e-190	99.4
WP_001574271.1\|13290_15468_-	YtxH domain-containing protein	A0A1S5SF30	Streptococcus_phage	2.4e-307	85.6
WP_000331160.1\|15470_17918_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
WP_000506270.1\|17901_18408_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
WP_000342539.1\|18382_18880_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
WP_001009056.1\|18996_19218_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_165548710.1\|19260_20466_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	9.1e-232	99.5
WP_000879507.1\|20488_20641_-	hypothetical protein	NA	NA	NA	NA
WP_000813488.1\|20643_22029_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000985015.1\|22057_22444_-	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000420682.1\|22459_22774_-	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_002362410.1\|23350_25510_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002362409.1\|25542_25815_+	LtrD	NA	NA	NA	NA
WP_002362408.1\|26060_26417_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_033918025.1\|26417_28103_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_002367698.1\|28135_28486_+	hypothetical protein	NA	NA	NA	NA
WP_094467209.1\|29002_29542_-	PcfJ	A8ATM0	Listeria_phage	3.6e-31	36.8
WP_001015311.1\|29706_30388_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_002307645.1\|30451_30637_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002405073.1\|30633_30858_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_010821298.1\|30841_31645_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002405071.1\|31801_32416_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_002405070.1\|32431_32797_+	hypothetical protein	NA	NA	NA	NA
WP_002405069.1\|32780_33212_+	hypothetical protein	NA	NA	NA	NA
WP_002405068.1\|33222_34809_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_002294790.1\|34836_35517_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-36	37.4
WP_002294791.1\|35516_36911_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.2e-39	32.8
WP_002307659.1\|36925_37132_+	hypothetical protein	NA	NA	NA	NA
WP_002328844.1\|37161_37749_+	YdhK family protein	NA	NA	NA	NA
WP_002405064.1\|40798_41254_+	copper-responsive transcriptional repressor TcrY	NA	NA	NA	NA
WP_002335389.1\|43815_44022_+	copper chaperone TcrZ	NA	NA	NA	NA
WP_002346660.1\|44160_46293_+	copper-translocating P-type ATPase TcrB	E4ZFI9	Streptococcus_phage	2.3e-60	29.4
WP_002294569.1\|46424_47045_+	adenylate kinase	A0A2K9L833	Tupanvirus	1.4e-10	34.4
WP_002294566.1\|47116_47551_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002405059.1\|47620_47962_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002405058.1\|47974_48157_+	hypothetical protein	NA	NA	NA	NA
WP_033918028.1\|48335_48950_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.5e-17	32.3
WP_002344895.1\|49318_50320_-	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_002344896.1\|50478_50745_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002344897.1\|50734_51091_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_165548712.1\|51225_51906_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	7.6e-127	98.7
WP_033918030.1\|52117_55267_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	2.4e-21	23.1
WP_033918032.1\|56511_58107_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.5e-125	50.9
WP_002405179.1\|59291_59894_-	hypothetical protein	NA	NA	NA	NA
WP_033918033.1\|59924_61700_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_104885698.1\|61915_63041_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.3e-74	54.1
WP_002405176.1\|63223_63919_-	Fic family protein	NA	NA	NA	NA
WP_002405175.1\|63967_64567_-\|integrase	tyrosine-type recombinase/integrase	D2XR58	Bacillus_phage	3.2e-28	35.6
WP_094467193.1\|65015_66154_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	6.7e-75	53.7

DBSCAN-SWA_2

74816 : 84625

Streptococcus_phage(70.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002321849.1\|74816_75554_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	3.7e-135	100.0
WP_001814874.1\|75678_75762_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002368882.1\|75782_76052_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	7.6e-22	81.5
WP_010710189.1\|76873_77554_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	4.9e-126	98.7
WP_002415429.1\|77587_78094_-	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1
WP_002326830.1\|78390_78708_-	hypothetical protein	A0A1W6JN36	Lactococcus_phage	3.5e-26	79.4
WP_002332783.1\|79147_80011_-	toxin zeta	NA	NA	NA	NA
WP_002326825.1\|80012_80285_-	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.4e-07	96.7
WP_001835296.1\|80302_80518_-	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_032458614.1\|80609_81464_-	ParA family protein	A0A1X9I765	Streptococcus_phage	2.3e-152	97.9
WP_024408862.1\|82038_82776_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	4.8e-135	99.6
WP_001814874.1\|82900_82984_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_002358205.1\|83415_83787_-	hypothetical protein	NA	NA	NA	NA
WP_000239313.1\|83779_84625_-	ParA family protein	F0PIG8	Enterococcus_phage	3.1e-53	42.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP049775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049775_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049775_1

1790705-1790922

Orphan

NA:II-A,II-B

Consensus_repeat	Method
AAACAACATGACTCTAAAAC	CRT
CCAAGCGTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	PILER-CR
GTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP049775_1

>merge|NZ_CP049775|1|1790705-1790922|CRT,PILER-CR,CRISPRCasFinder
TAACAACATGGCTATAAAACAGGGGAGAAAAAGCCAAATCAAAAAAGTTTGTTTTGGTACCATTCCAAACAACATGACTCTAAAACTGCTCGCAGTTTCCGCTCGAACTGCTTTTCGTTTTGGTACCATTCCAAACAACATGACTCTAAAACATTAACGTAGTTGATTCAGAAAAACCAAGCGTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_CP049775|1|1|1790705-1790922|CRT
TAACAACATGGCTATAAAAC	AGGGGAGAAAAAGCCAAATCAAAAAAGTTTGTTTTGGTACCATTCC
AAACAACATGACTCTAAAAC	TGCTCGCAGTTTCCGCTCGAACTGCTTTTCGTTTTGGTACCATTCC
AAACAACATGACTCTAAAAC	ATTAACGTAGTTGATTCAGAAAAACCAAGCGTTTTGGTACCATTCT
AAACAACATGACTCTAAAAC

>NZ_CP049775|1|1|1790755-1790922|PILER-CR
GTTTTGGTACCATTCCAAACAACATGACTCTAAAACTGCTCG	CAGTTTCCGCTCGAACTGCTTTTC
GTTTTGGTACCATTCCAAACAACATGACTCTAAAACATTAAC	GTAGTTGATTCAGAAAAACCAAGC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_CP049775|1|1|1790755-1790922|CRISPRCasFinder
GTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	TGCTCGCAGTTTCCGCTCGAACTGCTTTTC
GTTTTGGTACCATTCCAAACAACATGACTCTAAAAC	ATTAACGTAGTTGATTCAGAAAAACCAAGC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049775.1\|WP_002362075.1\|1797354_1798479_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_CP049775.1\|WP_002356963.1\|1795404_1795920_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
NZ_CP049775.1\|WP_002381711.1\|1776589_1777339_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP049775.1\|WP_002360016.1\|1782265_1783171_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP049775.1\|WP_002356965.1\|1794702_1795272_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP049775.1\|WP_165548551.1\|1791079_1791943_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP049775.1\|WP_002356976.1\|1787853_1788867_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP049775.1\|WP_002356966.1\|1794239_1794605_-\|DUF1033-family-protein	unknown	unknown	gnl\|CDD\|336361
NZ_CP049775.1\|WP_165548548.1\|1781025_1782237_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP049775.1\|WP_165548553.1\|1795936_1797175_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP049775.1\|WP_165548550.1\|1784352_1786119_-\|thiol-reductant-ABC-exporter-subunit-CydC	unknown	unknown	gnl\|CDD\|227320
NZ_CP049775.1\|WP_002364244.1\|1777456_1778158_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP049775.1\|WP_002378476.1\|1783292_1784273_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP049775.1\|WP_002356959.1\|1798704_1799049_-\|DUF1831-domain-containing-protein	unknown	unknown	gnl\|CDD\|370163
NZ_CP049775.1\|WP_002356974.1\|1788863_1790282_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP049775.1\|WP_010708822.1\|1792027_1794109_-\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP049775.1\|WP_002364367.1\|1778288_1780712_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
NZ_CP049775.1\|WP_002379587.1\|1800418_1801393_-\|ribose-phosphate-diphosphokinase	unknown	unknown	gnl\|CDD\|235039
NZ_CP049775.1\|WP_023894458.1\|1786115_1787849_-\|thiol-reductant-ABC-exporter-subunit-CydD	unknown	unknown	gnl\|CDD\|274323
NZ_CP049775.1\|WP_023894461.1\|1799116_1800262_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029

Protein	Function_ID	Function_description	E-value
NZ_CP049775.1\|WP_002362075.1\|1797354_1798479_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_CP049775.1\|WP_002356963.1\|1795404_1795920_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	5.73504e-32
NZ_CP049775.1\|WP_002381711.1\|1776589_1777339_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	2.63593e-110
NZ_CP049775.1\|WP_002360016.1\|1782265_1783171_-\|prenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	8.82053e-105
NZ_CP049775.1\|WP_002356965.1\|1794702_1795272_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	2.91104e-15
NZ_CP049775.1\|WP_165548551.1\|1791079_1791943_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.54197e-26
NZ_CP049775.1\|WP_002356976.1\|1787853_1788867_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	9.60464e-103
NZ_CP049775.1\|WP_002356966.1\|1794239_1794605_-\|DUF1033-family-protein	gnl\|CDD\|336361	pfam06279, DUF1033, Protein of unknown function (DUF1033). This family consists of several hypothetical bacterial proteins. Many of the sequences in this family are annotated as putative DNA binding proteins but the function of this family is unknown.	4.62165e-64
NZ_CP049775.1\|WP_165548548.1\|1781025_1782237_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	8.20436e-122
NZ_CP049775.1\|WP_165548553.1\|1795936_1797175_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.03402e-172
NZ_CP049775.1\|WP_165548550.1\|1784352_1786119_-\|thiol-reductant-ABC-exporter-subunit-CydC	gnl\|CDD\|227320	COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].	0
NZ_CP049775.1\|WP_002364244.1\|1777456_1778158_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.52313e-37
NZ_CP049775.1\|WP_002378476.1\|1783292_1784273_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	4.36842e-80
NZ_CP049775.1\|WP_002356959.1\|1798704_1799049_-\|DUF1831-domain-containing-protein	gnl\|CDD\|370163	pfam08866, DUF1831, Putative amino acid metabolism. Solution of the structure of the Lactobacillus plantarum protein from this family has indicated a potential new fold with remote similarities to TBP-like (TATA-binding protein) structures. This similarity, in combination with genomic context analysis, leads us to propose an involvement in amino-acid metabolism. The potentially novel fold is an alpha + beta fold comprising two beta sheets packed against a single helix. The enzyme is present in the cytosol.	1.33245e-53
NZ_CP049775.1\|WP_002356974.1\|1788863_1790282_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP049775.1\|WP_010708822.1\|1792027_1794109_-\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP049775.1\|WP_002364367.1\|1778288_1780712_-\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	7.68936e-175
NZ_CP049775.1\|WP_002379587.1\|1800418_1801393_-\|ribose-phosphate-diphosphokinase	gnl\|CDD\|235039	PRK02458, PRK02458, ribose-phosphate pyrophosphokinase; Provisional.	0
NZ_CP049775.1\|WP_023894458.1\|1786115_1787849_-\|thiol-reductant-ABC-exporter-subunit-CydD	gnl\|CDD\|274323	TIGR02857, transport_ATP-binding_protein, thiol reductant ABC exporter, CydD subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD.	0
NZ_CP049775.1\|WP_023894461.1\|1799116_1800262_-\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	3.35117e-177

>NZ_CP049775.1|WP_002356974.1|1788863_1790282_-|cytochrome-ubiquinol-oxidase-subunit-I
MFDIVTLARIQFAMTTVFHFFFVPFSIGLALVVAIMETMYVVKKEERYRKMAKFWGNIFLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFFLESTFLGLWIFTWDKMNPKVHVTFIWLVVFGSMMSAFWILVANSFMQHPVGYVINNGRAEMVDFVAVISNPKVWYEFSHVIMGAFTLGGMAVAGMAAFQLLKKRDISFHKASMRIGLWVTLFGSIGVLLAGDLQMKALIEGQPMKFAAMEGAYEDSDDPAAWTLIAWADEREHKQVFGIDIPYMLSILSYNKLSGSVDGMDTVNKRLVEKYGDDKNYYPPVNTLFWSFRIMAGFGALMLLVAALGLFFTRKKKPSLYEKKWMLWIVALCTFAPFLANTTGWLVTELGRYPWTVYGLFTIEQSVSPNVSVASLITSNVIYFLLFAGLGSVMVYLVILELRKGPDYEAKKLAKENEPALDPFDKGVFGE
>NZ_CP049775.1|WP_002356976.1|1787853_1788867_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MSTLQLLWFVLIGVLFSGFFFLEGFDFGVGMAVQTLAHNDDEKDQVVATIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLILFTILFGLIIRGVSFEFRHNMPEGKRRRMWNWTLSIGSFLVPFFFGILFISLVQGMPLDANGNMHAQFTDYFNLFSIVGGVALTLLCYLHGMNYIALKTEGPIRERARNYAEILYGVLYVGLVVFAVLMYFKTDFYEKNFAVTLILTLAIVVLTVIANVGVFKRKEMLAFLASGLTLVVLVALLFSGLFPRVMIGSEGFDLLIKDATSTPYTLKIMTWISLSILPFVLAYTAWSYYIFRKRISQTAVPEGY
>NZ_CP049775.1|WP_023894458.1|1786115_1787849_-|thiol-reductant-ABC-exporter-subunit-CydD
MIDKDILQMPKIKKILVLLAGFSFLQAVFIIGQAFFLSKAIVGLWSGGHLNQQLQSILLFFIFYLGRHVITYFRERMLDTFSYERSKELREQLLTKIFRLGPNVVQKNGTGNMVTMALEGISQTENYLQLILTKMMNMMIIPWIILAFVFTQDIRSGVTLLIVFPIIIIFMIVLGYAAQSKADKQYAAFQMLSNHFIDSLRGIDTLKLFGLSKKYAGSIYHTSERFRKATMSTLKIAILSTFALDFFTTLSVAVVAVFLGLSLLNGTILLFPALVTLILAPEFFLPIRDFSSDYHATLDGKNSFQAIQAVLALPEAEQTDVLTLDDWHQESQLSVTALNFSYEDATQEAIQSLQFSVDGRKKIGIIGASGSGKSTLINLLSGFLLATEETSQLAINGQTIPHFLQKDWQKQILYIPQAPYIFQDTLANNIRFYTPEATDEAIQQAIQLVGLDELVKDLPEGIHTLIGESGRMLSGGQAQRVALARAFVDQKRHVLLFDEPTAHLDIETEVEMKERMLPLMNNHLVFFATHRLHWMEEMDYILVMEKGQLVEQGTLAELIEKDGYYVQLMKQMRGGRQ
>NZ_CP049775.1|WP_165548550.1|1784352_1786119_-|thiol-reductant-ABC-exporter-subunit-CydC
MMEKQPTTKDVWKNDQWVRPFLKRYKKTLYFALLLGFLTFFSAGALMFTSGYLISRAASLPENILLIYIPIVLTRAFGIGRPVFRYVERLTSHNWVLKMTSDLRLKLYNVLEKDAIFFKIKYRTGDILGLLSEDINHIQNLYLRTIFPTVIAWILYIFLVIALGFFSWWFALCMLLMLGVVVFLLPLVSVLVNGARQEKHKYAKNELYQTLTDNILGVSDWVFSQRGSEFVARYETDEANVRALDEKMKQFNRGRDFVLQLLFGVIAIAVLAWTSVRFPGNHGGAANWIGAFVLTVFPLIDAFAPLPAAAQETTIYKDSIRRFNELPEGEDDSTEAPVQPNGTSLSIEHLSFAYENQEKKVLNDLSLTIPEKQKLAILGRSGSGKSTLASLIRGDLRPTSGEILLGNIPTEAFGETMTEYIGVMHQAPYLFRTTILNNIRIGREEASEAEVWAVLEKVGLKEMVTQLPEGLQTMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTTGLDPITEQQLLETFFEALKDKTVIWITHHLQGVTLMDQVIFIEDGQLEMSGTPEELLATNAHYQKLYRIDRGISSFEE
>NZ_CP049775.1|WP_002378476.1|1783292_1784273_+|polyprenyl-synthetase-family-protein
MNTFWKSFPDVERSLTETCELIEQTLHTRNEDIEEALVTLARSGGKLLRPAFFFLFAQLGDEEKQEKQQLLKIAASLEILHMATLIHDDIIDDSPLRRGAVTIQSQYGKDVAVYTGDLLFTEFFTLIADAMNGSEFMKINAQGMKRLLLGELDQMSHRFDRRMSIPAYLRSVNGKTAELFSLSCLEGAYFGHSSKEVQRLAKRIGRHIGIAFQVYDDILDYTADTETLKKPALEDLSQGVYTLPLLFAYQAAPDVFGPYLDKGRAITLEEAAEVAALVNDYHGVTEAQAFAKKVTNKAITDIQQLPDGTAKETLLSLTELLLHRSF
>NZ_CP049775.1|WP_002360016.1|1782265_1783171_-|prenyltransferase
MNREIFFELVELKAKTASVLPFLLGICFSWYQYGRLHVGYVLIFFIAMFIFNMAVDILDNYNDYHHATEVHDYKEKTNIIGRENLSLPLIRKMIFWMILVSALMGIGLSFIVGWPLLIMGLYCYLIGIFYSSGPKPLSSLPLGEVFSGFTMGFMITLICVYINTFEVFNWSAANLWGIFLVALPNTCYIANLMLANNICDLEEDENNKRYTLVHYLGKASSLKLFVGLNTIAMLAILLAVGLGLTPPTMLLMLLTLPFVRKQTQALLKEQVKSKTFVCAVKILAVGATAQVLFFAIGLWWL
>NZ_CP049775.1|WP_165548548.1|1781025_1782237_-|NAD(P)/FAD-dependent-oxidoreductase
MNKKHVVILGAGYAGLKTLRELQKGAKDVEITLVDRNNYHYEATDLHEVAAGTQPAEKITYNIMDVVDEKMTTFIQGTVKTIDAATQTVALEDGQTINYDYLVVSLGFESESFGIPGVQEHALQMVDVKTALNVYEHIQEQMRQYKATQNEEFLKIVVCGAGFTGIELLGSLVENKPKFAEIAGVSADQIQIYCVEAVTRLLPMFNEKLANYGVQLLKDSAIHLLLGKPIKEIKPGAVVYQDNEAGDLAELSAKTIIWTTGVSGSHVVGDSGFEARRGRVMVQPDLTDANHSNIYIIGDCSAVMDTETNRPYPTTAQIALKMGAHAAKNIQAQLKGEATKPFSFKSQGSVCSVGNTRALGIVGKTDIKGYPASFMKKIIMNKALFETGGTKEMMAKGRFDLYH
>NZ_CP049775.1|WP_002364367.1|1778288_1780712_-|DNA-translocase-FtsK
MAQKRATNKKKSTTKKKTKKQQQQQERLNYMFLGLIFILFGVFGLFRLGFLGTLLANCLRLVVGNTFPFAAILLILYGLLVMIYGKDFPLKRGRPIFGAVLIYISVLLFFHAFMFRNVSGSQPDILGNTWEFLQSDLKANQVTQNVGGGMIGALLYQGTYFLVAQFGSYLIATLLLLAGIFLMSMWDFQQIVDHFQSIQDRLSHVSAKSQARQEEKEAKRAAKKEAKAAERQAKIEAAAQQKLQERERMEQAAAERLTKTPVETHQPMVEEPAAPTPVQIDSFQQQNQAMPVPPIAATKPQREQEEEAADEAGVLEFEISEEAEDRDYQLPPTDLLDTIQATDQSGEYEKIEKNIGVLEQTFKSFGVDAKVVKASLGPSVTKFEVQPAVGVKVSKIVNLTDDIALALAAKDVRMEAPIPGKSLIGIEVPNSAISTVSFRDIVEAQPSHPDKLLEVPLGRDISGMVQTADLSKMPHLLIAGSTGSGKSVAINGIITGILMQAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTNPRKAAQALQKVVQEMEFRYEKFAATGVRNITGYNQLIQQKNAEDGENRPILPFIVVIVDELADLMMVASNEVEDAIIRLAQMARAAGIHMILATQRPSVDVITGIIKANVPSRMAFAVSSGTDSRTIIDTNGAEKLLGRGDMLFLPMGENKPIRIQGAFISDQEVERVVAFVTDQQEAEYQESMMPTDEPTTSGGGEAPQDELFEEAKNLVVEMQTASISLLQRRFRIGYNRAARLVDELEAHGVIGPSEGSKPRKVFLQAESEEAATETPEQ
>NZ_CP049775.1|WP_002364244.1|1777456_1778158_-|GntR-family-transcriptional-regulator
MRRKSVLYLEVADQIKEDILSGKYPVGTFLPTETELEELFNVSKITIRRAIEMLATEEFVEKKSGRGTTVLSNRPYNKLSKAGTFTEFLNESGQKVTKKVLQVENLTLSKEMPAYQFLGEEVVHLSRLYLIDEQPYIYFNYYLPAAMKDVSLTEYKEESLYRLMDRHAIEIYKFEDRFEVATLTEAEQKMLQTTETTGLKRIRRSLSPTGRCVEYSEAIYNTKIHPYVIEYEA
>NZ_CP049775.1|WP_002381711.1|1776589_1777339_-|ABC-transporter-ATP-binding-protein
MLEVQNLKKVYGNEIKYEALKGINLTVQDGEFIGIMGPSGSGKSTLLNLLATIDSPTDGEILLNGKNPNNLNQEQIAKFRRTELGFVFQSFNLMPTLTVEENIILPLTLDGEKVSVMKRQLAELSERLGINHLLKKRIAEISGGQAQRVAVARAMIHHPQLLLADEPTGNLDTKSSKDVMGLLQQLNEEEAATILMVTHDPLAASYCKRIVFIKDGELIDEIVQNGNQKEFYDLIMVKLAEIEGVDNEF
>NZ_CP049775.1|WP_165548551.1|1791079_1791943_-|AraC-family-transcriptional-regulator
MLANLNQAMDYIEEHLTEEVSFDELAKKTGISVYHFKRTFSFVAGMSLAEYIKKRRLVEANLALLAGEKVTDVAFKYGYQSIEGFSRAFRDWTGQAPSEVMKTQIQKTFPKFSFYIDIKGGQSMDVKLIEKPAFQIVGVSQKVPLQYQGENQAIMELAQRITPQQRAEMHTFDDVYPHQVVNASFDFQEGRTTEGGEMTHMIGFATSQENTYEDLEQLSVPAHTWAVFPNEGPFPQTLQETWARIFSEWLPSSGYQVVAAPEISFTQYQGPAEAKYSEIWLAVTATK
>NZ_CP049775.1|WP_010708822.1|1792027_1794109_-|DNA-topoisomerase-III
MVAKQLIIAEKPSVAKDLSRVLGANQKNKNYYEGPNVIVTWALGHLLGLKMPEDLNKEWQTWQMETLPMIPKNLGIKPLPKTGHQLKAIKQLANRKDVSEAVIATDAGREGELVARWILEYVRFNKPVKRLWISSQTDKAIKDGFKKIRPAKDYDNLYYSALARAKADWLVGLNVTRALTVKYQDNLSAGRVQTPTLAMVRQQEKTIEQFKPQTYFTISLSVESEKAKMTQKNPYALKERQEAEQLVKELSKQKGLVTDIQEKVKTENAPLPYDLTEIQREANQRFQFSAKKTLSLVQSLYETHKIVSYPRTDSKYLTTDMKGTMKERLQAIADFSPEVKGYLKNGAVVKQQKVFQNAKVTDHHGLIPTEQRPRYEKLSNDEQKIYQMIVQRFLGLFAEPNQTKQTKVTVAFGKETFVFHQNKVVVAGWKTTAEQPLSTVQWQKGMTVAPNFTINKELTSPPKPLTEGTLLGKMEKHSLGTPATRAEIIEKLIKSELMERTNSGLSISAKGKQLLDLVNPSLVTPELTEKWEKSLEAIASGQQKSQLFLKDIEEDTKKLVREIKQSEKKYQDFSITQKKCPDCGSNLREKNTKDGKIYVCTNQECSYRRRKDPKVSNHRCPQCHKKMVIIEGKNGRSFKCKFCSITEKIPDKKERKQKMTKHEERRLMKKYSQPDEPEESALAQALKAAMNQE
>NZ_CP049775.1|WP_002356966.1|1794239_1794605_-|DUF1033-family-protein
MYQVITMYGDNEPWWFFDDWQEDIVQEKTFDNLTDAETYYVEVWQKLSQNYTYVNTKPNYLTAFWNDGEERWCEECDEDLQQYFGLALLENHHAVTFENKAEFTTISNHFGKTKFCKRKVI
>NZ_CP049775.1|WP_002356965.1|1794702_1795272_-|TetR/AcrR-family-transcriptional-regulator
MAKKRNLTKAKILESARNLAEELGVQQLTFQNLAVDLGIKYPSLYNHFKNIAEVKNALVDLLIQELNDALRRALVGKSGAEAIRIYAETYQQFAFENSAVYELLISVPKTQNQQLIEGIHETNQIILQLLAFYPFNNEERLHKSRELRSLIHGYITLRFLGYFQREEATPEESYRRMIEDFIASLEVAG
>NZ_CP049775.1|WP_002356963.1|1795404_1795920_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MHITNRSHLADRYGKRTSAEFLLHERPILSFPISLAAIPKEARYLSWELIDYDTIPLIGFPFIHWLAANVPVTNEIPEDFSRTALKPTIQGKNSLASPLGKQMIPALATETLPELTERYLGLSPRSGVHTYTLYVYATKNPLNLKEGFFANELHQALNDQLLAKAKFEFLY
>NZ_CP049775.1|WP_165548553.1|1795936_1797175_+|multidrug-efflux-MFS-transporter
MYELIKSKIFRPRQPWEKNLLVLWFGTFMAGIGFSLVMPFMPLYINTLGTFTHQQLNFWSGITFSSTFLVTTIVSPWWGRLADRKGRKLMLLRASLGMAIVISLMGAVTSVYQLIGLRLLQGVFSGYISNATALVATGTPKEKSGQVLGTLATGSVTGTLLGPLLGGVTASIFGYRPTFFITGTILLLVFVLSLVFVHEEFVPIEKNQAASGKQILKKLEHPHVILGMFITTLIIQASNNSISPIISLYIQQLLGGHGNVTLISGVIASIPGIATLIAAPRFRRLGDRIGSERILTIGLILAIFVYLPMAFVQNVWQLAMLRFLVGISDACLLPAVQTLITRYSPSDAAGRIFSYNQSFQATGNVIGPMIGSSVSAAFGYRGVFISTSCLVLLNLLWVRRSTAELKKEKNDD
>NZ_CP049775.1|WP_002362075.1|1797354_1798479_-|tRNA-2-thiouridine(34)-synthase-MnmA
MADNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVAKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQLGADYVATGHYAQVETDENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGMEKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLPAKKGNMVTEDGEIKGQHDGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVHFTVDTPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVFYDGMECLGGGLIDRAYQDEKELQYV
>NZ_CP049775.1|WP_002356959.1|1798704_1799049_-|DUF1831-domain-containing-protein
MAFTTTAAVEGSTVFYKVHPSAKRYTLKDNGFTETKSGNFQLIRSLDPTPQRNEGFKLKITITADLKELKMSITTANGLKPMNIFKNEQHEMSKEKYFFLMDGLISRGVLEKVE
>NZ_CP049775.1|WP_023894461.1|1799116_1800262_-|cysteine-desulfurase
MEPIYLDHAATTPLHPTVIQAMTENMQTTFGNPSSIHQFGRKAHGLLEEVRQTIAESLQAKPHEIIFNSGGTEGDNTAILAVAFSRQKEGEHIITTAIEHPAVLRTMEYLETLGFEVTYLPVNENGQISMDQFKKSLREETILVSMMYGNNEIGNRLPIAEVGAILKNHSAIFHTDAVQAYGSEVILPHELGIDLLSISAHKINGPKGVGFLFKSDAIQLPPLLHGGEQEEKRRAGTENLAGIIGMGTAVSLLTSAEKQARKTAYQSFQMIILKALEEANIDFSINGEPTNRLAHVLNLHLKGIPSDLLLMHLDLRGIAISTGSACTAGTVDPSHVLTAMYGENSSAIKESIRISFGYGNTPEEIATFSEVLVAVIQQLKK
>NZ_CP049775.1|WP_002379587.1|1800418_1801393_-|ribose-phosphate-diphosphokinase
MTENYQDDTLRIFSLNANRPLAEKIAASVGTELGKSTVRQFSDGEIQINIEESIRGDHVYIIQATNAPVNDHLMELLILIDALKRASAKTVNVILPYYGYARQDRTAKPREPITAKLVANMLVEAGATRLLTLDLHTVQVQGFFDIPVDNLFTMPLFAHYYRQQALVGEEIVIVSPKNSGVQRARSLSEYLDATLAIVDHEEIDGVRQEGYVIGNVAGKKCILVDDILNTGQTLATAAEVLMKNGAQEVYACASHGLLSEGAKATLENAPIKEISITDSVYTTADRQPATLNIISCAELMGEALLRIHENKPMSPLFRLEPKGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP049775_1	1.4\|1790797\|24\|NZ_CP049775\|PILER-CR	1790797-1790820	24	NZ_CP049775.1	927414-927437	1	0.958
NZ_CP049775_1	1.4\|1790797\|24\|NZ_CP049775\|PILER-CR	1790797-1790820	24	NZ_CP049775.1	2354715-2354738	1	0.958
NZ_CP049775_1	1.5\|1790863\|24\|NZ_CP049775\|PILER-CR	1790863-1790886	24	NZ_CP049775.1	2340369-2340392	0	1.0
NZ_CP049775_1	1.6\|1790791\|30\|NZ_CP049775\|CRISPRCasFinder	1790791-1790820	30	NZ_CP049775.1	927408-927437	1	0.967
NZ_CP049775_1	1.6\|1790791\|30\|NZ_CP049775\|CRISPRCasFinder	1790791-1790820	30	NZ_CP049775.1	2354715-2354744	1	0.967

1. spacer 1.4|1790797|24|NZ_CP049775|PILER-CR matches to position: 927414-927437, mismatch: 1, identity: 0.958

tgctcgcagtttccgctcgaactg	CRISPR spacer
tggtcgcagtttccgctcgaactg	Protospacer
** *********************

2. spacer 1.4|1790797|24|NZ_CP049775|PILER-CR matches to position: 2354715-2354738, mismatch: 1, identity: 0.958

tgctcgcagtttccgctcgaactg	CRISPR spacer
tggtcgcagtttccgctcgaactg	Protospacer
** *********************

3. spacer 1.5|1790863|24|NZ_CP049775|PILER-CR matches to position: 2340369-2340392, mismatch: 0, identity: 1.0

attaacgtagttgattcagaaaaa	CRISPR spacer
attaacgtagttgattcagaaaaa	Protospacer
************************

4. spacer 1.6|1790791|30|NZ_CP049775|CRISPRCasFinder matches to position: 927408-927437, mismatch: 1, identity: 0.967

tgctcgcagtttccgctcgaactgcttttc	CRISPR spacer
tggtcgcagtttccgctcgaactgcttttc	Protospacer
** ***************************

5. spacer 1.6|1790791|30|NZ_CP049775|CRISPRCasFinder matches to position: 2354715-2354744, mismatch: 1, identity: 0.967

tgctcgcagtttccgctcgaactgcttttc	CRISPR spacer
tggtcgcagtttccgctcgaactgcttttc	Protospacer
** ***************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049775_1	1.1\|1790725\|46\|NZ_CP049775\|CRT	1790725-1790770	46	MF157411	Escherichia coli strain EC1000 plasmid pCR2, complete sequence	288-333	0	1.0
NZ_CP049775_1	1.5\|1790863\|24\|NZ_CP049775\|PILER-CR	1790863-1790886	24	HG796796	Uncultured bacterium plasmid pRGF00045	2663-2686	2	0.917
NZ_CP049775_1	1.6\|1790791\|30\|NZ_CP049775\|CRISPRCasFinder	1790791-1790820	30	NZ_CP014003	Synechococcus sp. PCC 73109 plasmid unnamed5, complete sequence	12742-12771	5	0.833
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	HG796796	Uncultured bacterium plasmid pRGF00045	2663-2692	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	324412-324441	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	258608-258637	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	106037-106066	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	14249-14278	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	232571-232600	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	349574-349603	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	232572-232601	8	0.733
NZ_CP049775_1	1.7\|1790857\|30\|NZ_CP049775\|CRISPRCasFinder	1790857-1790886	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	232184-232213	8	0.733
NZ_CP049775_1	1.6\|1790791\|30\|NZ_CP049775\|CRISPRCasFinder	1790791-1790820	30	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	17579-17608	9	0.7

1. spacer 1.1|1790725|46|NZ_CP049775|CRT matches to MF157411 (Escherichia coli strain EC1000 plasmid pCR2, complete sequence) position: , mismatch: 0, identity: 1.0

aggggagaaaaagccaaatcaaaaaagtttgttttggtaccattcc	CRISPR spacer
aggggagaaaaagccaaatcaaaaaagtttgttttggtaccattcc	Protospacer
**********************************************

2. spacer 1.5|1790863|24|NZ_CP049775|PILER-CR matches to HG796796 (Uncultured bacterium plasmid pRGF00045) position: , mismatch: 2, identity: 0.917

attaacgtagttgattcagaaaaa	CRISPR spacer
attgatgtagttgattcagaaaaa	Protospacer
***.*.******************

3. spacer 1.6|1790791|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP014003 (Synechococcus sp. PCC 73109 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.833

-tgctcgcagtttccgctcgaactgcttttc	CRISPR spacer
gtgct-gcaatttccggtcgaactgctttat	Protospacer
 **** ***.****** ************ .

4. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to HG796796 (Uncultured bacterium plasmid pRGF00045) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
attgatgtagttgattcagaaaaagttgag	Protospacer
***.*.****************** . ..

5. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

6. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

7. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

8. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

9. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

10. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

11. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

12. spacer 1.7|1790857|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.733

attaacgtagttgattcagaaaaaccaagc	CRISPR spacer
gaaaacgtagttgtatcagaaaaacctgga	Protospacer
.  **********  *********** .*

13. spacer 1.6|1790791|30|NZ_CP049775|CRISPRCasFinder matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 9, identity: 0.7

tgctcgcagtttccgctcgaactgcttttc	CRISPR spacer
gtcgagcagtttccgctcgaactcctccga	Protospacer
  *  ****************** **..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

122534 : 187847

Streptococcus_phage(52.38%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002356123.1\|122534_123806_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.5e-93	45.3
WP_002370628.1\|123842_124757_-	alpha/beta hydrolase	Q9DHU9	Yaba-like_disease_virus	7.3e-16	26.3
WP_002356125.1\|124923_125403_-	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002387472.1\|125621_126134_+	ArgR family transcriptional regulator	NA	NA	NA	NA
WP_002356129.1\|126430_127657_+	arginine deiminase	NA	NA	NA	NA
WP_161299076.1\|127682_128705_+	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_002356132.1\|128810_129743_+	carbamate kinase	NA	NA	NA	NA
WP_002356133.1\|129767_130460_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002356134.1\|130507_131959_+	YfcC family protein	NA	NA	NA	NA
WP_002359260.1\|132049_132730_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_002356136.1\|132726_133062_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_010710971.1\|134467_136975_+	family 20 glycosylhydrolase	NA	NA	NA	NA
WP_070416003.1\|137259_138528_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
WP_002379245.1\|138577_139021_-	MepB family protein	NA	NA	NA	NA
WP_002370633.1\|139017_140430_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_023895193.1\|140527_141493_+	ornithine cyclodeaminase family protein	NA	NA	NA	NA
WP_002389645.1\|141494_142283_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_002385445.1\|142330_142876_-	ATP-binding protein	NA	NA	NA	NA
WP_002379241.1\|143043_143421_-	hypothetical protein	NA	NA	NA	NA
WP_070416004.1\|143430_145782_-	hypothetical protein	NA	NA	NA	NA
WP_002356158.1\|147238_148801_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.0e-18	29.5
WP_002356160.1\|149112_150036_-	type I pantothenate kinase	NA	NA	NA	NA
WP_002356161.1\|150190_150778_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_002356162.1\|150792_151401_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_070416005.1\|151433_152465_-	adenosine deaminase	NA	NA	NA	NA
WP_001015311.1\|152810_153491_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_113826336.1\|153518_153887_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_003744430.1\|154638_154950_+	arsenic metallochaperone ArsD family protein	NA	NA	NA	NA
WP_003744432.1\|154969_156709_+	arsenical pump-driving ATPase	NA	NA	NA	NA
WP_002333381.1\|156799_157093_+	winged helix-turn-helix transcriptional regulator	A0A2H4PQT4	Staphylococcus_phage	4.9e-14	42.2
WP_003744454.1\|158167_158347_+	hypothetical protein	NA	NA	NA	NA
WP_002372158.1\|158424_159360_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.8e-25	31.2
WP_003744460.1\|159352_160123_+	ABC transporter permease	NA	NA	NA	NA
WP_162782692.1\|160405_162043_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_001015311.1\|162289_162969_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
WP_165548391.1\|163030_163219_+	hypothetical protein	NA	NA	NA	NA
WP_002288897.1\|164685_165309_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	6.8e-13	30.2
WP_165548392.1\|165404_166083_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-127	99.1
WP_001808810.1\|166579_166744_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000384569.1\|166909_167107_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013438838.1\|167096_167711_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033626719.1\|167885_168803_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-43	47.6
WP_002367750.1\|168795_169545_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_002367748.1\|169544_170375_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_162499548.1\|170572_171253_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-116	90.7
WP_001814874.1\|171482_171566_+	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_104681337.1\|171690_172428_+	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.2e-133	99.2
WP_001096887.1\|172431_173226_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000868795.1\|175061_175559_+	trimethoprim-resistant dihydrofolate reductase DfrG	G3MBI7	Bacillus_virus	4.0e-40	49.1
WP_165548393.1\|175630_177583_-	insertion element protein	NA	NA	NA	NA
WP_165548682.1\|178100_179939_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.3e-271	99.6
WP_021732891.1\|180083_180938_+	ParA family protein	A0A1X9I765	Streptococcus_phage	1.1e-154	100.0
WP_001835296.1\|181029_181245_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_002333002.1\|181262_181535_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_002333003.1\|181536_182400_+	zeta-toxin	NA	NA	NA	NA
WP_002326773.1\|183103_183700_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_002326774.1\|184010_184892_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.3e-22	30.2
WP_002333004.1\|184915_186529_+	hypothetical protein	NA	NA	NA	NA
WP_010717848.1\|186600_187125_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.1e-36	44.4
WP_001015311.1\|187166_187847_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6

DBSCAN-SWA_2

726853 : 734767

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002364714.1\|726853_727906_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.1
WP_002355795.1\|727905_728862_+	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	3.2e-06	23.9
WP_070416138.1\|728902_729973_+	helix-turn-helix domain-containing protein	A0A288TXV8	Enterococcus_phage	2.6e-89	49.3
WP_002355797.1\|730371_730893_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.0e-14	33.3
WP_002355798.1\|731006_731207_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002355799.1\|731267_731627_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002385048.1\|731673_732054_-	hypothetical protein	NA	NA	NA	NA
WP_002361363.1\|732121_732481_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_165548409.1\|732548_733043_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_070416136.1\|733060_733576_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	6.5e-38	48.5
WP_002380126.1\|733591_734767_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.3e-85	47.7

DBSCAN-SWA_3

918479 : 951917

Enterococcus_phage(25.81%)

portal,capsid,tail,terminase,holin,integrase,protease

attL 918325:918343|attR 954510:954528

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
918325:918343	attL	NA	NA	NA	NA
WP_025193885.1\|918479_919610_-\|integrase	site-specific integrase	A8ATX2	Listeria_phage	2.7e-100	50.4
WP_016633414.1\|919693_920599_-	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_029681557.1\|920692_921088_-	hypothetical protein	NA	NA	NA	NA
WP_010708602.1\|921115_921457_-	helix-turn-helix transcriptional regulator	A0A141DZM2	Streptococcus_phage	2.8e-21	46.7
WP_002371609.1\|921746_921938_+	hypothetical protein	NA	NA	NA	NA
WP_002358109.1\|921950_922280_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_002358108.1\|922287_922476_+	hypothetical protein	A0A0S2MY96	Enterococcus_phage	2.7e-18	80.7
WP_016633416.1\|922542_922842_+	hypothetical protein	NA	NA	NA	NA
WP_002358104.1\|922838_923063_+	hypothetical protein	D2IZX4	Enterococcus_phage	2.2e-22	69.9
WP_010774955.1\|923065_923422_+	hypothetical protein	NA	NA	NA	NA
WP_016633417.1\|923512_924478_+	recombinase RecT	A0A1X9I5N6	Streptococcus_phage	1.2e-77	62.6
WP_016633418.1\|924440_925256_+	hypothetical protein	J7KGZ1	Streptococcus_phage	3.0e-61	50.6
WP_002402868.1\|925270_926050_+	DnaD domain protein	B4XYS6	Lactobacillus_phage	2.3e-42	63.4
WP_165548424.1\|926061_926901_+	ATP-binding protein	U5PVD6	Bacillus_phage	1.3e-19	32.1
WP_002402870.1\|927038_927308_+	hypothetical protein	NA	NA	NA	NA
WP_025193886.1\|927456_927921_+	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	1.7e-32	48.3
WP_016633421.1\|927940_928546_+	hypothetical protein	NA	NA	NA	NA
WP_016633422.1\|928561_928768_+	hypothetical protein	A0A1B1V001	Enterococcus_phage	1.3e-24	96.8
WP_002373959.1\|929430_929898_+	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	2.9e-08	27.8
WP_016633423.1\|930204_930711_-	hypothetical protein	NA	NA	NA	NA
WP_016633424.1\|931238_931508_+	hypothetical protein	NA	NA	NA	NA
WP_016633425.1\|931568_931883_+	hypothetical protein	NA	NA	NA	NA
WP_016633426.1\|931875_932187_+	HNH endonuclease	A0A1S5SFB3	Streptococcus_phage	4.0e-30	64.1
WP_154591510.1\|932191_932335_+	hypothetical protein	NA	NA	NA	NA
WP_033601507.1\|932470_932779_+\|terminase	terminase	D2XR14	Bacillus_phage	3.2e-16	50.0
WP_016630714.1\|932775_934458_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	8.0e-226	69.4
WP_002400743.1\|934491_934659_-	YjzC family protein	A0A0A7RTS6	Clostridium_phage	4.0e-13	74.0
WP_010828332.1\|934764_934932_+	hypothetical protein	NA	NA	NA	NA
WP_016630713.1\|934946_935129_+	hypothetical protein	NA	NA	NA	NA
WP_002396873.1\|935161_936325_+\|portal	phage portal protein	A0A059T6F0	Listeria_phage	1.8e-75	39.5
WP_016633428.1\|936311_937031_+\|protease	Clp protease ClpP	A0A2H4J8Y7	uncultured_Caudovirales_phage	2.7e-42	45.0
WP_016633429.1\|937027_938215_+\|capsid	phage major capsid protein	D2XR18	Bacillus_phage	7.2e-64	37.1
WP_002380686.1\|938291_938573_+	hypothetical protein	A0A2H4JAM0	uncultured_Caudovirales_phage	1.8e-13	48.8
WP_016633430.1\|938547_938934_+	hypothetical protein	A8ATA1	Listeria_phage	3.8e-30	54.3
WP_016633431.1\|938930_939335_+	phage protein, HK97 gp10 family	A0A2P0ZLD7	Lactobacillus_phage	2.0e-18	42.6
WP_016633432.1\|939331_939727_+	hypothetical protein	A0A059T681	Listeria_phage	1.5e-18	46.3
WP_016633433.1\|939759_940353_+\|tail	phage major tail protein, phi13 family	A0A060AKE9	Staphylococcus_phage	2.6e-22	35.1
WP_016633434.1\|940426_940900_+	Ig domain-containing protein	A0A1D6Z291	Staphylococcus_phage	3.9e-21	45.6
WP_016633435.1\|940956_941304_+	hypothetical protein	NA	NA	NA	NA
WP_010820079.1\|941525_946277_+\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	1.6e-13	42.2
WP_002371567.1\|946276_947176_+\|tail	phage tail family protein	D2J071	Enterococcus_phage	2.9e-49	37.4
WP_002371566.1\|947178_948303_+	hypothetical protein	Q77MU2	Lactococcus_phage	2.6e-87	45.0
WP_016633436.1\|948313_949369_+	hypothetical protein	D2J073	Enterococcus_phage	9.0e-50	37.0
WP_002381464.1\|949380_950169_+	hypothetical protein	D2IYX9	Enterococcus_phage	3.3e-41	71.6
WP_002358058.1\|950204_950603_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	1.6e-36	54.2
WP_095714931.1\|950657_951917_+	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	6.6e-225	91.6
954510:954528	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1129491 : 1147262

Enterococcus_phage(46.15%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002357859.1\|1129491_1131888_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.7e-19	24.1
WP_002360497.1\|1131912_1132263_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002382232.1\|1132635_1133121_-	toxin	A0A097BY56	Enterococcus_phage	4.4e-60	70.5
WP_002371257.1\|1133155_1133638_-	helix-turn-helix domain-containing protein	R9QTP6	Staphylococcus_phage	2.6e-20	47.7
WP_002394380.1\|1134032_1134788_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	6.7e-31	56.0
WP_010707651.1\|1134806_1135649_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	2.0e-31	31.0
WP_002360492.1\|1135715_1136108_+	hypothetical protein	NA	NA	NA	NA
WP_002360491.1\|1136127_1136535_+	RinA family phage transcriptional activator	NA	NA	NA	NA
WP_002382237.1\|1136756_1137173_+	hypothetical protein	NA	NA	NA	NA
WP_002366557.1\|1137185_1137698_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	8.8e-35	49.4
WP_002357848.1\|1137731_1138091_+	hypothetical protein	A0A0F6N4J9	Staphylococcus_phage	7.6e-09	32.2
WP_002382238.1\|1138183_1138477_+	hypothetical protein	NA	NA	NA	NA
WP_165548431.1\|1138466_1141400_+	hypothetical protein	W8EBC4	Geobacillus_phage	6.9e-15	41.2
WP_002365553.1\|1141401_1142328_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	9.0e-147	78.6
WP_165548432.1\|1142340_1143798_+	hypothetical protein	C9E2K6	Enterococcus_phage	5.5e-175	47.7
WP_016633492.1\|1143830_1145600_+	hypothetical protein	A0A097BYA8	Enterococcus_phage	5.2e-143	71.8
WP_002357842.1\|1145623_1146019_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	2.8e-33	48.9
WP_070415887.1\|1146137_1147262_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	7.8e-76	44.0

DBSCAN-SWA_5

1566651 : 1575297

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002360141.1\|1566651_1567224_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.2e-25	35.1
WP_085444218.1\|1567220_1568252_-	phosphoribosylformylglycinamidine cyclo-ligase	M4QRQ6	Synechococcus_phage	6.3e-56	45.2
WP_002382407.1\|1568253_1569693_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-49	33.0
WP_165548487.1\|1569668_1571888_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	8.2e-146	39.8
WP_002361952.1\|1571884_1572559_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002357271.1\|1572559_1572811_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_010822912.1\|1572824_1573538_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3ELR0	Synechococcus_phage	7.4e-48	42.5
WP_023895641.1\|1573691_1574816_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_002360132.1\|1574808_1575297_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.8e-19	42.0

DBSCAN-SWA_6

1713776 : 1769000

Enterococcus_phage(43.33%)

head,portal,tail,plate,tRNA,terminase,holin,integrase

attL 1748544:1748557|attR 1770801:1770814

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165548526.1\|1713776_1715546_-\|tRNA	aspartate--tRNA ligase	A0A2K9L424	Tupanvirus	3.0e-13	30.3
WP_002360033.1\|1715563_1716865_-\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	1.2e-22	26.6
WP_002383130.1\|1716861_1717083_-	hypothetical protein	NA	NA	NA	NA
WP_002357080.1\|1717222_1717669_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_002380422.1\|1717692_1719906_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.3e-10	38.0
WP_002357078.1\|1720120_1720873_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_002357075.1\|1720874_1721822_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_002383131.1\|1721837_1722332_-	DUF3013 family protein	NA	NA	NA	NA
WP_002364174.1\|1722279_1722957_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
WP_002360030.1\|1723085_1724363_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.8e-105	49.9
WP_002357068.1\|1724636_1724969_+	hypothetical protein	NA	NA	NA	NA
WP_165548527.1\|1725250_1725757_+	universal stress protein	NA	NA	NA	NA
WP_002357064.1\|1725868_1727056_-	acetate kinase	NA	NA	NA	NA
WP_002357063.1\|1727080_1728088_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_010825349.1\|1728216_1728570_-	hypothetical protein	NA	NA	NA	NA
WP_165548529.1\|1728569_1729004_-	ComGF family competence protein	NA	NA	NA	NA
WP_002370967.1\|1728993_1729320_-	type II secretion system protein	NA	NA	NA	NA
WP_002364185.1\|1730120_1731062_-	ferrochelatase	NA	NA	NA	NA
WP_002383136.1\|1731801_1732050_-	hypothetical protein	NA	NA	NA	NA
WP_002357053.1\|1732121_1732322_-	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-24	80.3
WP_165548531.1\|1733158_1734400_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	2.5e-168	71.4
WP_002384371.1\|1734400_1734634_-\|holin	phage holin	D2J020	Enterococcus_phage	1.9e-29	87.8
WP_002364191.1\|1734626_1734848_-	hypothetical protein	D2J019	Enterococcus_phage	2.5e-31	93.2
WP_002364192.1\|1734882_1735038_-	XkdX family protein	A0A1W6JQ64	Staphylococcus_phage	7.2e-09	55.6
WP_002383141.1\|1735039_1735384_-	hypothetical protein	NA	NA	NA	NA
WP_002364194.1\|1735373_1735865_-	hypothetical protein	NA	NA	NA	NA
WP_002357046.1\|1735864_1736152_-	collagen-like protein	NA	NA	NA	NA
WP_002357045.1\|1736148_1736745_-	hypothetical protein	NA	NA	NA	NA
WP_104659692.1\|1736737_1737619_-\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	1.2e-12	28.1
WP_165548533.1\|1737637_1740445_-	CHAP domain-containing protein	Q9AZX5	Lactococcus_phage	1.5e-144	38.6
WP_002403868.1\|1740426_1741161_-\|tail	tail protein	NA	NA	NA	NA
WP_162782897.1\|1741150_1744048_-	tape measure protein	D7RWD8	Brochothrix_phage	8.4e-82	46.7
WP_002357039.1\|1744295_1744646_-	hypothetical protein	A0A2H4JAA8	uncultured_Caudovirales_phage	2.9e-05	33.3
WP_165548535.1\|1744698_1745547_-\|tail	phage tail protein	A0A288TYF3	Enterococcus_phage	3.2e-05	42.5
WP_002357037.1\|1745547_1745922_-	hypothetical protein	NA	NA	NA	NA
WP_002357036.1\|1745924_1746323_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002357034.1\|1746315_1746684_-	hypothetical protein	NA	NA	NA	NA
WP_002357033.1\|1746680_1747025_-	hypothetical protein	NA	NA	NA	NA
WP_002357032.1\|1747038_1747221_-	hypothetical protein	NA	NA	NA	NA
WP_165548537.1\|1747249_1748137_-	DUF5309 domain-containing protein	NA	NA	NA	NA
WP_165548539.1\|1748150_1748774_-	DUF4355 domain-containing protein	NA	NA	NA	NA
1748544:1748557	attL	NA	NA	NA	NA
WP_002389265.1\|1748991_1749312_-	hypothetical protein	NA	NA	NA	NA
WP_002357027.1\|1749376_1749598_-	hypothetical protein	NA	NA	NA	NA
WP_002384360.1\|1749594_1751352_-\|head	head protein	NA	NA	NA	NA
WP_002384358.1\|1751326_1752814_-\|portal	phage portal protein	A0A0A7AQF2	Bacillus_phage	2.5e-29	25.7
WP_002357024.1\|1752825_1754115_-\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	1.5e-232	94.9
WP_002364203.1\|1754086_1754890_-\|terminase	small subunit of terminase	D2J000	Enterococcus_phage	1.1e-127	97.0
WP_104659696.1\|1754936_1755659_-	hypothetical protein	D2IYV9	Enterococcus_phage	4.3e-128	99.2
WP_104659697.1\|1756047_1756608_-	hypothetical protein	NA	NA	NA	NA
WP_104659698.1\|1756637_1757591_-	hypothetical protein	NA	NA	NA	NA
WP_002357018.1\|1758300_1758717_-	autolysin	D2IZ17	Enterococcus_phage	1.4e-67	99.3
WP_002402491.1\|1759623_1760058_-	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	2.8e-58	80.7
WP_002372047.1\|1760066_1760366_-	hypothetical protein	D2IZY1	Enterococcus_phage	1.3e-43	90.9
WP_002368214.1\|1760366_1760669_-	hypothetical protein	D2IZR3	Enterococcus_phage	1.6e-47	99.0
WP_002402489.1\|1760665_1761526_-	helix-turn-helix domain-containing protein	A0A2P1CD59	Lactobacillus_phage	3.7e-25	59.6
WP_010715320.1\|1761525_1761726_-	hypothetical protein	NA	NA	NA	NA
WP_002402487.1\|1761730_1762372_-	hypothetical protein	U5U4M2	Lactobacillus_phage	6.3e-30	36.0
WP_165548541.1\|1762376_1763111_-	ERF family protein	A0A1W6JNQ5	Staphylococcus_phage	1.4e-20	29.9
WP_002402485.1\|1763103_1763421_-	hypothetical protein	NA	NA	NA	NA
WP_002402484.1\|1763616_1763955_-	hypothetical protein	NA	NA	NA	NA
WP_002378465.1\|1763991_1764201_-	hypothetical protein	D2IZ57	Enterococcus_phage	8.8e-18	74.2
WP_002357001.1\|1764255_1764444_+	YegP family protein	NA	NA	NA	NA
WP_165548543.1\|1764469_1765192_-	phage regulatory protein	D2IYT0	Enterococcus_phage	5.6e-43	46.5
WP_104659699.1\|1765214_1765526_-	hypothetical protein	NA	NA	NA	NA
WP_002383936.1\|1765537_1765729_-	hypothetical protein	NA	NA	NA	NA
WP_002387267.1\|1766024_1766366_+	helix-turn-helix transcriptional regulator	A0A1P8BMG3	Lactococcus_phage	3.2e-17	46.8
WP_002387266.1\|1766370_1767021_+	ImmA/IrrE family metallo-endopeptidase	S4U0J6	uncultured_phage	9.2e-13	29.9
WP_002410530.1\|1767116_1767746_+	SHOCT domain-containing protein	NA	NA	NA	NA
WP_002387264.1\|1767851_1769000_+\|integrase	site-specific integrase	A0A1C8E994	Bacillus_phage	1.1e-37	29.9
1770801:1770814	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2291106 : 2299857

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002382497.1\|2291106_2293290_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	4.0e-286	66.8
WP_002356379.1\|2293322_2293919_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	6.0e-51	56.4
WP_165548649.1\|2293963_2295082_-	DNA polymerase IV	NA	NA	NA	NA
WP_002365066.1\|2295207_2295966_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002356375.1\|2295949_2296612_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.7e-19	31.1
WP_002356373.1\|2296626_2297499_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.2e-81	57.6
WP_002356372.1\|2297610_2297958_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	8.1e-16	36.7
WP_002356371.1\|2297950_2298790_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002384059.1\|2298906_2299857_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.2e-34	33.0

DBSCAN-SWA_8

2321642 : 2368989

Enterococcus_phage(35.0%)

head,portal,tail,capsid,plate,tRNA,terminase,holin,integrase,protease

attL 2352650:2352666|attR 2370329:2370345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002362481.1\|2321642_2322353_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_023894868.1\|2322363_2322906_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_002356329.1\|2322993_2323764_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_002379789.1\|2323929_2324505_+	DUF805 domain-containing protein	NA	NA	NA	NA
WP_016632964.1\|2324595_2326161_+	membrane protein	NA	NA	NA	NA
WP_002406046.1\|2326112_2327246_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	8.0e-20	51.5
WP_002387217.1\|2327504_2328569_-	FUSC family protein	NA	NA	NA	NA
WP_002403006.1\|2328824_2329076_-	hypothetical protein	NA	NA	NA	NA
WP_002415466.1\|2329576_2330947_-	hypothetical protein	V5UQU1	Oenococcus_phage	5.3e-10	23.4
WP_002415467.1\|2331107_2332409_-	LysM peptidoglycan-binding domain-containing protein	D2J077	Enterococcus_phage	1.7e-231	96.1
WP_002367246.1\|2332411_2332618_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	3.4e-30	98.5
WP_002383824.1\|2332620_2332854_-\|holin	holin	D2J075	Enterococcus_phage	1.2e-23	69.0
WP_002380794.1\|2332888_2333026_-	XkdX family protein	NA	NA	NA	NA
WP_010714092.1\|2333025_2333400_-	hypothetical protein	NA	NA	NA	NA
WP_010714093.1\|2333414_2333966_-	hypothetical protein	NA	NA	NA	NA
WP_002383822.1\|2333965_2334283_-	hypothetical protein	NA	NA	NA	NA
WP_002383821.1\|2334275_2334593_-	hypothetical protein	NA	NA	NA	NA
WP_010714094.1\|2334585_2335494_-\|plate	phage baseplate upper protein	Q9AYV5	Lactococcus_phage	1.1e-11	26.7
WP_010783203.1\|2335512_2338308_-	CHAP domain-containing protein	D7RWE0	Brochothrix_phage	1.9e-62	70.1
WP_002415248.1\|2338304_2339009_-	hypothetical protein	NA	NA	NA	NA
WP_159110592.1\|2339014_2341318_-\|tail	phage tail tape measure protein	V5UPR9	Enterococcus_phage	2.4e-79	56.0
WP_002380802.1\|2341509_2341965_-	hypothetical protein	A0A2H4J956	uncultured_Caudovirales_phage	2.6e-14	37.4
WP_025187539.1\|2341964_2342600_-\|tail	tail protein	A0A2H4JGN2	uncultured_Caudovirales_phage	2.0e-28	34.5
WP_002385662.1\|2342605_2342968_-	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_002385661.1\|2342957_2343296_-	hypothetical protein	A0A1B0T6B7	Bacillus_phage	4.9e-26	54.1
WP_002365100.1\|2343285_2343612_-\|head	phage head closure protein	A0A0N7IRA3	Lactobacillus_phage	1.7e-20	52.4
WP_002385660.1\|2343589_2343880_-\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7M9	Bacillus_phage	7.4e-23	64.3
WP_159110593.1\|2343872_2345237_-\|capsid	phage major capsid protein	A0A1B2APY9	Phage_Wrath	4.9e-125	67.7
WP_002385658.1\|2345249_2345822_-\|head,protease	HK97 family phage prohead protease	A0A2H4J6Z9	uncultured_Caudovirales_phage	1.1e-62	62.4
WP_159110594.1\|2345793_2347020_-\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	5.4e-147	66.3
WP_010706848.1\|2347038_2348766_-\|terminase	terminase large subunit	A0A2H4JDG5	uncultured_Caudovirales_phage	8.4e-255	70.7
WP_010714099.1\|2348762_2349215_-	hypothetical protein	A0A2H4JFK0	uncultured_Caudovirales_phage	6.1e-48	68.5
WP_002365108.1\|2349325_2349700_-	HNH endonuclease	A0A1B0T6C5	Bacillus_phage	2.0e-44	68.3
WP_159110595.1\|2349699_2350107_-	hypothetical protein	A0A1B1P7N8	Bacillus_phage	4.4e-13	39.4
WP_128437839.1\|2350634_2351102_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	9.9e-09	28.5
WP_050565220.1\|2351310_2351592_-	hypothetical protein	D2IZL5	Enterococcus_phage	1.4e-26	83.1
WP_010714102.1\|2351726_2351909_-	hypothetical protein	C9E2P1	Enterococcus_phage	8.2e-20	80.0
WP_080113513.1\|2351922_2352078_-	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	1.6e-19	91.8
WP_010714105.1\|2352401_2353220_+	DUF4393 domain-containing protein	E9LUL1	Lactobacillus_phage	7.0e-26	31.2
2352650:2352666	attL	NA	NA	NA	NA
WP_002395701.1\|2353377_2353584_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	8.7e-26	100.0
WP_010714107.1\|2353602_2354205_-	hypothetical protein	NA	NA	NA	NA
WP_010706850.1\|2354224_2354695_-	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	8.4e-32	45.9
WP_002393796.1\|2354843_2355113_-	hypothetical protein	NA	NA	NA	NA
WP_070415951.1\|2355251_2356103_-	ATP-binding protein	U5PVD6	Bacillus_phage	6.4e-22	33.3
WP_010714108.1\|2356114_2356903_-	DnaD domain protein	A0A0N7IRA7	Lactobacillus_phage	1.4e-52	53.2
WP_002393795.1\|2356918_2357734_-	hypothetical protein	J7KGZ1	Streptococcus_phage	8.7e-61	50.6
WP_002393794.1\|2357696_2358713_-	recombinase RecT	A0A1S5SAA8	Streptococcus_phage	2.2e-61	44.5
WP_002370012.1\|2358815_2359040_-	hypothetical protein	D2IZX4	Enterococcus_phage	4.9e-22	67.1
WP_002385643.1\|2359036_2359336_-	hypothetical protein	NA	NA	NA	NA
WP_010785685.1\|2359402_2359582_-	hypothetical protein	A0A0S2MY96	Enterococcus_phage	2.2e-17	75.4
WP_002385641.1\|2359617_2359887_-	hypothetical protein	NA	NA	NA	NA
WP_002385638.1\|2359962_2360277_+	hypothetical protein	NA	NA	NA	NA
WP_002385636.1\|2360401_2360578_-	helix-turn-helix domain-containing protein	D2IZW2	Enterococcus_phage	1.3e-14	65.5
WP_159110597.1\|2360661_2361045_+	DUF2513 domain-containing protein	A0A2H4J4K9	uncultured_Caudovirales_phage	5.8e-15	35.9
WP_002385634.1\|2361041_2361260_-	DUF2829 domain-containing protein	NA	NA	NA	NA
WP_002385633.1\|2361556_2361889_+	helix-turn-helix transcriptional regulator	A0A097QQ00	Enterococcus_phage	7.4e-35	68.2
WP_002385632.1\|2361907_2362252_+	ImmA/IrrE family metallo-endopeptidase	A0A097QQ08	Enterococcus_phage	3.9e-47	78.9
WP_002385631.1\|2362309_2363038_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	1.0e-15	50.3
WP_010714109.1\|2363192_2364374_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.5e-48	31.8
WP_002356321.1\|2364476_2364626_-	50S ribosomal protein L33	NA	NA	NA	NA
WP_165548655.1\|2364751_2366887_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_002359397.1\|2367051_2368989_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.1e-112	36.3
2370329:2370345	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP049775.1|WP_002370012.1|2358815_2359040_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP049775.1|WP_002370012.1|2358815_2359040_-|hypothetical-protein

2358815_2359040_-

74 aa aa

2321642-2368989

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP049775_1	Orphan	1.4\|1790797\|24\|NZ_CP049775\|PILER-CR	1790797-1790820	24	2354715-2354738	1
NZ_CP049775_1	Orphan	1.5\|1790863\|24\|NZ_CP049775\|PILER-CR	1790863-1790886	24	2340369-2340392	0
NZ_CP049775_1	Orphan	1.6\|1790791\|30\|NZ_CP049775\|CRISPRCasFinder	1790791-1790820	30	2354715-2354744	1

1. spacer 1.4|1790797|24|NZ_CP049775|PILER-CR matches to NZ_CP049775 position: 2354715-2354738, mismatch: 1

tgctcgcagtttccgctcgaactg	CRISPR spacer
tggtcgcagtttccgctcgaactg	Protospacer
** *********************

2. spacer 1.5|1790863|24|NZ_CP049775|PILER-CR matches to NZ_CP049775 position: 2340369-2340392, mismatch: 0

attaacgtagttgattcagaaaaa	CRISPR spacer
attaacgtagttgattcagaaaaa	Protospacer
************************

3. spacer 1.6|1790791|30|NZ_CP049775|CRISPRCasFinder matches to NZ_CP049775 position: 2354715-2354744, mismatch: 1

tgctcgcagtttccgctcgaactgcttttc	CRISPR spacer
tggtcgcagtttccgctcgaactgcttttc	Protospacer
** ***************************

3. NZ_CP049777

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049777_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049777_1

426-557

Orphan

Consensus_repeat	Method
TTTCGAAAGTGGGAAAAACCAAC	CRISPRCasFinder
TTAGTTCGAAAGTGGGAAAAACCAACC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP049777_1

>merge|NZ_CP049777|1|426-557|CRISPRCasFinder,PILER-CR
TCCCGAAAGTGGGAAAAACCAACCTTCGGATAAACATGATAAAATCAGCGTTTATTTCGAAAGTGGGAAAAACCAACGTCCAGAAGAATCCAATAATACCAGTACTTTGTTCGAAAGTGGGAAAAACCAACC

>NZ_CP049777|1|1|426-556|CRISPRCasFinder
TCCCGAAAGTGGGAAAAACCAAC	CTTCGGATAAACATGATAAAATCAGCGTTTA
TTTCGAAAGTGGGAAAAACCAAC	GTCCAGAAGAATCCAATAATACCAGTACTTT
GTTCGAAAGTGGGAAAAACCAAC

>NZ_CP049777|1|1|429-557|PILER-CR
CGAAAGTGGGAAAAACCAACCTTCGGA	TAAACATGATAAAATCAGCGTTTATTT
CGAAAGTGGGAAAAACCAACGTCCAGA	AGAATCCAATAATACCAGTACTTTGTT
CGAAAGTGGGAAAAACCAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049777.1\|WP_001835296.1\|6704_6920_+\|peptide-binding-protein	unknown	unknown	gnl\|CDD\|311623
NZ_CP049777.1\|WP_000301765.1\|6936_7209_+\|antitoxin	unknown	unknown	gnl\|CDD\|370234
NZ_CP049777.1\|WP_129235162.1\|2155_2374_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|163261
NZ_CP049777.1\|WP_000108741.1\|3483_5628_+\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
NZ_CP049777.1\|WP_001284311.1\|7210_8074_+\|toxin-zeta	unknown	unknown	gnl\|CDD\|368892
NZ_CP049777.1\|WP_000409925.1\|5758_6613_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|366743
NZ_CP049777.1\|WP_001062589.1\|2866_3484_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239737
NZ_CP049777.1\|WP_010728931.1\|8247_9588_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|376574
NZ_CP049777.1\|WP_000713594.1\|2682_2853_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049777.1\|WP_002395903.1\|1135_2044_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648

Protein	Function_ID	Function_description	E-value
NZ_CP049777.1\|WP_001835296.1\|6704_6920_+\|peptide-binding-protein	gnl\|CDD\|311623	pfam07764, Omega_Repress, Omega Transcriptional Repressor. The omega transcriptional repressor regulates expression of involved in copy number control and stable maintenance of plasmids. The omega protein belongs to the structural superfamily of MetJ/Arc repressors featuring a ribbon-helix-helix DNA-binding motif with the beta-ribbon located in and recognising the major groove of operator DNA.	3.67778e-37
NZ_CP049777.1\|WP_000108741.1\|3483_5628_+\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP049777.1\|WP_129235162.1\|2155_2374_+\|hypothetical-protein	gnl\|CDD\|163261	TIGR03433, padR_acidobact, transcriptional regulator, Acidobacterial, PadR-family. Members of this protein family are putative transcriptional regulators of the PadR family, as found in species of the Acidobacteria. This family of proteins has expanded greatly in this lineage, and where it regularly is found in the vicinity of a putative transporter protein [Regulatory functions, DNA interactions].	0.000434154
NZ_CP049777.1\|WP_000409925.1\|5758_6613_+\|ParA-family-protein	gnl\|CDD\|366743	pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyze amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family.	1.58696e-45
NZ_CP049777.1\|WP_001284311.1\|7210_8074_+\|toxin-zeta	gnl\|CDD\|368892	pfam06414, Zeta_toxin, Zeta toxin. This family consists of several bacterial zeta toxin proteins. Zeta toxin is thought to be part of a postregulational killing system in bacteria. It relies on antitoxin/toxin systems that secure stable inheritance of low and medium copy number plasmids during cell division and kill cells that have lost the plasmid.	1.35607e-47
NZ_CP049777.1\|WP_000301765.1\|6936_7209_+\|antitoxin	gnl\|CDD\|370234	pfam08998, Epsilon_antitox, Bacterial epsilon antitoxin. The epsilon antitoxin, produced by various prokaryotes, forms part of a postsegregational killing system which is involved in the initiation of programmed cell death of plasmid-free cells. The protein is folded into a three-helix bundle that directly interacts with the zeta toxin, inactivating it.	9.42049e-34
NZ_CP049777.1\|WP_001062589.1\|2866_3484_+\|recombinase-family-protein	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.58429e-42
NZ_CP049777.1\|WP_010728931.1\|8247_9588_-\|ISL3-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	1.0329e-72
NZ_CP049777.1\|WP_002395903.1\|1135_2044_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.93763e-18

>NZ_CP049777.1|WP_002395903.1|1135_2044_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKDITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP049777.1|WP_129235162.1|2155_2374_+|hypothetical-protein
MILVLTTPVHGYAIIQEIDKLNDGSVKVAAGTMYGAIENLLKLNLIEEIPSRPHRRKEGKNLLKGFLPSLRR
>NZ_CP049777.1|WP_000713594.1|2682_2853_+|hypothetical-protein
MKKFIYRVLENDEVVAIFNEQEYAQDFIAYEKTISDKQFEIEKVALADWLLQPREF
>NZ_CP049777.1|WP_001062589.1|2866_3484_+|recombinase-family-protein
MAKIGYARVSSKEQNLDRQLQALQGVSKVFSDKLSGQSVERPQLQAMLNYIREGDIVVVTELDRLGRNNKELTELMNAIQQKGATLEVLNLPSMNGIEDENLRRLINNLVIELYKYQAESERKRIKERQAQGIEIAKSKGKFKGRQHKFKENDPRLKHAFDLFLNGCSDKEVEEQTGINRRTFRRYRTRYNVTVDQRKNKGKRDS
>NZ_CP049777.1|WP_000108741.1|3483_5628_+|type-IA-DNA-topoisomerase
MSTVILAEKPSQALAYAQAFNQSDKKDGYFEIKDPLFTDETFITFGFGHLVELAEPGNYDEKWQNWKLESLPIFPDRYDFEVAKDKGKQFKIVAELLKKANTIIVATDSDREGENIAWSIIHKANAFSKDKTFKRLWINSLEKDVIRSGFQNLQPGMNYYPFYQEAQTRQIADWLIGMNASPLYTLNLQQKGVQGTFSLGRVQTPTLYLIFQRQEAIENFKKEPFFEVEASIKVNQGSFKGVLSPTQRFKTQEELLAFVSSKQAKIGNQEGRITDVQTKEKKTNSPSLFSLSSLQSKVNQLYKATASQTLKAMQGLYEAKLLSYPRTDTPFITENEFAYLKANFGKYSGFLGLDLEMVQTEPRKRYVDGSKVQEHHAIIPTKQVPTESALAKMDDLQRKIYALVVKTTVAMFLPDYLYEETKIQTKVADLLFQSIGKTPKQEGWKILFKQQNKEEKEDVQTLPLVIIGEHAEVDVKSAEKETQPPKAFTEGTLLTAMKTAGKTIDDEEAQKILKDTEGIGTEATRASIIEALKQKEYIQVIKNKLVVTEKGKLLCQAVESQHLLTSAEMTAKWETYLKKIGKREGNQENFITNIKKFIVHLLEAVPTDIEKLNFSDYQEQKEKEAEKSIVGKCPKCGNNIVLKKSFYGCSNYPECKFTLAEHFRKKKLTKTNVKELLEGKETLVKGIKNKEKKSYNAVVKIGEKGYIDFISFSK
>NZ_CP049777.1|WP_000409925.1|5758_6613_+|ParA-family-protein
MEKEELKILEELRRILSNKNEAIVILNNYFKGGVGKSKLSTMFAYLTDKLNLKVLMIDKDLQATLTKDLAKTFKVELPRVNFYEGLKNGNLASSIVHLTDNLDLIPGTFDLMLLPKLTRSWTFENESRLLATLLAPLKSDYDLIIIDTVPTPSVYTNNAIVASDYVMIPLQAEEESTNNIQNYISYLIDLQEQFNPGLDMIGFVPYLVDTDSATIKSNLEELYKQHKEDNLVFQNIIKRSNKVSTWSKNGITEHKGYDKKVLSMYKNVFFEMLERIIQLENEKE
>NZ_CP049777.1|WP_001835296.1|6704_6920_+|peptide-binding-protein
MIVGNLGAQKAKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYLPDKL
>NZ_CP049777.1|WP_000301765.1|6936_7209_+|antitoxin
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA
>NZ_CP049777.1|WP_001284311.1|7210_8074_+|toxin-zeta
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
>NZ_CP049777.1|WP_010728931.1|8247_9588_-|ISL3-family-transposase
MTQNMLNLPSLKIIDMHESESDYRFLVETTLPPSTYCPKCGTIANLYKHGKKKQLFFDLPMHAKRVGIYVNRQRYKCRECDETFFENLPDMVVNRSVTNRLINWIQEASLEKTFTSVAEEIGVDEKTVRNIFNDYVDELEAQTDFRTPKWLGIDEVHLLKNYRCVITDVENKSVIDILRKRNKDTIISYLSKLQDIDKIELIAMDMWNPYKSAVNTMIPHAKIVIDKFHVVKLANEALEKIRKANRQNVTAKERRQLMRDRYVLLTRSKDLTDFDDQIKLQVWTQNFPLLGQAYELKEQFFDIYEAESINDAYKLYQNWVSNVPKELITYFEDLFKAMNNWEEEIFNYFNSPITNAYTESLNRLIKTMNHVGRGYSFEALRAKILFTQGYRKVRKKKKFKEVEVTFGKMLPDQFPGWSQTGYEWVYEEIFGADFSTLTKVMEEGSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66224-66254	0	1.0
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	449-479	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7642-7672	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66170-66200	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12175-12205	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60905-60935	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92753-92783	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43888-43918	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4943-4973	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5073-5103	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	602-632	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	515-545	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33709-33739	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	503-533	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	503-533	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5526-5556	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83505-83535	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9536-9566	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	827-857	0	1.0
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66227-66253	0	1.0
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	450-476	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7645-7671	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66173-66199	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12178-12204	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60908-60934	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92756-92782	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43891-43917	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4946-4972	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5074-5100	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	603-629	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	516-542	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33710-33736	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	504-530	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	504-530	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5527-5553	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83506-83532	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9537-9563	0	1.0
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	828-854	0	1.0
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	748-778	1	0.968
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5020-5046	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	549-575	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	462-488	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33656-33682	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	450-476	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5473-5499	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43945-43971	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83452-83478	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	695-721	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9483-9509	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	5000-5026	1	0.963
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	774-800	1	0.963
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	749-775	1	0.963
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5019-5049	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	548-578	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	461-491	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33655-33685	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	449-479	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5472-5502	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43942-43972	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83451-83481	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	694-724	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9482-9512	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4997-5027	2	0.935
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	773-803	2	0.935
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7699-7725	2	0.926
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12232-12258	2	0.926
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60962-60988	2	0.926
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92810-92836	2	0.926
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7696-7726	3	0.903
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12229-12259	3	0.903
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60959-60989	3	0.903
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92807-92837	3	0.903
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP034685	Bacillus sp. BD59S plasmid pBTBD59S2, complete sequence	63363-63393	5	0.839
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	MT711976	Streptomyces phage Coruscant, complete genome	87403-87429	5	0.815
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31964-31990	5	0.815
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	MN543579	Klebsiella pneumoniae strain PM48 plasmid pPM48_140, complete sequence	24861-24891	6	0.806
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	MN543581	Klebsiella pneumoniae strain PM48TC plasmid pPM48TC_fusion, complete sequence	24861-24891	6	0.806
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	LR134207	Klebsiella aerogenes strain NCTC9667 genome assembly, plasmid: 2	135048-135078	6	0.806
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NZ_CP031801	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed1, complete sequence	86382-86412	6	0.806
NZ_CP049777_1	1.3\|456\|27\|NZ_CP049777\|PILER-CR	456-482	27	NC_015250	Acinetobacter phage 133, complete genome	121682-121708	6	0.778
NZ_CP049777_1	1.4\|510\|27\|NZ_CP049777\|PILER-CR	510-536	27	JQ660954	Clostridium phage PhiS63, complete genome	22891-22917	6	0.778
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31963-31993	7	0.774
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	KY653128	Staphylococcus phage IME1364_01, complete genome	28-58	8	0.742
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	MT711976	Streptomyces phage Coruscant, complete genome	87400-87430	8	0.742
NZ_CP049777_1	1.1\|449\|31\|NZ_CP049777\|CRISPRCasFinder	449-479	31	NC_015250	Acinetobacter phage 133, complete genome	121681-121711	10	0.677
NZ_CP049777_1	1.2\|503\|31\|NZ_CP049777\|CRISPRCasFinder	503-533	31	JQ660954	Clostridium phage PhiS63, complete genome	22890-22920	10	0.677

1. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcagcgttta	Protospacer
*******************************

2. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcagcgttta	Protospacer
*******************************

3. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

4. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

5. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

6. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

7. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

8. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

9. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

10. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

11. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

12. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

13. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

14. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

15. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

16. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

17. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

18. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

19. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccagtacttt	Protospacer
*******************************

20. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcagcgt	Protospacer
***************************

21. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcagcgt	Protospacer
***************************

22. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

23. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

24. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

25. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

26. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

27. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

28. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

29. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

30. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

31. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

32. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

33. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

34. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

35. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

36. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

37. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

38. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccagtac	Protospacer
***************************

39. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.968

gtccagaagaatccaataataccagtacttt	CRISPR spacer
gtccagaagaatccaataataccaggacttt	Protospacer
************************* *****

40. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcaacgt	Protospacer
***********************.***

41. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

42. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

43. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

44. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

45. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

46. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

47. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

48. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcaacgt	Protospacer
***********************.***

49. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcaacgt	Protospacer
***********************.***

50. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

51. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 1, identity: 0.963

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcgt	Protospacer
**********************.****

52. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.963

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaatccaataataccaggac	Protospacer
************************ **

53. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcaacgtttc	Protospacer
************************.*****

54. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

55. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

56. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

57. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

58. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

59. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

60. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

61. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcaacgtttc	Protospacer
************************.*****

62. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcaacgtttc	Protospacer
************************.*****

63. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

64. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 2, identity: 0.935

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcgtttc	Protospacer
***********************.******

65. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 2, identity: 0.926

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcat	Protospacer
**********************.**.*

66. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 2, identity: 0.926

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcat	Protospacer
**********************.**.*

67. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 2, identity: 0.926

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcat	Protospacer
**********************.**.*

68. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 2, identity: 0.926

ttcggataaacatgataaaatcagcgt	CRISPR spacer
ttcggataaacatgataaaatcggcat	Protospacer
**********************.**.*

69. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 3, identity: 0.903

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcatttc	Protospacer
***********************.**.***

70. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 3, identity: 0.903

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcatttc	Protospacer
***********************.**.***

71. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 3, identity: 0.903

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcatttc	Protospacer
***********************.**.***

72. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 3, identity: 0.903

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
cttcggataaacatgataaaatcggcatttc	Protospacer
***********************.**.***

73. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP034685 (Bacillus sp. BD59S plasmid pBTBD59S2, complete sequence) position: , mismatch: 5, identity: 0.839

---cttcggataaacatgataaaatcagcgttta	CRISPR spacer
aaactt---ataaacatgattaaatcaacgttta	Protospacer
   ***   *********** ******.******

74. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 5, identity: 0.815

tccagaagaatccaataataccagtac	CRISPR spacer
tccagaagaagccaataaaaccactct	Protospacer
********** ******* **** * .

75. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 5, identity: 0.815

tccagaagaatccaataataccagtac	CRISPR spacer
ttttgaagaatcctttaataccagtac	Protospacer
*.. *********  ************

76. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to MN543579 (Klebsiella pneumoniae strain PM48 plasmid pPM48_140, complete sequence) position: , mismatch: 6, identity: 0.806

----cttcggataaacatgataaaatcagcgttta	CRISPR spacer
gtcacttc----aaacatgataaaatcagcatgta	Protospacer
    ****    ******************.* **

77. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to MN543581 (Klebsiella pneumoniae strain PM48TC plasmid pPM48TC_fusion, complete sequence) position: , mismatch: 6, identity: 0.806

----cttcggataaacatgataaaatcagcgttta	CRISPR spacer
gtcacttc----aaacatgataaaatcagcatgta	Protospacer
    ****    ******************.* **

78. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to LR134207 (Klebsiella aerogenes strain NCTC9667 genome assembly, plasmid: 2) position: , mismatch: 6, identity: 0.806

----cttcggataaacatgataaaatcagcgttta	CRISPR spacer
gtcacttc----aaacatgataaaatcagcatgta	Protospacer
    ****    ******************.* **

79. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NZ_CP031801 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

----cttcggataaacatgataaaatcagcgttta	CRISPR spacer
gtcacttc----aaacatgataaaatcagcatgta	Protospacer
    ****    ******************.* **

80. spacer 1.3|456|27|NZ_CP049777|PILER-CR matches to NC_015250 (Acinetobacter phage 133, complete genome) position: , mismatch: 6, identity: 0.778

ttcggataaacatgataaaatcagcgt	CRISPR spacer
catcgataaacatgataatatcagggt	Protospacer
. . ************** ***** **

81. spacer 1.4|510|27|NZ_CP049777|PILER-CR matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 6, identity: 0.778

tccagaagaatccaataataccagtac	CRISPR spacer
aaacgaagaaaccaataatatcagtac	Protospacer
    ****** *********.******

82. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 7, identity: 0.774

gtccagaagaatccaataataccagtacttt	CRISPR spacer
attttgaagaatcctttaataccagtactta	Protospacer
.*.. *********  **************

83. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to KY653128 (Staphylococcus phage IME1364_01, complete genome) position: , mismatch: 8, identity: 0.742

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
aatattacaaactttataaaatcagcgttta	Protospacer
  *   *.**** * ****************

84. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 8, identity: 0.742

gtccagaagaatccaataataccagtacttt	CRISPR spacer
atccagaagaagccaataaaaccactctgtg	Protospacer
.********** ******* **** * . *

85. spacer 1.1|449|31|NZ_CP049777|CRISPRCasFinder matches to NC_015250 (Acinetobacter phage 133, complete genome) position: , mismatch: 10, identity: 0.677

cttcggataaacatgataaaatcagcgttta	CRISPR spacer
tcatcgataaacatgataatatcagggtact	Protospacer
.. . ************** ***** ** .

86. spacer 1.2|503|31|NZ_CP049777|CRISPRCasFinder matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 10, identity: 0.677

gtccagaagaatccaataataccagtacttt	CRISPR spacer
aaaacgaagaaaccaataatatcagtacaag	Protospacer
.    ****** *********.******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2866 : 12875

Streptococcus_phage(62.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001062589.1\|2866_3484_+	recombinase family protein	A0A219YA40	Aeromonas_phage	4.5e-17	36.1
WP_000108741.1\|3483_5628_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.5e-264	96.9
WP_000409925.1\|5758_6613_+	ParA family protein	A0A1X9I765	Streptococcus_phage	1.7e-152	98.2
WP_001835296.1\|6704_6920_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
WP_000301765.1\|6936_7209_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
WP_001284311.1\|7210_8074_+	toxin zeta	NA	NA	NA	NA
WP_010728931.1\|8247_9588_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.4e-100	43.5
WP_016922374.1\|9809_10229_-	fosfomycin resistance bacillithiol transferase FosB3	NA	NA	NA	NA
WP_050047025.1\|10765_11503_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.1e-134	99.6
WP_031929417.1\|11627_11711_-	23S rRNA methyltransferase attenuator leader peptide ErmL	NA	NA	NA	NA
WP_165548727.1\|12197_12875_-	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	4.9e-33	93.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049776

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP049775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

3. NZ_CP049777

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection