CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	2 crisprs	csa3	5	10
NZ_CP049910	Diaphorobacter sp. HDW4A chromosome, complete genome	2 crisprs	csa3,DEDDh,cas3,DinG,RT,WYL,Cas9_archaeal,PD-DExK	1	8
NZ_CP049912	Diaphorobacter sp. HDW4A plasmid p_unnamed2, complete sequence	0 crisprs	DEDDh	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049911_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049911_1

192543-192714

Orphan

Consensus_repeat	Method
GAGTCATCCTGTTGACAGGATGA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP049911_1

>merge|NZ_CP049911|1|192543-192714|PILER-CR
GATTCATCCTGTTGACAGGATGACGGCTCAGAATGAAATCATCCTGTTGCCAGGACGACGGGAAAATTGGTACGGACCGTCCTGTCGACAGGATGACAGCATCGCTATGCGGCAAGAATTCAGTGATATCTGAGCCAGCCTTATTAGGGGAGTCATCCTGTTGGCAGGATGA

>NZ_CP049911|1|1|192543-192714|PILER-CR
GATTCATCCTGTTGACAGGATGA	CGGCTCAGAATGAAATCATCCTGTTGCCAGGACGACGGGAAAATTGGTACGGACCG
TCCTGTCGACAGGATGACAGCAT	CGCTATGCGGCAAGAATTCAGTGATATCTGAGCCAGCCTTATTAGGGGAGTCA
TCCTGTTGGCAGGATGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049911.1\|WP_166312425.1\|185747_185894_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312479.1\|194387_195500_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NZ_CP049911.1\|WP_166312435.1\|196015_196354_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP049911.1\|WP_166312441.1\|200073_200340_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312430.1\|187940_188498_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312424.1\|185414_185579_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312437.1\|196921_198727_+\|conjugative-transfer-system-coupling-protein-TraD	unknown	unknown	gnl\|CDD\|274760
NZ_CP049911.1\|WP_166312434.1\|193208_194384_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP049911.1\|WP_166312426.1\|185952_186162_-\|DUF3717-domain-containing-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312438.1\|198729_199344_+\|DUF4400-domain-containing-protein	unknown	unknown	gnl\|CDD\|379573
NZ_CP049911.1\|WP_166312433.1\|191133_192171_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379352
NZ_CP049911.1\|WP_166312442.1\|200537_201017_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381603
NZ_CP049911.1\|WP_166312436.1\|196512_196905_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312428.1\|186759_187383_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197267
NZ_CP049911.1\|WP_166312439.1\|199397_199727_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312440.1\|199756_200077_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP049911.1\|WP_166312431.1\|188685_188991_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312432.1\|189007_189967_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319246
NZ_CP049911.1\|WP_166312429.1\|187656_187935_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312427.1\|186350_186647_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390

Protein	Function_ID	Function_description	E-value
NZ_CP049911.1\|WP_166312479.1\|194387_195500_-\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	7.3042e-33
NZ_CP049911.1\|WP_166312435.1\|196015_196354_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	2.09347e-17
NZ_CP049911.1\|WP_166312432.1\|189007_189967_-\|hypothetical-protein	gnl\|CDD\|319246	cd16387, ParB_N_Srx, ParB N-terminal domain and sulfiredoxin protein-related families. The ParB N-terminal domain/Sulfiredoxin (Srx) superfamily contains proteins with diverse activities. Many of the families are involved in segregation and competition between plasmids and chromosomes. Several families share similar activities with the N-terminal domain of ParB (Spo0J in Bacillus subtilis), a DNA-binding component of the prokaryotic parABS partitioning system. Also within this superfamily is sulfiredoxin (Srx; reactivator of oxidatively inactivated 2-cys peroxiredoxins), RepB N-terminal domain (plasmid segregation replication protein B like protein), nucleoid occlusion protein, KorB N-terminal domain partition protein of low copy number plasmid RK2, irbB (immunoglobulin-binding regulator that activates eib genes), N-terminal domain of sopB protein (promotes proper partitioning of F1 plasmid), fertility inhibition factors OSA and FiwA,DNA sulfur modification protein DndB, and a ParB-like toxin domain. Other activities includes a StrR (regulator in the streptomycin biosynthetic gene cluster), and a family containing a Pyrococcus furiosus nuclease and putative transcriptional regulators sbnI (Staphylococcus aureus siderophore biosynthetic gene cluster ). Nuclease activity has also been reported in Arabidopsis Srx.	0.00898661
NZ_CP049911.1\|WP_166312437.1\|196921_198727_+\|conjugative-transfer-system-coupling-protein-TraD	gnl\|CDD\|274760	TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. [Mobile and extrachromosomal element functions, Other].	0
NZ_CP049911.1\|WP_166312434.1\|193208_194384_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	2.21467e-17
NZ_CP049911.1\|WP_166312438.1\|198729_199344_+\|DUF4400-domain-containing-protein	gnl\|CDD\|379573	pfam14348, DUF4400, Domain of unknown function (DUF4400). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 209 and 249 amino acids in length. There is a single completely conserved residue P that may be functionally important.	0.00211331
NZ_CP049911.1\|WP_166312433.1\|191133_192171_-\|hypothetical-protein	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	0.00173266
NZ_CP049911.1\|WP_166312442.1\|200537_201017_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381603	cd13400, LT_IagB-like, Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	1.46631e-54
NZ_CP049911.1\|WP_166312440.1\|199756_200077_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	1.6736e-08
NZ_CP049911.1\|WP_166312428.1\|186759_187383_-\|phospholipase-D-family-protein	gnl\|CDD\|197267	cd09170, PLDc_Nuc, Catalytic domain of EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Catalytic domain of an EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Nuc is an endonuclease cleaving both single- and double-stranded DNA. It is the smallest known member of the phospholipase D (PLD, EC 3.1.4.4) superfamily that includes a diverse group of proteins with various catalytic functions. Most members of this superfamily have two copies of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue) in a single polypeptide chain and both are required for catalytic activity. However, Nuc only has one copy of the HKD motif per subunit but form a functionally active homodimer (it is most likely also active in solution as a multimeric protein), which has a single active site at the dimer interface containing the HKD motifs from both subunits. Due to the lack of a distinct domain for DNA binding, Nuc cuts DNA non-specifically. It utilizes a two-step mechanism to cleave phosphodiester bonds: Upon substrate binding, the bond is first attacked by a histidine residue from one HKD motif to form a covalent phosphohistidine intermediate, which is then hydrolyzed by water with the aid of a second histidine residue from the other HKD motif in the opposite subunit.	2.8325e-59
NZ_CP049911.1\|WP_166312427.1\|186350_186647_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	1.0255e-23

>NZ_CP049911.1|WP_166312433.1|191133_192171_-|hypothetical-protein
MGIPAPSFPYPITLACTSLPHLESFADLPDGFIRIVSRIIQKINLKNPFSEIFATRSTIANESGKSLDTVHRAVKWLEDHGMIERERKAKIGYRGSKSPLIPTQKFLHSLNLVDENGNSREFPKFSTKTDFSDANKKSAPGANVAPTEKKNRLFKRFGNVSLPIDLSWLCERGGLTPYGVLGLMKLARSVKQTLSEVVHASMKYLDGLTKNELYAYITKLLQSGRDFKNLSEISKENDKNREISEYLKEKQKIFFGKKFISQSTRTIYEFTEDSVKCHYPDGASKTMVLEMGLLEAIQQGKLRPYVSQPKSCGPNAASVSTKNSILRKTFLESLFNIKPKVPLAS
>NZ_CP049911.1|WP_166312432.1|189007_189967_-|hypothetical-protein
MATSWKSRAADKNDPDVKKKDLYGVNPLIVEEEEGFNLRDYDDPEVIEHIESLCQSYMAGSYVPPPIARVDDDGRVVVIEGHCRIRAIKMAIERGKNIPFIDVLPFRGNDAERVQVMLRSAQGLSLKPLKIAIGYLRLRRMGHEVAEIAKSMGKSTAHVEQMLVLANANSDVHALVSSGAVNAYAAIEVVRKHGEKAGAVLQDLINGNEGKAKKVVTRSDVNEWIPPRKIIGNIYKSVDGFVDTFDKNVRVRLAELEKLDVEELRNKTIEVDAASLLEIFRSWSKADEAKKSKLEAGLKRKEKASQMDLAGTEEGDEEK
>NZ_CP049911.1|WP_166312431.1|188685_188991_-|hypothetical-protein
MNEKTHGLHMSVDGQLERMRYPEDYEDFLTRNGESVPPDEARAWLLMNKACGRKVIPMSSSCGHPCDNAAYGCKGFDYSGKGCSGYYDSLKSRNAAIGTED
>NZ_CP049911.1|WP_166312430.1|187940_188498_-|hypothetical-protein
MIIRPINADHLYPGVEDFELDRQMERDKRNFESTENWIYLGADIRDIFYSKVGITTGNLQSRSYSSAMPNYYLFCAFKAEIPTSKARLELVENDILANLDNQFGQQFRMCHAESGTLSECYYGVEFKYIFQAVHQIIYYRHPNAFTRILCEDDYGNAIGSRVRCEFNEVVVKNKKYWESLILQAD
>NZ_CP049911.1|WP_166312429.1|187656_187935_-|hypothetical-protein
MKILGVDFVNPPVRSLLWVAGVGVATALFSSALADMDLISKTGALWFVVGAMGGSFTSVVGVNLREHGWRGWVLFFTFMGLILSATYLYLTS
>NZ_CP049911.1|WP_166312428.1|186759_187383_-|phospholipase-D-family-protein
MFYPSKTTLIVAGVWASLLLPGWALPIEPMLSNTGGRFLKAVASELEPAVGNFEVAFSPNEGAEQLVVRVIDSTKLDLRVLAYSFTSARVTQAILRAQKRGVKIYMVADEQNNLSSTASPKARAALSALVTAGANVRVTSAYPIHHDKVIIADGQTVQTGSYNYSEAAASKNSENVFVNWNNPRLAQLYAKHFERNWSTAKKFEPSF
>NZ_CP049911.1|WP_166312427.1|186350_186647_-|H-NS-histone-family-protein
MTVSLKELLAQKVALEARIDEQRKIEHSGAVQKVRQLVSEYGLTQDDIFGRTRGSKAGTGETRTVPPKYRDPATGQTWTGRGKAPKWIEGQDREKFAI
>NZ_CP049911.1|WP_166312426.1|185952_186162_-|DUF3717-domain-containing-protein
MDAVLDFQSLNTALTNCMAAHPPVAPEFRMHPDAHAMSDPWATMVILRHESLPLHEIKQPVLEAIERWK
>NZ_CP049911.1|WP_166312425.1|185747_185894_+|hypothetical-protein
MKYKEPVVTWTVSGAAEQKAKFYRLGGSQWLQKMIDKAKDPKTEKAGD
>NZ_CP049911.1|WP_166312424.1|185414_185579_-|hypothetical-protein
MTYEEFKAAYVEAFTEMQKYTVDQVGSGHFAQKLADLSDAYPDFENSLFDEPSP
>NZ_CP049911.1|WP_166312434.1|193208_194384_-|ParB/RepB/Spo0J-family-partition-protein
MRTRKLNPAGATQEQPSQTPAPTAAPKRPDGPPLPLRDFKNVSRAPAVKVEASATGTDAPDETVHITDTSSAQEVVSQQSQESGLSQPLTAGAPVQNDSPSDRSYLQLDARLIDQNAHPPRLTYIDDAIKEIADSISKNGQRDAIHVIPHPKKPGRYIIGDGWTRVLAIRSYGINNGTVLAAVHKNLTESEASWLGMLQNDERSQLTDFDRGMYFANWLDDGMTIDDIANRVKMSRTRVGEFVVIRNLPMEIKEHARRTPKKMSASVFAIISSILNKSSEDKAIAICNKYIAGDHTHAWLRKQASEISENSRKKSANSVQYQRRYGQGHYRQRASGQVELNVVIPDTSLVTQFNADLEELLKKYLPQETADANGTAEGPDTDSESTGSTSE
>NZ_CP049911.1|WP_166312479.1|194387_195500_-|AAA-family-ATPase
MKYRLRQACQLLGVTDNTLRTYADNAGIQIKRANESNPRAVASRVFEPDTLFQLAQWRRAQGWSKAPAGQGPVIIVVDVVKGGTGKTTTAVETAVHLQFMGLRVLAIDLDVQANLTQAFGYEADILDDEIASYGVTQEAVINSTIDNLVTPFLQTSTRPSPSASDNSKIEGLIKKPFGEAGPHLIGANIDLANMETHIANSKGPREMCLRNLFDAATRGEISSLPLSNYDVVILDCPPNVSFTSTAALGAADLVIAPVRMDAFAIKGLIRLMGEIESIDATYKVRPELVILPTHYAPQIARIGRMQAKINQYKDLLAPNVISASEDFPKSLDQYLPLSLQRPSCTATSEYRMFAEFIQGKVLSISAKKGK
>NZ_CP049911.1|WP_166312435.1|196015_196354_+|H-NS-histone-family-protein
MAHEDDLDVQISELKKKLLQLEAQQEDARKEKIAEVVASIRAQINEFGLKPADLFPEARWVQVSRARPLKKDRPPKYRNEQGEVWSGGPGRKPRWVREVEARGEDINKYLIV
>NZ_CP049911.1|WP_166312436.1|196512_196905_+|hypothetical-protein
MWLYDGGPDGVCLRVNDASPTDGGYVMVFILPSGDARLLATRFPAKYVTTWRTNSKRCGGEDLERVLISPLHPRYEKIKRLLATQLIPKDDSEATLREISVETITEEVTKLFSLPTSPAHAVLEKAENLE
>NZ_CP049911.1|WP_166312437.1|196921_198727_+|conjugative-transfer-system-coupling-protein-TraD
MPNELFDFDNPWRPIYEGWQSAAWYGAMAVSFTSPLYMPLPTSFAAVAGSACTLMGSWRMYKAWDRASDKSRSMPGKVEFITIPQLQKLAPKFASKGEVWLGQGFHWTDLEANRMHALIGAGVANVLGKKALNGQGSYWLHGLSKEEDISAQLMLLEGHTLIVGSTGVGKTRLFDLLIAQAILRGEPVIIIDPKGDQGLADNARRVCEAMGAPEKFIYFNPAHPDKSACIDPMRNWNRKTELASRIAALIPSETGADPFTAFGWKVLNDIVSGLIATGRRPNLVQLRRYIEGGPDDLLVKALRVHFVKCVPNWETKVASYVKKAKGSLLDGYIDFYKEVVIHEAENVDLQGLISTFEHNRDHFQKMVASLIPILSMLTSEPLTDLLSPDLEPGHDKVVTDMSRVIRNNMVCYMGLDSLADATVGSAIGSVMLADMTAVAGDRYNYGVDEKKSINVFVDEAAEVINQPTIQLLNKGRGAGFRMFIATQTFADFASRLGDENKARQVLANTNNKIALRIQDSETQQYIADGIPKIKAQAMAVRYGHNIDADMHDQYSASYQEQATKEEADLIPPGVLSELPPLHFFARLSGGKTLKGKIPILV
>NZ_CP049911.1|WP_166312438.1|198729_199344_+|DUF4400-domain-containing-protein
MASKKSSDGKHSFASIILIIVLFGSLLIAALVPEQTFEAVRAKEQAQIVSWLGEDTDQWILDRIFRWLETVNAEAGNYLEKTESFVGKPAIDQWMVHRVYAVTIWAHVILYRMGMLILWLAFALPCMLAAFTDGFYQREISKASFTSQSPVRHKAGLEMVKLISMLMLLWIFMPVFISIIIAPVAIAAGSFAWWMWMSNMQKRL
>NZ_CP049911.1|WP_166312439.1|199397_199727_-|hypothetical-protein
MANIKYFSDVTGEAVQLKAPYGMPNEEFAARWPGIKGLRYDGYSMRVGYPTSGTSGVMPVTRMIEYKSQPSLHECNAKCLDGKHNGKCECRCGGKNHGFGMFSGLLKAA
>NZ_CP049911.1|WP_166312440.1|199756_200077_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MNRYQVLFSTDAAEDLERLFDHILERELASPSGDLDIPARAMEAIEQACSFLQHSPFSCRKAGSDPFLRELIISFGGSGYVALFEIHDSSTVIIGAIRHQLESDFH
>NZ_CP049911.1|WP_166312441.1|200073_200340_-|hypothetical-protein
MKSATIPPVRVEPAFRQEMEQALGPNENLASLVETAVRNEVSRRQAQAEFVRRGLASIQKTVATGTGIPAHVVIEKLQAKLAAAKKNA
>NZ_CP049911.1|WP_166312442.1|200537_201017_+|lytic-transglycosylase-domain-containing-protein
MSQWFLALVARIAFATAALASFPVLAGPACFDEAARRYHVPVELLKAISMVESRGDPNARNYNTNGSYDIGHMQINSWWLKTLEQYGITEETLLEPCVNTNIGAWVLAQNIARYGLTWNAVGAYNAASDSKRLVYARKVATTLRSQQMKAVKAAKQTQG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP049911_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049911_2

192841-193074

Orphan

Consensus_repeat	Method
CCATCCTGTTGACAGGA	PILER-CR

3 spacers

The CRISPR arrays of NZ_CP049911_2

>merge|NZ_CP049911|2|192841-193074|PILER-CR
CCATCCTGTTGACAGGACGGAGGCCGCCCCATGGCGTACCTCCCGGCTGGCATGAGCACCACTGGGTACCATCCATCCTGTTGACAGGATGAAATCGGAATCAGCGACTGTCATCCTGTCAACAGGATGCAATCTGCGCCGGGGGAGGCCATCCTGTTGACAGGACGGAGGCCAGGACATGGTCTGGCCAGCTGGCTTGGTTTCCACCAAGAGGCATCCATCCTGTTGACAGGA

>NZ_CP049911|2|2|192841-193074|PILER-CR
CCATCCTGTTGACAGGA	CGGAGGCCGCCCCATGGCGTACCTCCCGGCTGGCATGAGCACCACTGGGTACCAT
CCATCCTGTTGACAGGA	TGAAATCGGAATCAGCGACTGTCATCCTGTCAACAGGATGCAATCTGCGCCGGGGGAGG
CCATCCTGTTGACAGGA	CGGAGGCCAGGACATGGTCTGGCCAGCTGGCTTGGTTTCCACCAAGAGGCAT
CCATCCTGTTGACAGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049911.1\|WP_166312425.1\|185747_185894_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312479.1\|194387_195500_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|224113
NZ_CP049911.1\|WP_166312435.1\|196015_196354_+\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
NZ_CP049911.1\|WP_166312441.1\|200073_200340_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312430.1\|187940_188498_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312424.1\|185414_185579_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312437.1\|196921_198727_+\|conjugative-transfer-system-coupling-protein-TraD	unknown	unknown	gnl\|CDD\|274760
NZ_CP049911.1\|WP_166312434.1\|193208_194384_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|272946
NZ_CP049911.1\|WP_166312426.1\|185952_186162_-\|DUF3717-domain-containing-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312438.1\|198729_199344_+\|DUF4400-domain-containing-protein	unknown	unknown	gnl\|CDD\|379573
NZ_CP049911.1\|WP_166312433.1\|191133_192171_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379352
NZ_CP049911.1\|WP_166312442.1\|200537_201017_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381603
NZ_CP049911.1\|WP_166312436.1\|196512_196905_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312428.1\|186759_187383_-\|phospholipase-D-family-protein	unknown	unknown	gnl\|CDD\|197267
NZ_CP049911.1\|WP_166312439.1\|199397_199727_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312440.1\|199756_200077_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|368240
NZ_CP049911.1\|WP_166312431.1\|188685_188991_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312432.1\|189007_189967_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319246
NZ_CP049911.1\|WP_166312429.1\|187656_187935_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049911.1\|WP_166312427.1\|186350_186647_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390

Protein	Function_ID	Function_description	E-value
NZ_CP049911.1\|WP_166312479.1\|194387_195500_-\|AAA-family-ATPase	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	7.3042e-33
NZ_CP049911.1\|WP_166312435.1\|196015_196354_+\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	2.09347e-17
NZ_CP049911.1\|WP_166312432.1\|189007_189967_-\|hypothetical-protein	gnl\|CDD\|319246	cd16387, ParB_N_Srx, ParB N-terminal domain and sulfiredoxin protein-related families. The ParB N-terminal domain/Sulfiredoxin (Srx) superfamily contains proteins with diverse activities. Many of the families are involved in segregation and competition between plasmids and chromosomes. Several families share similar activities with the N-terminal domain of ParB (Spo0J in Bacillus subtilis), a DNA-binding component of the prokaryotic parABS partitioning system. Also within this superfamily is sulfiredoxin (Srx; reactivator of oxidatively inactivated 2-cys peroxiredoxins), RepB N-terminal domain (plasmid segregation replication protein B like protein), nucleoid occlusion protein, KorB N-terminal domain partition protein of low copy number plasmid RK2, irbB (immunoglobulin-binding regulator that activates eib genes), N-terminal domain of sopB protein (promotes proper partitioning of F1 plasmid), fertility inhibition factors OSA and FiwA,DNA sulfur modification protein DndB, and a ParB-like toxin domain. Other activities includes a StrR (regulator in the streptomycin biosynthetic gene cluster), and a family containing a Pyrococcus furiosus nuclease and putative transcriptional regulators sbnI (Staphylococcus aureus siderophore biosynthetic gene cluster ). Nuclease activity has also been reported in Arabidopsis Srx.	0.00898661
NZ_CP049911.1\|WP_166312437.1\|196921_198727_+\|conjugative-transfer-system-coupling-protein-TraD	gnl\|CDD\|274760	TIGR03743, SXT_TraD, conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains. [Mobile and extrachromosomal element functions, Other].	0
NZ_CP049911.1\|WP_166312434.1\|193208_194384_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	2.21467e-17
NZ_CP049911.1\|WP_166312438.1\|198729_199344_+\|DUF4400-domain-containing-protein	gnl\|CDD\|379573	pfam14348, DUF4400, Domain of unknown function (DUF4400). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 209 and 249 amino acids in length. There is a single completely conserved residue P that may be functionally important.	0.00211331
NZ_CP049911.1\|WP_166312433.1\|191133_192171_-\|hypothetical-protein	gnl\|CDD\|379352	pfam13730, HTH_36, Helix-turn-helix domain.	0.00173266
NZ_CP049911.1\|WP_166312442.1\|200537_201017_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381603	cd13400, LT_IagB-like, Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.	1.46631e-54
NZ_CP049911.1\|WP_166312440.1\|199756_200077_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|368240	pfam05016, ParE_toxin, ParE toxin of type II toxin-antitoxin system, parDE. ParE is the toxin family of a type II toxin-antitoxin family. It is toxic towards DNA gyrase, but is neutralized by the antitoxin ParD. The family also encompasses RelE/ParE described in.	1.6736e-08
NZ_CP049911.1\|WP_166312428.1\|186759_187383_-\|phospholipase-D-family-protein	gnl\|CDD\|197267	cd09170, PLDc_Nuc, Catalytic domain of EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Catalytic domain of an EDTA-resistant nuclease Nuc from Salmonella typhimurium and similar proteins. Nuc is an endonuclease cleaving both single- and double-stranded DNA. It is the smallest known member of the phospholipase D (PLD, EC 3.1.4.4) superfamily that includes a diverse group of proteins with various catalytic functions. Most members of this superfamily have two copies of the conserved HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue) in a single polypeptide chain and both are required for catalytic activity. However, Nuc only has one copy of the HKD motif per subunit but form a functionally active homodimer (it is most likely also active in solution as a multimeric protein), which has a single active site at the dimer interface containing the HKD motifs from both subunits. Due to the lack of a distinct domain for DNA binding, Nuc cuts DNA non-specifically. It utilizes a two-step mechanism to cleave phosphodiester bonds: Upon substrate binding, the bond is first attacked by a histidine residue from one HKD motif to form a covalent phosphohistidine intermediate, which is then hydrolyzed by water with the aid of a second histidine residue from the other HKD motif in the opposite subunit.	2.8325e-59
NZ_CP049911.1\|WP_166312427.1\|186350_186647_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	1.0255e-23

>NZ_CP049911.1|WP_166312433.1|191133_192171_-|hypothetical-protein
MGIPAPSFPYPITLACTSLPHLESFADLPDGFIRIVSRIIQKINLKNPFSEIFATRSTIANESGKSLDTVHRAVKWLEDHGMIERERKAKIGYRGSKSPLIPTQKFLHSLNLVDENGNSREFPKFSTKTDFSDANKKSAPGANVAPTEKKNRLFKRFGNVSLPIDLSWLCERGGLTPYGVLGLMKLARSVKQTLSEVVHASMKYLDGLTKNELYAYITKLLQSGRDFKNLSEISKENDKNREISEYLKEKQKIFFGKKFISQSTRTIYEFTEDSVKCHYPDGASKTMVLEMGLLEAIQQGKLRPYVSQPKSCGPNAASVSTKNSILRKTFLESLFNIKPKVPLAS
>NZ_CP049911.1|WP_166312432.1|189007_189967_-|hypothetical-protein
MATSWKSRAADKNDPDVKKKDLYGVNPLIVEEEEGFNLRDYDDPEVIEHIESLCQSYMAGSYVPPPIARVDDDGRVVVIEGHCRIRAIKMAIERGKNIPFIDVLPFRGNDAERVQVMLRSAQGLSLKPLKIAIGYLRLRRMGHEVAEIAKSMGKSTAHVEQMLVLANANSDVHALVSSGAVNAYAAIEVVRKHGEKAGAVLQDLINGNEGKAKKVVTRSDVNEWIPPRKIIGNIYKSVDGFVDTFDKNVRVRLAELEKLDVEELRNKTIEVDAASLLEIFRSWSKADEAKKSKLEAGLKRKEKASQMDLAGTEEGDEEK
>NZ_CP049911.1|WP_166312431.1|188685_188991_-|hypothetical-protein
MNEKTHGLHMSVDGQLERMRYPEDYEDFLTRNGESVPPDEARAWLLMNKACGRKVIPMSSSCGHPCDNAAYGCKGFDYSGKGCSGYYDSLKSRNAAIGTED
>NZ_CP049911.1|WP_166312430.1|187940_188498_-|hypothetical-protein
MIIRPINADHLYPGVEDFELDRQMERDKRNFESTENWIYLGADIRDIFYSKVGITTGNLQSRSYSSAMPNYYLFCAFKAEIPTSKARLELVENDILANLDNQFGQQFRMCHAESGTLSECYYGVEFKYIFQAVHQIIYYRHPNAFTRILCEDDYGNAIGSRVRCEFNEVVVKNKKYWESLILQAD
>NZ_CP049911.1|WP_166312429.1|187656_187935_-|hypothetical-protein
MKILGVDFVNPPVRSLLWVAGVGVATALFSSALADMDLISKTGALWFVVGAMGGSFTSVVGVNLREHGWRGWVLFFTFMGLILSATYLYLTS
>NZ_CP049911.1|WP_166312428.1|186759_187383_-|phospholipase-D-family-protein
MFYPSKTTLIVAGVWASLLLPGWALPIEPMLSNTGGRFLKAVASELEPAVGNFEVAFSPNEGAEQLVVRVIDSTKLDLRVLAYSFTSARVTQAILRAQKRGVKIYMVADEQNNLSSTASPKARAALSALVTAGANVRVTSAYPIHHDKVIIADGQTVQTGSYNYSEAAASKNSENVFVNWNNPRLAQLYAKHFERNWSTAKKFEPSF
>NZ_CP049911.1|WP_166312427.1|186350_186647_-|H-NS-histone-family-protein
MTVSLKELLAQKVALEARIDEQRKIEHSGAVQKVRQLVSEYGLTQDDIFGRTRGSKAGTGETRTVPPKYRDPATGQTWTGRGKAPKWIEGQDREKFAI
>NZ_CP049911.1|WP_166312426.1|185952_186162_-|DUF3717-domain-containing-protein
MDAVLDFQSLNTALTNCMAAHPPVAPEFRMHPDAHAMSDPWATMVILRHESLPLHEIKQPVLEAIERWK
>NZ_CP049911.1|WP_166312425.1|185747_185894_+|hypothetical-protein
MKYKEPVVTWTVSGAAEQKAKFYRLGGSQWLQKMIDKAKDPKTEKAGD
>NZ_CP049911.1|WP_166312424.1|185414_185579_-|hypothetical-protein
MTYEEFKAAYVEAFTEMQKYTVDQVGSGHFAQKLADLSDAYPDFENSLFDEPSP
>NZ_CP049911.1|WP_166312434.1|193208_194384_-|ParB/RepB/Spo0J-family-partition-protein
MRTRKLNPAGATQEQPSQTPAPTAAPKRPDGPPLPLRDFKNVSRAPAVKVEASATGTDAPDETVHITDTSSAQEVVSQQSQESGLSQPLTAGAPVQNDSPSDRSYLQLDARLIDQNAHPPRLTYIDDAIKEIADSISKNGQRDAIHVIPHPKKPGRYIIGDGWTRVLAIRSYGINNGTVLAAVHKNLTESEASWLGMLQNDERSQLTDFDRGMYFANWLDDGMTIDDIANRVKMSRTRVGEFVVIRNLPMEIKEHARRTPKKMSASVFAIISSILNKSSEDKAIAICNKYIAGDHTHAWLRKQASEISENSRKKSANSVQYQRRYGQGHYRQRASGQVELNVVIPDTSLVTQFNADLEELLKKYLPQETADANGTAEGPDTDSESTGSTSE
>NZ_CP049911.1|WP_166312479.1|194387_195500_-|AAA-family-ATPase
MKYRLRQACQLLGVTDNTLRTYADNAGIQIKRANESNPRAVASRVFEPDTLFQLAQWRRAQGWSKAPAGQGPVIIVVDVVKGGTGKTTTAVETAVHLQFMGLRVLAIDLDVQANLTQAFGYEADILDDEIASYGVTQEAVINSTIDNLVTPFLQTSTRPSPSASDNSKIEGLIKKPFGEAGPHLIGANIDLANMETHIANSKGPREMCLRNLFDAATRGEISSLPLSNYDVVILDCPPNVSFTSTAALGAADLVIAPVRMDAFAIKGLIRLMGEIESIDATYKVRPELVILPTHYAPQIARIGRMQAKINQYKDLLAPNVISASEDFPKSLDQYLPLSLQRPSCTATSEYRMFAEFIQGKVLSISAKKGK
>NZ_CP049911.1|WP_166312435.1|196015_196354_+|H-NS-histone-family-protein
MAHEDDLDVQISELKKKLLQLEAQQEDARKEKIAEVVASIRAQINEFGLKPADLFPEARWVQVSRARPLKKDRPPKYRNEQGEVWSGGPGRKPRWVREVEARGEDINKYLIV
>NZ_CP049911.1|WP_166312436.1|196512_196905_+|hypothetical-protein
MWLYDGGPDGVCLRVNDASPTDGGYVMVFILPSGDARLLATRFPAKYVTTWRTNSKRCGGEDLERVLISPLHPRYEKIKRLLATQLIPKDDSEATLREISVETITEEVTKLFSLPTSPAHAVLEKAENLE
>NZ_CP049911.1|WP_166312437.1|196921_198727_+|conjugative-transfer-system-coupling-protein-TraD
MPNELFDFDNPWRPIYEGWQSAAWYGAMAVSFTSPLYMPLPTSFAAVAGSACTLMGSWRMYKAWDRASDKSRSMPGKVEFITIPQLQKLAPKFASKGEVWLGQGFHWTDLEANRMHALIGAGVANVLGKKALNGQGSYWLHGLSKEEDISAQLMLLEGHTLIVGSTGVGKTRLFDLLIAQAILRGEPVIIIDPKGDQGLADNARRVCEAMGAPEKFIYFNPAHPDKSACIDPMRNWNRKTELASRIAALIPSETGADPFTAFGWKVLNDIVSGLIATGRRPNLVQLRRYIEGGPDDLLVKALRVHFVKCVPNWETKVASYVKKAKGSLLDGYIDFYKEVVIHEAENVDLQGLISTFEHNRDHFQKMVASLIPILSMLTSEPLTDLLSPDLEPGHDKVVTDMSRVIRNNMVCYMGLDSLADATVGSAIGSVMLADMTAVAGDRYNYGVDEKKSINVFVDEAAEVINQPTIQLLNKGRGAGFRMFIATQTFADFASRLGDENKARQVLANTNNKIALRIQDSETQQYIADGIPKIKAQAMAVRYGHNIDADMHDQYSASYQEQATKEEADLIPPGVLSELPPLHFFARLSGGKTLKGKIPILV
>NZ_CP049911.1|WP_166312438.1|198729_199344_+|DUF4400-domain-containing-protein
MASKKSSDGKHSFASIILIIVLFGSLLIAALVPEQTFEAVRAKEQAQIVSWLGEDTDQWILDRIFRWLETVNAEAGNYLEKTESFVGKPAIDQWMVHRVYAVTIWAHVILYRMGMLILWLAFALPCMLAAFTDGFYQREISKASFTSQSPVRHKAGLEMVKLISMLMLLWIFMPVFISIIIAPVAIAAGSFAWWMWMSNMQKRL
>NZ_CP049911.1|WP_166312439.1|199397_199727_-|hypothetical-protein
MANIKYFSDVTGEAVQLKAPYGMPNEEFAARWPGIKGLRYDGYSMRVGYPTSGTSGVMPVTRMIEYKSQPSLHECNAKCLDGKHNGKCECRCGGKNHGFGMFSGLLKAA
>NZ_CP049911.1|WP_166312440.1|199756_200077_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MNRYQVLFSTDAAEDLERLFDHILERELASPSGDLDIPARAMEAIEQACSFLQHSPFSCRKAGSDPFLRELIISFGGSGYVALFEIHDSSTVIIGAIRHQLESDFH
>NZ_CP049911.1|WP_166312441.1|200073_200340_-|hypothetical-protein
MKSATIPPVRVEPAFRQEMEQALGPNENLASLVETAVRNEVSRRQAQAEFVRRGLASIQKTVATGTGIPAHVVIEKLQAKLAAAKKNA
>NZ_CP049911.1|WP_166312442.1|200537_201017_+|lytic-transglycosylase-domain-containing-protein
MSQWFLALVARIAFATAALASFPVLAGPACFDEAARRYHVPVELLKAISMVESRGDPNARNYNTNGSYDIGHMQINSWWLKTLEQYGITEETLLEPCVNTNIGAWVLAQNIARYGLTWNAVGAYNAASDSKRLVYARKVATTLRSQQMKAVKAAKQTQG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP049911_1	1.1\|192566\|56\|NZ_CP049911\|PILER-CR	192566-192621	56	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	192566-192621	1.0
NZ_CP049911_1	1.2\|192645\|53\|NZ_CP049911\|PILER-CR	192645-192697	53	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	192639-192691	1.0
NZ_CP049911_2	2.1\|192858\|55\|NZ_CP049911\|PILER-CR	192858-192912	55	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	192858-192912	1.0
NZ_CP049911_2	2.2\|192930\|59\|NZ_CP049911\|PILER-CR	192930-192988	59	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	192930-192988	1.0
NZ_CP049911_2	2.3\|193006\|52\|NZ_CP049911\|PILER-CR	193006-193057	52	NZ_CP049911	Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence	193006-193057	1.0

1. spacer 1.1|192566|56|NZ_CP049911|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cggctcagaatgaaatcatcctgttgccaggacgacgggaaaattggtacggaccg	CRISPR spacer
cggctcagaatgaaatcatcctgttgccaggacgacgggaaaattggtacggaccg	Protospacer
********************************************************

2. spacer 1.2|192645|53|NZ_CP049911|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcatcgctatgcggcaagaattcagtgatatctgagccagccttattaggg	CRISPR spacer
cagcatcgctatgcggcaagaattcagtgatatctgagccagccttattaggg	Protospacer
*****************************************************

3. spacer 2.1|192858|55|NZ_CP049911|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cggaggccgccccatggcgtacctcccggctggcatgagcaccactgggtaccat	CRISPR spacer
cggaggccgccccatggcgtacctcccggctggcatgagcaccactgggtaccat	Protospacer
*******************************************************

4. spacer 2.2|192930|59|NZ_CP049911|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgaaatcggaatcagcgactgtcatcctgtcaacaggatgcaatctgcgccgggggagg	CRISPR spacer
tgaaatcggaatcagcgactgtcatcctgtcaacaggatgcaatctgcgccgggggagg	Protospacer
***********************************************************

5. spacer 2.3|193006|52|NZ_CP049911|PILER-CR matches to NZ_CP049911 (Diaphorobacter sp. HDW4A plasmid p_unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cggaggccaggacatggtctggccagctggcttggtttccaccaagaggcat	CRISPR spacer
cggaggccaggacatggtctggccagctggcttggtttccaccaagaggcat	Protospacer
****************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3258

Bacillus_virus(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071038007.1\|1944_3258_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.0e-79	40.2

DBSCAN-SWA_2

8554 : 80032

Salmonella_phage(18.75%)

integrase,transposase

attL 74862:74876|attR 80191:80205

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043387381.1\|8554_9664_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.9e-35	31.4
WP_166312469.1\|9947_10853_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_071038011.1\|11014_12991_-	excinuclease ABC subunit UvrB	B2CRJ8	Acidianus_filamentous_virus	1.8e-06	35.7
WP_003158660.1\|14376_17292_-\|transposase	Tn3-like element IS1071 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-52	24.0
WP_028600946.1\|19863_20055_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_166312333.1\|20108_20993_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_008903065.1\|21110_21431_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_166312334.1\|21434_21872_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_166312335.1\|21883_22318_+	hypothetical protein	NA	NA	NA	NA
WP_166312336.1\|22271_22751_+	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_166312470.1\|22788_24519_+	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-10	21.2
WP_166312337.1\|26767_29737_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.7
WP_034377874.1\|29739_30297_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	7.5e-48	80.5
WP_166312338.1\|30427_31915_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_144373924.1\|31901_32375_-	cytochrome c	NA	NA	NA	NA
WP_003056107.1\|32403_33114_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.9e-30	37.4
WP_166312339.1\|36934_37582_+	hypothetical protein	NA	NA	NA	NA
WP_166312340.1\|37676_37982_+	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	7.3e-21	49.5
WP_166312341.1\|37978_38365_+	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.2e-29	59.3
WP_082585479.1\|38539_38764_-	hypothetical protein	NA	NA	NA	NA
WP_056265797.1\|38763_39048_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_056265800.1\|39062_39437_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_056265803.1\|39479_39917_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_166311894.1\|39905_41435_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-113	46.6
WP_056265807.1\|41516_41849_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_056265811.1\|41845_42196_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_166312342.1\|42612_43377_-	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_166312343.1\|43572_43932_-	hypothetical protein	NA	NA	NA	NA
WP_166312344.1\|44988_45267_-	hypothetical protein	NA	NA	NA	NA
WP_166312345.1\|45612_45762_-	hypothetical protein	NA	NA	NA	NA
WP_166312346.1\|47445_48246_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_166312347.1\|48544_49447_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_166312348.1\|52863_54585_+	hypothetical protein	NA	NA	NA	NA
WP_166312349.1\|54588_55608_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-41	33.6
WP_166312350.1\|55795_56545_+	hypothetical protein	NA	NA	NA	NA
WP_166312351.1\|56855_57389_-	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_166312352.1\|57793_58804_-	sugar kinase	NA	NA	NA	NA
WP_166312471.1\|58803_60345_-	altronate dehydratase	NA	NA	NA	NA
WP_166312353.1\|60400_61549_-	mannitol dehydrogenase family protein	NA	NA	NA	NA
WP_166312354.1\|61565_62576_-	zinc-binding alcohol dehydrogenase family protein	E3SJ82	Synechococcus_phage	2.4e-07	25.1
WP_166312355.1\|62623_63394_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_166312356.1\|63461_64190_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-30	38.2
WP_166312357.1\|64173_64824_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_166312358.1\|64839_65523_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_166312359.1\|65776_66472_+	FadR family transcriptional regulator	NA	NA	NA	NA
WP_166312360.1\|67124_67334_+	hypothetical protein	NA	NA	NA	NA
WP_166312361.1\|67529_68393_+	hypothetical protein	NA	NA	NA	NA
WP_166312362.1\|68698_68935_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_166312363.1\|69613_69925_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	2.0e-13	46.1
WP_166312364.1\|70008_70461_-	hypothetical protein	NA	NA	NA	NA
WP_166312365.1\|70636_70786_+	hypothetical protein	NA	NA	NA	NA
WP_166312366.1\|70814_71693_-	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	2.4e-24	35.7
WP_166312367.1\|71691_72048_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_166312472.1\|72083_72641_+	hypothetical protein	NA	NA	NA	NA
WP_166312368.1\|72689_72941_-	hypothetical protein	NA	NA	NA	NA
WP_166312369.1\|73766_74465_-	SOS response-associated peptidase	NA	NA	NA	NA
WP_166312370.1\|74501_74948_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	1.1e-22	42.3
74862:74876	attL	NA	NA	NA	NA
WP_166312371.1\|75412_76564_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_166312372.1\|76560_78228_+	hypothetical protein	NA	NA	NA	NA
WP_166312373.1\|78217_80032_+\|integrase	site-specific integrase	NA	NA	NA	NA
80191:80205	attR	NA	NA	NA	NA

DBSCAN-SWA_3

83894 : 90150

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312375.1\|83894_87143_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	8.6e-51	22.7
WP_166312376.1\|87157_88387_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_166312377.1\|88593_88968_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_166312474.1\|89142_90150_+	DUF4113 domain-containing protein	A0A1W6JNT0	Morganella_phage	1.1e-52	37.5

DBSCAN-SWA_4

101628 : 103620

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312385.1\|101628_103620_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	2.9e-09	32.4

DBSCAN-SWA_5

112677 : 146898

Morganella_phage(16.67%)

integrase,transposase

attL 129329:129367|attR 150465:150503

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312390.1\|112677_113544_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.5e-21	33.3
WP_166312477.1\|113597_114767_+	NnrS family protein	NA	NA	NA	NA
WP_166312391.1\|115498_115999_+	hypothetical protein	A0A1W6JNT0	Morganella_phage	1.7e-22	41.1
WP_166312392.1\|115944_116352_+	DUF4113 domain-containing protein	A0A1W6JNT0	Morganella_phage	4.6e-10	30.4
WP_166312393.1\|117063_117492_-	hypothetical protein	NA	NA	NA	NA
WP_166312478.1\|118140_119136_+	ParM/StbA family protein	A7KUY1	Bacillus_phage	3.5e-11	24.7
WP_166312394.1\|119132_119798_+	hypothetical protein	NA	NA	NA	NA
WP_044402653.1\|119884_120214_+	hypothetical protein	NA	NA	NA	NA
WP_166312395.1\|120228_120447_+	hypothetical protein	NA	NA	NA	NA
WP_166312396.1\|120459_120930_+	hypothetical protein	NA	NA	NA	NA
WP_166312397.1\|120962_122111_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_166312398.1\|122107_122641_-	DUF1817 domain-containing protein	NA	NA	NA	NA
WP_166312399.1\|122637_123153_-	hypothetical protein	NA	NA	NA	NA
WP_166312400.1\|123149_124505_-	type II toxin-antitoxin system HipA family toxin YjjJ	NA	NA	NA	NA
WP_000414383.1\|125281_125716_-	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_015272416.1\|125787_126138_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000732290.1\|126153_126429_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_003090700.1\|126500_128186_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.3e-39	29.2
WP_043792548.1\|128203_128569_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_003132004.1\|128565_128802_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
129329:129367	attL	NA	NA	NA	NA
WP_001389365.1\|129613_130378_-\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_000376623.1\|130884_131385_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000946487.1\|131512_132364_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.1e-11	27.2
WP_001470697.1\|132465_133119_+\|integrase	site-specific integrase	A0A2I7SAK5	Vibrio_phage	1.1e-21	58.1
WP_001747814.1\|133345_134878_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_001253717.1\|134969_135761_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_001257840.1\|135781_136957_-	tetracycline efflux MFS transporter Tet(G)	NA	NA	NA	NA
WP_000163574.1\|137060_137687_+	tetracycline resistance transcriptional repressor TetR(G)	NA	NA	NA	NA
WP_000480968.1\|137872_138709_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|138708_139512_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_023434504.1\|139523_140192_-	recombinase family protein	E5FFF9	Burkholderia_phage	5.5e-37	48.1
WP_006473469.1\|140317_143203_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.9e-190	40.0
WP_000214125.1\|143368_144583_-	chloramphenicol/florfenicol efflux MFS transporter FloR2	S4TR35	Salmonella_phage	9.8e-16	23.7
WP_023835631.1\|144799_145783_-	dihydropteroate synthase	NA	NA	NA	NA
WP_000845039.1\|145884_146898_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
150465:150503	attR	NA	NA	NA	NA

DBSCAN-SWA_6

149912 : 181590

Vibrio_phage(30.0%)

integrase,transposase

attL 163221:163235|attR 183638:183652

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003100847.1\|149912_150470_+	recombinase family protein	A0A0C4UR34	Shigella_phage	3.3e-59	63.2
WP_166312402.1\|150476_150686_-	hypothetical protein	NA	NA	NA	NA
WP_166312403.1\|150719_151184_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_166312404.1\|151268_151571_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	5.6e-13	46.1
WP_166312405.1\|152424_153405_+	hypothetical protein	NA	NA	NA	NA
WP_166312406.1\|153441_153792_+	hypothetical protein	NA	NA	NA	NA
WP_003158660.1\|153910_156826_+\|transposase	Tn3-like element IS1071 family transposase	A0A1B0V7H9	Salmonella_phage	1.4e-52	24.0
WP_003056109.1\|158766_159918_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_004393990.1\|159914_160523_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_166312407.1\|161162_161876_+	hypothetical protein	NA	NA	NA	NA
163221:163235	attL	NA	NA	NA	NA
WP_166301587.1\|163846_164179_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_082759168.1\|164175_164724_-\|transposase	transposase	NA	NA	NA	NA
WP_166312408.1\|164782_165088_+	hypothetical protein	NA	NA	NA	NA
WP_166312409.1\|165070_166093_-	S49 family peptidase	A0A2I6UH21	Salinibacter_virus	4.1e-15	30.2
WP_166312410.1\|166206_168126_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJP1	Virus_Rctr41k	1.3e-06	30.1
WP_166312411.1\|168131_168518_-	hypothetical protein	NA	NA	NA	NA
WP_166312412.1\|168520_168925_-	hypothetical protein	NA	NA	NA	NA
WP_166312413.1\|168921_169914_-	ParM/StbA family protein	R4JMR4	Bacillus_phage	2.1e-08	23.7
WP_166312414.1\|170474_170969_+	hypothetical protein	NA	NA	NA	NA
WP_166300226.1\|171137_172070_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.9e-56	39.1
WP_166312415.1\|172262_172607_+	hypothetical protein	NA	NA	NA	NA
WP_166312416.1\|172914_173250_+	hypothetical protein	NA	NA	NA	NA
WP_166312417.1\|173373_174939_+	AAA family ATPase	A0A0A0P263	Enterobacteria_phage	7.9e-10	25.1
WP_166312418.1\|175358_177077_-	hypothetical protein	NA	NA	NA	NA
WP_166300226.1\|177457_178390_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.9e-56	39.1
WP_166312419.1\|178699_179131_-	hypothetical protein	NA	NA	NA	NA
WP_166312420.1\|179447_180518_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_166300226.1\|180657_181590_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.9e-56	39.1
183638:183652	attR	NA	NA	NA	NA

DBSCAN-SWA_7

184841 : 189967

Cronobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312423.1\|184841_185090_-	hypothetical protein	A0A1W5N0E9	Cronobacter_phage	4.3e-11	51.4
WP_166312424.1\|185414_185579_-	hypothetical protein	NA	NA	NA	NA
WP_166312425.1\|185747_185894_+	hypothetical protein	NA	NA	NA	NA
WP_166312426.1\|185952_186162_-	DUF3717 domain-containing protein	NA	NA	NA	NA
WP_166312427.1\|186350_186647_-	H-NS histone family protein	F8TUP5	EBPR_podovirus	3.7e-09	45.5
WP_166312428.1\|186759_187383_-	phospholipase D family protein	NA	NA	NA	NA
WP_166312429.1\|187656_187935_-	hypothetical protein	NA	NA	NA	NA
WP_166312430.1\|187940_188498_-	hypothetical protein	NA	NA	NA	NA
WP_166312431.1\|188685_188991_-	hypothetical protein	NA	NA	NA	NA
WP_166312432.1\|189007_189967_-	hypothetical protein	A0A0U4JP11	Pseudomonas_phage	5.3e-33	41.0

DBSCAN-SWA_8

194387 : 195500

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312479.1\|194387_195500_-	AAA family ATPase	A0A240F4U1	Ochrobactrum_phage	9.6e-10	25.4

DBSCAN-SWA_9

219777 : 226968

Salmonella_phage(66.67%)

integrase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166312455.1\|219777_221079_+	Y-family DNA polymerase	I6RSM4	Salmonella_phage	4.3e-86	41.1
WP_166312456.1\|221194_222562_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.3e-112	49.8
WP_166312457.1\|222845_223691_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_166312458.1\|223995_226968_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.5

DBSCAN-SWA_10

237106 : 241385

Virus_Rctr41k(50.0%)

integrase,transposase

attL 235811:235826|attR 241437:241452

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
235811:235826	attL	NA	NA	NA	NA
WP_166312465.1\|237106_238114_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	47.2
WP_166312466.1\|238206_238497_-	hypothetical protein	NA	NA	NA	NA
WP_166312467.1\|239788_240286_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_166312468.1\|240365_241385_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	8.7e-42	34.6
241437:241452	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP049910

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP049910_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049910_1

247827-247931

Orphan

Consensus_repeat	Method
GCGGTCATTGCGCTCGTTGCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP049910_1

>merge|NZ_CP049910|1|247827-247931|CRISPRCasFinder
GCGGTCATTGCGCTCGTTGCGGCGGTCATTGTTGCGAGCTTCGCCGCCTTCACGTGGCTGGCGCGGCTCGCCATTGGCGCTGCGGTCATTGCGCTCGTTGCGGCG

>NZ_CP049910|1|1|247827-247931|CRISPRCasFinder
GCGGTCATTGCGCTCGTTGCGGCG	GTCATTGTTGCGAGCTTCGCCGCCTTCACGTGGCTGGCGCGGCTCGCCATTGGCGCT
GCGGTCATTGCGCTCGTTGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049910.1\|WP_166299895.1\|240978_241431_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239538
NZ_CP049910.1\|WP_166311804.1\|242628_243792_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|176459
NZ_CP049910.1\|WP_166299915.1\|253767_254556_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|381176
NZ_CP049910.1\|WP_166299903.1\|245840_246623_-\|peroxide-stress-protein-YaaA	unknown	unknown	gnl\|CDD\|234999
NZ_CP049910.1\|WP_013519991.1\|255881_256064_+\|50S-ribosomal-protein-L32	unknown	unknown	gnl\|CDD\|234901
NZ_CP049910.1\|WP_166299887.1\|237346_238213_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP049910.1\|WP_166299889.1\|238304_238886_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP049910.1\|WP_166299897.1\|241570_242521_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP049910.1\|WP_166299909.1\|251570_252239_+\|HAD-IIIA-family-hydrolase	unknown	unknown	gnl\|CDD\|319835
NZ_CP049910.1\|WP_166299891.1\|239145_240225_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP049910.1\|WP_166299919.1\|255177_255732_+\|DUF177-domain-containing-protein	unknown	unknown	gnl\|CDD\|224317
NZ_CP049910.1\|WP_166299921.1\|256183_257215_+\|phosphate-acyltransferase-PlsX	unknown	unknown	gnl\|CDD\|235414
NZ_CP049910.1\|WP_166299923.1\|257246_258224_+\|ketoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|236475
NZ_CP049910.1\|WP_166299913.1\|252640_253696_+\|S49-family-peptidase	unknown	unknown	gnl\|CDD\|132934
NZ_CP049910.1\|WP_166299911.1\|252257_252641_+\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|225057
NZ_CP049910.1\|WP_166299917.1\|254552_255152_-\|septum-formation-inhibitor-Maf	unknown	unknown	gnl\|CDD\|234855
NZ_CP049910.1\|WP_166299899.1\|244003_244870_-\|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF	unknown	unknown	gnl\|CDD\|236986
NZ_CP049910.1\|WP_166299901.1\|244910_245798_-\|2-oxoglutarate-dependent-dioxygenase	unknown	unknown	gnl\|CDD\|214780
NZ_CP049910.1\|WP_166299907.1\|250552_251578_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|182909
NZ_CP049910.1\|WP_166299893.1\|240291_240858_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102

Protein	Function_ID	Function_description	E-value
NZ_CP049910.1\|WP_166299895.1\|240978_241431_+\|MaoC-family-dehydratase	gnl\|CDD\|239538	cd03454, YdeM, YdeM is a Bacillus subtilis protein that belongs to a family of prokaryotic proteins of unkown function. YdeM has sequence similarity to the hot-dog fold of (R)-specific enoyl-CoA hydratase. Other enzymes with this fold include the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	1.52759e-69
NZ_CP049910.1\|WP_166311804.1\|242628_243792_+\|DNA-polymerase-IV	gnl\|CDD\|176459	cd03586, PolY_Pol_IV_kappa, DNA Polymerase IV/Kappa. Pol IV, also known as Pol kappa, DinB, and Dpo4, is a translesion synthesis (TLS) polymerase. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Known primarily as Pol IV in prokaryotes and Pol kappa in eukaryotes, this polymerase has a propensity for generating frameshift mutations. The eukaryotic Pol kappa differs from Pol IV and Dpo4 by an N-terminal extension of ~75 residues known as the "N-clasp" region. The structure of Pol kappa shows DNA that is almost totally encircled by Pol kappa, with the N-clasp region augmenting the interactions between DNA and the polymerase. Pol kappa is more resistant than Pol eta and Pol iota to bulky guanine adducts and is efficient at catalyzing the incorporation of dCTP. Bacterial pol IV has a higher error rate than other Y-family polymerases.	1.28679e-131
NZ_CP049910.1\|WP_166299915.1\|253767_254556_-\|SAM-dependent-methyltransferase	gnl\|CDD\|381176	cd11649, RsmI_like, uncharacterized subfamily of the tetrapyrrole methylase family similar to Ribosomal RNA small subunit methyltransferase I (RsmI). RsmI, also known as rRNA (cytidine-2'-O-)-methyltransferase, is an S-AdoMet (S-adenosyl-L-methionine or SAM)-dependent methyltransferase responsible for the 2'-O-methylation of cytidine 1402 (C1402) at the P site of bacterial 16S rRNA. Another S-AdoMet-dependent methyltransferase, RsmH (not included in this family), is responsible for N4-methylation at C1402. These methylation reactions may occur at a late step during 30S assembly in the cell. The dimethyl modification is believed to be conserved in bacteria, may play a role in fine-tuning the shape and functions of the P-site to increase the translation fidelity, and has been shown for Staphylococcus aureus, to contribute to virulence in host animals by conferring resistance to oxidative stress.	4.99608e-102
NZ_CP049910.1\|WP_166299903.1\|245840_246623_-\|peroxide-stress-protein-YaaA	gnl\|CDD\|234999	PRK02101, PRK02101, peroxide stress protein YaaA.	1.9246e-137
NZ_CP049910.1\|WP_013519991.1\|255881_256064_+\|50S-ribosomal-protein-L32	gnl\|CDD\|234901	PRK01110, rpmF, 50S ribosomal protein L32; Validated.	6.23724e-24
NZ_CP049910.1\|WP_166299887.1\|237346_238213_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	4.63089e-58
NZ_CP049910.1\|WP_166299889.1\|238304_238886_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.15798e-10
NZ_CP049910.1\|WP_166299897.1\|241570_242521_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	0.00226444
NZ_CP049910.1\|WP_166299909.1\|251570_252239_+\|HAD-IIIA-family-hydrolase	gnl\|CDD\|319835	cd07533, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily, similar to Parvibaculum lavamentivorans HAD-superfamily hydrolase, subfamily IA, variant 1. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.17249e-66
NZ_CP049910.1\|WP_166299891.1\|239145_240225_+\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	1.90446e-19
NZ_CP049910.1\|WP_166299919.1\|255177_255732_+\|DUF177-domain-containing-protein	gnl\|CDD\|224317	COG1399, COG1399, Predicted metal-binding, possibly nucleic acid-binding protein [General function prediction only].	1.45195e-25
NZ_CP049910.1\|WP_166299921.1\|256183_257215_+\|phosphate-acyltransferase-PlsX	gnl\|CDD\|235414	PRK05331, PRK05331, phosphate acyltransferase PlsX.	0
NZ_CP049910.1\|WP_166299923.1\|257246_258224_+\|ketoacyl-ACP-synthase-III	gnl\|CDD\|236475	PRK09352, PRK09352, beta-ketoacyl-ACP synthase 3.	0
NZ_CP049910.1\|WP_166299913.1\|252640_253696_+\|S49-family-peptidase	gnl\|CDD\|132934	cd07023, S49_Sppa_N_C, Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad. Signal peptide peptidase A (SppA; Peptidase S49; Protease IV): SppA is found in all three domains of life and is involved in the cleavage of signal peptides after their removal from the precursor proteins by signal peptidases. This subfamily contains members with either a single domain (sometimes referred to as 36K type), such as sohB peptidase, protein C and archaeal signal peptide peptidase, or an amino-terminal domain in addition to the carboxyl-terminal protease domain that is conserved in all the S49 family members (sometimes referred to as 67K type), similar to E. coli and Arabidopsis thaliana SppA peptidases. Site-directed mutagenesis and sequence analysis have shown these SppAs to be serine proteases. The predicted active site serine for members in this family occurs in a transmembrane domain. Mutagenesis studies also suggest that the catalytic center comprises a Ser-Lys dyad and not the usual Ser-His-Asp catalytic triad found in the majority of serine proteases. Interestingly, the single membrane spanning E. coli SppA carries out catalysis using a Ser-Lys dyad with the serine located in the conserved carboxy-terminal protease domain and the lysine in the non-conserved amino-terminal domain.	1.18859e-83
NZ_CP049910.1\|WP_166299911.1\|252257_252641_+\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|225057	COG2146, {NirD}, Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only].	1.80851e-15
NZ_CP049910.1\|WP_166299917.1\|254552_255152_-\|septum-formation-inhibitor-Maf	gnl\|CDD\|234855	PRK00884, PRK00884, Maf-like protein; Reviewed.	5.49146e-92
NZ_CP049910.1\|WP_166299899.1\|244003_244870_-\|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF	gnl\|CDD\|236986	PRK11792, queF, 7-cyano-7-deazaguanine reductase; Provisional.	0
NZ_CP049910.1\|WP_166299901.1\|244910_245798_-\|2-oxoglutarate-dependent-dioxygenase	gnl\|CDD\|214780	smart00702, P4Hc, Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.	4.16792e-37
NZ_CP049910.1\|WP_166299907.1\|250552_251578_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|182909	PRK11025, PRK11025, 23S rRNA pseudouridine(955/2504/2580) synthase RluC.	3.39033e-113
NZ_CP049910.1\|WP_166299893.1\|240291_240858_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	2.32956e-12

>NZ_CP049910.1|WP_166299903.1|245840_246623_-|peroxide-stress-protein-YaaA
MLFLLSPAKSLDYDTPLAPDLAHTQPQFVPDAQKLIDVLKQKSPQEIASLMGISDTLAGLNVARYATWSPKFTSKNSRQAVMAFNGDVYEGLRAQSLSTDDLAWAQSHLAILSGLYGVLRPLDRMQPYRLEMGTRLETSAGATLYKFWGKRIAEHLNKRLQADTTPVVVNLASQEYFKSVDLKTLKARVIECVFEDFKNGQYKIISFYAKRARGLMARFAIEHRVTTPHQLEAFGIDGYALHTASSSPERLVFRRKLAEN
>NZ_CP049910.1|WP_166299901.1|244910_245798_-|2-oxoglutarate-dependent-dioxygenase
MPSRTSSHSAATQAQQPITPELRRWIVAQAQAGFTAPALLKSMTDSGWNEDVAIDALEVVLREHLHTVTVQSGLPEASPVPEPLLEESPLFIDVGDRQVEVLLEVATPRIVLFGNLLSREECETLIDAAKPRMARSKTVETKTGGEEVNASRTSEGMFFQRGEIEIVKKLEARIAKLVNWPLENGEGLQILRYGPGAEYKPHYDYFDPAEPGTATITKRGGQRVGTLVVYLNSPIKGGGTVFPDIHLEVGPRQGNAVFFSYDRPHASTKTLHGGSPVIEGEKWIATKWLRQGEFV
>NZ_CP049910.1|WP_166299899.1|244003_244870_-|NADPH-dependent-7-cyano-7-deazaguanine-reductase-QueF
MNVPSSPDSPEQSPLGKASAYADQYDATLLFPIPRETKRKEIGVDDKAPPFFGADLWTAYEVSWLNAKGKPQVALAHFTIPCESPNIVESKSFKLYLNSFNNSRFTGVEEVRDAIRADVSEAVWRGSDAPRTIGLKLVLAENFEQERMGELEGLLLDRLDIDCDQYSPAPELLTANHGEAPVSEELVSHLLKSNCLVTGQPDWGSVQISYSGAQIDQEGLLKYIVSFRNHNEFHEQCVERIFMDIWTRCRPIKLSVYARYTRRGGLDINPLRTSHPQALPRNLRNARQ
>NZ_CP049910.1|WP_166311804.1|242628_243792_+|DNA-polymerase-IV
MDAFYASVELLRYPQLKGLPVVIGGGRRSEDDALVAKYGDRLCEIPIAEFPLLKDYVGRGVITTATYAARQFGVGSAMGMMKAARLCPQAIMLPVDFAQYRKFSRQFKDIILSMAPRMEDRGVDEVYIDFTDVPGGQREGGRVLARLMQKTIFEATGLTCSIGVAPNKQIAKMASEFNKPNGISIVHESDFETMIWPLACRKINGVGPKADAKLKDHGIETIGQLAAKPRDWLIANFGKSYGAWLHAAAHGHDDRPVVTESEPVSMSRETTFDRDLHAVHDKAELGRIFTELCLQVAADLKRKGYAGKTIGIKLRYDDFKIATRDQSIDDYTQDAATIRRFAGLCLKRVPLHKRLRLLGVRVGNLLPQDEVEQARAEQKSGESASLF
>NZ_CP049910.1|WP_166299897.1|241570_242521_+|DMT-family-transporter
MSTAQQATSTLIEHAWLWVPVVLFAALAQTVRNSAQRSLTQELGTLSATLVRFLYGLPFAAVWLGLLYFWPEQRPSIPHMSGAYFGWIALGAFFQVAATAALLLAMKERNFAVAITLSKTEVLQVALFGAVFLHELPTPWALFAMVLATLGVFLLSLPPRGQLFSLSAWLSKSAMYGVVCGACFAIATIGFRGAAIELNAETPWLSGAWGVLFAQAMQTVGLGAWVQLRTERGLAPLFRAWKLSMVAGSMGAAASLAWFTAYAMQSAASVRTLGMVEVVFSYIVSRKFFSESFSRPEKIGISLVLVGLVLICAFGS
>NZ_CP049910.1|WP_166299895.1|240978_241431_+|MaoC-family-dehydratase
MSEKLYLDDLFVGQKFKSREYLLDARQIMAYAREFDPQPFHTDPELAKNTFFQGLAASGWHTASITMKLVVESLPMSGGVIGAGVEELRWPLPTRPGDVLHLESEVLEIIPSRSRPDRAIVRIRCDTKNQNGDVVQSFIPKLLAFKRQAA
>NZ_CP049910.1|WP_166299893.1|240291_240858_-|TetR/AcrR-family-transcriptional-regulator
MRYPASETAQKRERILDEAARLFRERGFARVGVAEIMQAAGLTHGAFYAHFTSKEALASEALARAFTHSERRLFRKRQADDDLRQRFVERYLNRAHLSDPGDGCPLVSLAPEVARSAALQDSFTEALETMITRMAESFDWADDHARERSITLLSTAVGALTLARAVNRPQLANELLNTVKSQLLQQSG
>NZ_CP049910.1|WP_166299891.1|239145_240225_+|OmpA-family-protein
MLDNLIREIGTRFGLGGDQAKSIAQMLLAFITNPASGGISGFLTRLRGEGLEGVVQSWLGTSSTPQVPSGTQVESMFGAGAGGGLLSTIVSRLGLPRDQVVGVVGAMLPKLISFLTPGGSVPSVLPAEVASLAEGGRGLLGAALAGTAAVGAGAASVSSAASQTAAAASSAGGGLGKWLPWIIGALIVIFGINYCSKKKTDVDTPPPASTTAPATPAPTAPPASVAAVPAPAAASDTAVGIPMGAAVIDSMAQDLPMLRVFFDTGKTDVATEFNDKSKAFVDYLKANADAKAVVSGFNDPTGDPVKNAELSKQRAQAVQSALVAAGIPADRTVLEKPAETTDTGTTNAASRRVDVVVRK
>NZ_CP049910.1|WP_166299889.1|238304_238886_-|TetR/AcrR-family-transcriptional-regulator
MRKKEFEPDDIADAAMNVFWQRGYAATSVQDLVNGTGLSRSSLYSTFENKQALYQQALRRYATVTTANVELLAGDAPAKELIRELLLRIASDELQDPQRRGCLIANASLELAGHDPAVAELVTHNLQRLQKALEKLIQRAQNTQEISPDKSARALARFVVNTIQGMRVSSKGSTAAQRKQCLHDVIEVTLSAL
>NZ_CP049910.1|WP_166299887.1|237346_238213_-|NAD(P)-dependent-oxidoreductase
MQDLNNTTSVAVLGTGTMGAPMARNLARRGFSVRAWNRTFDKARALEADGVAAFEHAADAVDRADIVITMLKDADSVMNAMELAASGLRPHALWLQMSTVGIAGTALLQAHARQLGLNFYDAPVQGTRQPAEQAQLIILASGPLSHRSQAQAVFDAVGKRTIWASETAGESSRLKLALNHWAFSLTHGLAESLAFAQALGVDPALVVNAVSDGPMDSGFFQAKSAAILKNNFAASFSVVNAVKDAQLVVDAAHDAGLRLDGAQAGLQRFERALAAGHGDKDMAASFLA
>NZ_CP049910.1|WP_166299907.1|250552_251578_+|RluA-family-pseudouridine-synthase
MKHIIEGKQAKPAAPISTSSVRIIEVDAEFAGQRLDNFLIRELKGVPKTHVYRIIRSGEVRVNKGRASADTRIEAGDQVRLPPVRISEKVAEKAERPAPPREFPVLLEDDHLLAIDKPAGIAVHGGSGVSFGVIEQLRQARVGAKFLELVHRLDRETSGILLVAKRRSALVALQDQFRERETGKTYLALVTGAWPAKLKVIDTPLHKYLQEDGERRVRTTTKDDPDGMRSITLVKVRSTYPPRPMQGLPAMTLLEVTIKTGRTHQIRVHLSSQGHPIAGDDKYGDFDLNKRLQKQGLKRMFLHAWRLQFNHPATSERCELRTELPPELADFLTTEPVAPHA
>NZ_CP049910.1|WP_166299909.1|251570_252239_+|HAD-IIIA-family-hydrolase
MPDNHIRRFDLIAFDWDGTLYDSTACIVQSIQEAVRDVGGTVPSDKDAAWVIGMALEPALAKAAPDVPVEKYPELANRYRYHYLKHHDDLNLFDGVMPMLDDLRKRGYLLAVATGKSRRGLDHVLESKELQGVFDGSRTADETAGKPHPQMLNELMEQWGIEPGRTLMIGDTTHDLQMAVLAGCASVGVAYGAHDTAGFAEFRPVFVAETVANLHQWLLGNA
>NZ_CP049910.1|WP_166299911.1|252257_252641_+|Rieske-2Fe-2S-domain-containing-protein
MNPTAANTGIELCASDALVDGGRAVSFDVRFAGESCRAFAIRFEGRVHAFLNRCTHVPMEMDYQPDQFFDDTGQWLLCATHGAAYRPDTGECGGGPCRGGLVKIPLSEADGVVRWHTADNLQPVEFD
>NZ_CP049910.1|WP_166299913.1|252640_253696_+|S49-family-peptidase
MTDPTRPDFPGSESSEPAAPDLWGNATASGKPASAAASKSSGVPGWERDVLEKLVFSTLKEQRSARRWRNFMRLAWLLVIITIAVILFSKETSATSKTTPHTAVVDIKGEIASGNEASAEFVVAAMRSAFEDSGAQAVVLLINSPGGSPVQAGIINDEIVRLKAKHKKPVYAVVEETCASAAYYIAAAADEIFVDKASIVGSIGVLMDGFGFTGTMEKLGVERRLLTAGENKGFLDPFSPQTEHQREYAQQMLNQIHQQFISVVKTGRGDRLKETPETFSGLFWTGQQAVEMGLADKMGNLDYVAREVVKAEEVVDYTKRDNVAERLVKRFGAAMGAGAAKSLQSSALQLR
>NZ_CP049910.1|WP_166299915.1|253767_254556_-|SAM-dependent-methyltransferase
MSTEQQNAKGRLYLVPAPLDFGCDSQAPLTDALPDGTLRQAAALTHWICENAKSTRAYLKRVDAVHPLAKVLQEQTITELPREVHKKGDHGGRGNVQFDARSMLAAALSGEDIGLISEAGMPAVADPGSSVVRAAHDLGIQVVPLVGPVSLLLAIAASGLNGQNFAFVGYLPQDSAERAKRLKELETLAVKHGQSQLFIETPYRNAAVWQALMQGLQPNTRLAIASGLTLATANIQSRPALQWRDLPCPADNRTPTVFLIGT
>NZ_CP049910.1|WP_166299917.1|254552_255152_-|septum-formation-inhibitor-Maf
MQQSTFPSRPLILGSTSRYRSELLARLRIPFETIAPHVDETPQPGETPQDLALRLAAAKAQAVAEQFPNAVVIGSDQVADLNGKPLGKPETHERAVAQLQEMRGHAMVFHTAVSVVCIATGFSAIDVAPVHVRFRDLSDDEIERYLRAEQPYDCAGSAKSEGLGISLLDALDSDDPTSLIGLPLIRTCRMLRAAGLVLP
>NZ_CP049910.1|WP_166299919.1|255177_255732_+|DUF177-domain-containing-protein
MTKEHSPDRLDIKAFAQAGGHLSRHDSLLKYKRLAEESKGLHPDLMVDWTADGEIRTVAGLGAQVWMHLVVHATVPMQCQRCLGPVDVPLDIDREFRFVADEATAEALDDECEEDLLVLSREFDLRQLIEDELLMELPVVPRHDECPTPVTLESSDEDFEEASNQKPNPFAALAGLRKDNDKKR
>NZ_CP049910.1|WP_013519991.1|255881_256064_+|50S-ribosomal-protein-L32
MAVQQNKKSPSKRGMHRSHNALTTPGTAVEPTTGETHLRHHISPNGFYRGRQVLKNKSEA
>NZ_CP049910.1|WP_166299921.1|256183_257215_+|phosphate-acyltransferase-PlsX
MITLAVDCMGGDHGPSVTLPACRQFLEQHSDVHLLMVGQEASLRDFKHERITIVNATEVVAMDDAVETALRRKKDSSMRVAIQQVKDGAAQVAVSAGNTGALMAIARYLLKTLDGIDRPAIATQMPNEKGGATTVLDLGANVDCTAEHLLQFAVMGSALVSVLQDCEQPKVGLLNIGEEVIKGNEVIKQTGELLRRAGAQGDLNFYGNVEGNDIFKGVVDIVVCDGFVGNVALKATEGVASMIVGGLKSEFKRNIFTKMAAIVAYPVLSALMKRMDHRRYNGAALLGLRGLVFKSHGSADAIGFEHALNRAYDAARNNLLDRVRTKVAHAAPLLATGAASASV
>NZ_CP049910.1|WP_166299923.1|257246_258224_+|ketoacyl-ACP-synthase-III
MRRYSRITGTGSYLPPRRVTNDDFVAQLAEQGIETSDQWIVERTGIRARHFAERDVASSDLALEAARKAIEAAGITAEDIDLIIVATSTPDMVFPSTAAILQGKLGIHGCPAFDVQAVCSGFVYALTVADSMLKSGVATRALVIGSEVFSRILDYTDRTTCVLFGDGAGAVVLEASDEPGILACDLHADGRHVDILCVPGNVYGGQILGDPLLKMDGQAVFKLAVGVLEKAARATLEKANMTEADIDWLIPHQANIRIMQSTARKLKLSMDKVIVTVDQHGNTSAASIPLALDHGVRSGQIKPGQTLLLEGVGGGFAWGAVLLKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP049910_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP049910_2

5786067-5786262

Orphan

Consensus_repeat	Method
GTGACCCCGGTTGCCCCCGTTGCGCCGGTTGGACCTGTAGGCCCTATAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP049910_2

>merge|NZ_CP049910|2|5786067-5786262|PILER-CR
GTGGCTCCGGTTGCACCCGTTGCGCCGGTTGGGCCTGTGGCTCCCGTGGCTCCGTTTGCCCCAGTGGTGCCAGTGCCGGAGACCCCCGTTGCGCCGGTTGGACCCGTAGGTCCTATAGCTCCCGTGGTGCCCGTTCCTGAGTCACCGGTGACCCCGGTTGCCCCCGTCGCGCCGGTTGGACCTGTCGGCCCTGTCG

>NZ_CP049910|2|1|5786067-5786262|PILER-CR
GTGGCTCCGGTTGCACCCGTTGCGCCGGTTGGGCCTGTGGCTCCCGTGG	CTCCGTTTGCCCCAGTGGTGCCAGTGCCGGAGACCCCCGTTGCG
CCGGTTGGACCCGTAGGTCCTATAGCTCCCGTGGTGCCCGTTCCTGAGT	CACCGGTGACCCCGGTTGCCCCCGTCGCG
CCGGTTGGACCTGTCGGCCCTGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP049910.1\|WP_166311275.1\|5784345_5785431_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133005
NZ_CP049910.1\|WP_166311272.1\|5782486_5782732_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049910.1\|WP_166311286.1\|5796839_5797307_+\|GyrI-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|214874
NZ_CP049910.1\|WP_166311285.1\|5795636_5796677_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235713
NZ_CP049910.1\|WP_166311274.1\|5783560_5784130_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|153097
NZ_CP049910.1\|WP_166311271.1\|5781051_5781657_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP049910.1\|WP_166311278.1\|5788046_5790134_-\|acetate--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|223972
NZ_CP049910.1\|WP_166311284.1\|5794930_5795542_+\|DUF1439-domain-containing-protein	unknown	unknown	unknown
NZ_CP049910.1\|WP_166311280.1\|5791231_5791633_-\|OB-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|224462
NZ_CP049910.1\|WP_166311281.1\|5791629_5792784_-\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238425
NZ_CP049910.1\|WP_166311279.1\|5790169_5791177_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP049910.1\|WP_166311268.1\|5777931_5778819_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP049910.1\|WP_166312275.1\|5781674_5782520_+\|DTW-domain-containing-protein	unknown	unknown	gnl\|CDD\|225690
NZ_CP049910.1\|WP_166311269.1\|5778855_5780307_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143432
NZ_CP049910.1\|WP_166311273.1\|5782927_5783476_-\|DUF2939-domain-containing-protein	unknown	unknown	gnl\|CDD\|378575
NZ_CP049910.1\|WP_166311267.1\|5777062_5777785_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049910.1\|WP_166311282.1\|5792819_5793671_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP049910.1\|WP_166311283.1\|5794020_5794698_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374318
NZ_CP049910.1\|WP_166311277.1\|5786667_5787273_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP049910.1\|WP_166311270.1\|5780536_5780923_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319923

Protein	Function_ID	Function_description	E-value
NZ_CP049910.1\|WP_166311275.1\|5784345_5785431_+\|glycosyltransferase	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	5.11258e-31
NZ_CP049910.1\|WP_166311279.1\|5790169_5791177_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.77545e-163
NZ_CP049910.1\|WP_166311286.1\|5796839_5797307_+\|GyrI-like-domain-containing-protein	gnl\|CDD\|214874	smart00871, AraC_E_bind, Bacterial transcription activator, effector binding domain. This domain is found in the probable effector binding domain of a number of different bacterial transcription activators.and is also present in some DNA gyrase inhibitors. The absence of a HTH motif in the DNA gyrase inhibitors is thought to indicate the fact that these do not bind DNA.	2.49884e-12
NZ_CP049910.1\|WP_166311285.1\|5795636_5796677_+\|SDR-family-oxidoreductase	gnl\|CDD\|235713	PRK06139, PRK06139, SDR family oxidoreductase.	1.07927e-114
NZ_CP049910.1\|WP_166311274.1\|5783560_5784130_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	6.45799e-28
NZ_CP049910.1\|WP_166311271.1\|5781051_5781657_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	8.08431e-11
NZ_CP049910.1\|WP_166311278.1\|5788046_5790134_-\|acetate--CoA-ligase-family-protein	gnl\|CDD\|223972	COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion].	2.01981e-114
NZ_CP049910.1\|WP_166311280.1\|5791231_5791633_-\|OB-fold-domain-containing-protein	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	5.28396e-14
NZ_CP049910.1\|WP_166311281.1\|5791629_5792784_-\|thiolase-family-protein	gnl\|CDD\|238425	cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism. The N-terminal presequence in the SCP-x isoform represents a peroxisomal 3-ketacyl-Coa thiolase specific for branched-chain acyl CoAs, which is proteolytically cleaved from the sterol carrier protein.	1.6925e-105
NZ_CP049910.1\|WP_166311268.1\|5777931_5778819_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	6.68288e-76
NZ_CP049910.1\|WP_166311269.1\|5778855_5780307_-\|aldehyde-dehydrogenase	gnl\|CDD\|143432	cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like. Uncharacterized aldehyde dehydrogenase from Candidatus pelagibacter (DhaS) and other related sequences are present in this CD.	0
NZ_CP049910.1\|WP_166311273.1\|5782927_5783476_-\|DUF2939-domain-containing-protein	gnl\|CDD\|378575	pfam11159, DUF2939, Protein of unknown function (DUF2939). This bacterial family of proteins has no known function.	9.84671e-24
NZ_CP049910.1\|WP_166311283.1\|5794020_5794698_+\|hypothetical-protein	gnl\|CDD\|374318	pfam16036, Chalcone_3, Chalcone isomerase-like. Chalcone_3 is a family of largely bacterial members.	5.93581e-40
NZ_CP049910.1\|WP_166311282.1\|5792819_5793671_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	1.73016e-46
NZ_CP049910.1\|WP_166312275.1\|5781674_5782520_+\|DTW-domain-containing-protein	gnl\|CDD\|225690	COG3148, COG3148, Uncharacterized conserved protein [Function unknown].	6.95301e-85
NZ_CP049910.1\|WP_166311270.1\|5780536_5780923_+\|VOC-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.35622e-46

>NZ_CP049910.1|WP_166311275.1|5784345_5785431_+|glycosyltransferase
MPASPKPTLCLNMIVKNEAHVIKRCLASARPWIDRWVIVDTGSSDGTPQVIRDFMAGVPGELHERPWKNFAHNRNEALQLARAAADYLLFIDADEQLQMPTDFQWPTLEADGYFLTCHMAGTEYQRNALIATRRDWHWEGVLHEYLTAPNAQPWQQLPGPVIYVSHDGARAKDPNTYLKDIALLEDALKADPGNTRNVFYLAQSYRDAQRLPQSLERYRQRADMGGWEEERWFAQFQVAKLLERTGAAPEVVREAYLTTYVARPQRAEPLCELARFCRERKEYALGALFALQASQMAMPTDILFVDASVYRWRALDELAVNAFYTPHQSQGREALKQLLAQRLYPESERVRIEGNQQFYRL
>NZ_CP049910.1|WP_166311274.1|5783560_5784130_-|ferritin-like-domain-containing-protein
MNRNSTMNNTKASKKEKLQLDPKRLNAAKRSLDKGAVLPDFGPYREDIIRLLNDSLATELVCILRYKRHHFTATGLESPAIAGEFLVHANEEQAHADRIAARIVQLGGEPDFNPDSLTKRSHADYNDQLDLHEMIRANLIAERVAIEAYTQMVALIGDKDHTTRRLIEQILEQEQEHADELSDWMKKAS
>NZ_CP049910.1|WP_166311273.1|5782927_5783476_-|DUF2939-domain-containing-protein
MKSSKNVVIAAVTAVALAIAVLLYASPYIAMHSIKKAMDAQDADALAQYVDFPVLRENLKGKMMSSIANRLPKSDDSSNPLGGIGQALGSIVVGAAVDNLVSPAGVMMMMQTGQFGPKVSQSTPAQNEGAASAETKNDAARSFSLTYQGFSKVRVFRKSQPGSAFIFHRDGLMGWKLVNVDT
>NZ_CP049910.1|WP_166311272.1|5782486_5782732_-|hypothetical-protein
MSQAPSPQETIAKRILFIMVNEQGLRAGDGMSPDNLTHDLARHEISQTDQLQAVQFAKEKGWLRDGPYGELQLTETGFALD
>NZ_CP049910.1|WP_166312275.1|5781674_5782520_+|DTW-domain-containing-protein
MLTTGTNETLVEPLSQNTPRPPHAVARLSTARRAISTRPFLARGGSQVVRCEGCRLRLSHCICQIEVEQNTRSGMCLLMHDAEPLKPTNTGWLIADVVADTYAFGWSRTEKNDVLLALLDDPQWQPYVVFPREFVVPPERVVETVAERLEGNAGAGGGAGSGKRPLFILLDATWPQARKMFHKSPYLVRFPVLSLHPEQVSAYRLRRSTRSDHFCTSEVAALCLELAGDRAASSVLAAWLDVFTHHYERARNQLPPLWDGEEHLHLNDCLSQSSAKPVSVS
>NZ_CP049910.1|WP_166311271.1|5781051_5781657_+|class-I-SAM-dependent-methyltransferase
MQSASEQWFDEAYYQRFYFDKKTSVIDVEHSRRLGAFVCSYLAYLRVPVARVLDVGCGIGLWKEAVSQHFPGASYHGVEFSSYLCERYGWEQGSVVDYRSDEPFDLVICQGVLPYLSASDLKLALENLGRLCRGGLYVEAVSREDYERGVIDEDLTDARLYRHRAALYRRGLELNFHELGGGVWVSQRCEVPMFELECKQD
>NZ_CP049910.1|WP_166311270.1|5780536_5780923_+|VOC-family-protein
MFSHIMVGVSDLERSRKFYDALLGALGISPGMANKNRFFWRGSGGTFAVSTPINGEPASIGNGSTFGFAATSEEQANAAHAAGLAAGGVTCEDPPGYRGEGPGRLYLAYLRDPDGNKVCLNYRPPKNA
>NZ_CP049910.1|WP_166311269.1|5778855_5780307_-|aldehyde-dehydrogenase
MKKMWVGGQAVDGEAGIAPLASVNPATGEVNYEVAAAGAKAADAAVRIADEAVRDKKWRNMLPPARAAILSKIADGMERRSEELARLQMIENGKVWRECQVQVKSAAATFRYYAGVCETTGSEVTPARGDYLSMSVYEPYGVIAAITPWNSPMTMEAQKVAPALAAGNAVILKPSEITPSTGLLLAEIAQEAGLPAGILNVLPGTGQQVGAALVEHPRVRLVSFTGGTESGRRIAETAARKLMPVALELGGKSPHIVFDDAPIDSAVAALAGGIFEGSGQSCVAGSRAFVQRKVYDEVVAKLSAVARSLRVDLPDAAGAEMGPLATFAHRDKVAGMVDAARAAGAEILAGGTRPDGKQLYKGAYYLPTLIGGIDNHAAIAQQEIFGPVLCMIPFDDEDDLITQANNSCFGLASGVWTRDYQRAWRVARALEAGTVWINTYKQLSIATPFGGFKDSGIGREKGVSGMRLYQQPKGIYFGMGQLG
>NZ_CP049910.1|WP_166311268.1|5777931_5778819_-|NAD(P)-dependent-oxidoreductase
MSNPQHIGFIGLGVMGEPICRNLARKSGAPVLAFDLSKEPLERLAADQVKAAATPAEVMQQCEVVFLSLPSGEVVAKLCHEANGLLANARAGQIVIDLSTSAVNTTRELSKAFDAKGAHLVDAPVARTRAAAEAGTLAVFVGATPKLFEQVQPLIATFASDIALCGPVGCGQVLKILNNMMLFENVVALSEAKNIGERAGVDPKVLFETLTQGSADSFALRNHGMKAVLPGEFPERAFSVKYAQKDLHYALQLADETGVDARGARIVDEWFNQAIAEGAGEKYHPVISTFMTKKS
>NZ_CP049910.1|WP_166311267.1|5777062_5777785_-|hypothetical-protein
MESPAPFFLQKLLRQTLQAQRLKCHVTDSGRSVTLPNGLRLEPFLMACEEAPEGRVHSTTVVEASHPSLFPNPLFEYQHSNGSSQRDALSKGFASWASMDLVTLIDACQTTPQSCSALEIAYGSSAGGEVYRRQVLLGPMEHYQQHAPRWSEDHEFCPCCLFTNSMQAFSRLLQSHDILGVRLYASRDPDGQCEADCRVNGHDFAAAVPLLCAYANLWPEAGMEYRKQYVVIRNTPRLLE
>NZ_CP049910.1|WP_166311277.1|5786667_5787273_-|hypothetical-protein
MNTGSLALVKNAVINAGGVVNGGSGLLEVNARWSNSGTYIAGTSTLRFANACSVGSIQVTGSTNFGNLVIDSGSGTLHIVLPPNTVQTVSGNLTFSGTAKDIYIDGGPCSGIQLAAGSTVTGQDANVHLSSGVWIASSPPTGCPGSNGGTSGPAPVPATDALGLALLSSLLVALGGGSLRTRGRQTRSNASQRPPNEAREN
>NZ_CP049910.1|WP_166311278.1|5788046_5790134_-|acetate--CoA-ligase-family-protein
MDLLESALNPRSVAVIGASENIHKIGGRPILYMQRHGYQGKIYPINPGREEIQGHKSYAALSALPEVPDLALIVVGGDKTVAAVEECAARGVKSAVIIASGFGETGEAGKEIEQHMLAKARASGMRLYGPNTQGLANFGTGAIAGFSTMFIEVPPQDGPVAVVSQSGGMSSMIYGLLRGHGIGVRHVHATGNEADVTVGEMALAVAHDPDVKLLLLYLESISKPEILAQAAEYARSRDLPIVAVKAGRTAGGQRAASSHTGSLANEDRTVDAFFKQHGIWRVRDPHEQARAAQAYLKGWRPEGKRLVVISNSGASCVMGADAADDEKLPMAELAKSTQDALAAKLPGFATTQNPIDITAALLSNSGLFGDVLPQVAKDPAADLFFINIPVAGAGYDVERFARDAAAFEKAAGKPVAVSAWQDSVASAFRAHGIATFPNEGDAISVLAQVANHTALMRRPRVQAPPAFTVELPSGNDQFLNEAQSLELLGKHGVPVVPMQLCQTADDARRAFERISGGGSRVVMKACSRDIPHKSEHGLVALNVASADEASTLFDRFWNKMDALKAARDGVIVAAMHKGRHEFMVGAHIDPVFGPVVVVGDGGKYTEALNDCIVLMPPFSAAEVQAALRTLRIAPLFDGVRGESPMDIASLSELAVAVGHFAVSARGQIASLDLNPVLVGSTGEGAMVVDALVERS
>NZ_CP049910.1|WP_166311279.1|5790169_5791177_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKETNMTHHTRNTRRHTLAIACAALCGMAAPFAATAADYPNKPIKLVVPYPPGGPTDIVARVVAQKLQEQMGQSVIVDNKPGAGANLGAEQVARSAPDGYTLMVATTAHAINPSLFSKLNYSMTKDLAPVSQLTSGPLVIVATPSLPANNVKELIALAKAKNGGLNFASSGNGQSTHLSAELFNAMAGTKMNHIPYKGSAPALTDVMSGQADLMFDTMLSSMPFVKGGKLKAIAVTSSQRSPIAPDIPTVAEAGLPGYEAIAWNGIQAPAGTPKDIIDKLNAELRKALENPEVKQRFEAQGFSSAWNTPANYGQFIQAEVDKWAKVVKASGAKVD
>NZ_CP049910.1|WP_166311280.1|5791231_5791633_-|OB-fold-domain-containing-protein
MTAMTHTPTHTLPPSLATHFTEGLQAHVVRYQCCDTCGHAQTLARYACQRCGSEQLGWHDASGLATVRARTVVSRAPSDEFRALAPYTLVIVELDEGLRLMGHADADVQIDERVQADFFEHQGRTLLRFCRQA
>NZ_CP049910.1|WP_166311281.1|5791629_5792784_-|thiolase-family-protein
MPSSPQAFLRGASGTAFGRHEGRSALDLMAEAASGAIQSAHLERAQIDGVLCGYATTQPHLMLSTLFCERFALTPNYAHSMQLGGATGAAMLMAARELVRSGRCRNVLVVAGENRLSGQSRDSSIQTLAQVGDADYEVPNGASVPAYYALMASEYMHRTGVTSADLAEFAVLMRHNAIGHPGAQLRTPINVQDVLASKAIASPLSLMDCCPISDGAMALVVSADPHPQAAIAMRGAGQAHRHQHLTAMEDVMRCGASDAASSAFDEAGMEIADVDYLGIYDSFTITLVMLLEELGFAPRAGAATRLRHGDFARDGALPLNTHGGLLSYGHCGVAGGMAHVVEAWRQMSGQAGDRQLPRTPSRAFIHADGGVMSSHVSLILTREG
>NZ_CP049910.1|WP_166311282.1|5792819_5793671_-|IclR-family-transcriptional-regulator
MAATDRNPPRTKSIVTRNSGTSVSSVERAMRVLRVMSEGANARLTDIATAADLDKATALRLLEMMVRDGFVMRDAATKQFTLGPELMVLGAAALRRFDPRPIVRPSLMRLVGQFEDSAVLSLPSGIESLCIDVEEGTYPIRANYLRVGSRRPLGVGAGSLALLAWLPDAEREAAIDILLGQLQRYPLITAGLLRERIAEARTKGYAVLLDVVVERMGGIGVPILDSQGRPIAAISIAALNDRILSREAAMGQSLMHEAMQCQVRWTEATRPAGRTAHRVGASK
>NZ_CP049910.1|WP_166311283.1|5794020_5794698_+|hypothetical-protein
MRKFGRHITGLLIAGGMLAVASLPAAARTESGAASPAEMKQVSIAPQMTVNTPFAEKVQVGGRVVQLNGSGTRFKAVFQVYRAALYTEKPIQQYGDLGGGNESKRIHLVMLREVNANELGGMFIRGIQENIDKASAARLMPAMLRMSALFNDYKKLEAGDSVTLDWVPGKGSVVSVRGVPATEAIPEAQFYHALAGIWLGATPADWKLRDALLGVKATTDTAIRN
>NZ_CP049910.1|WP_166311284.1|5794930_5795542_+|DUF1439-domain-containing-protein
MKFGIGLPHASYSPQRRVLLGAAVSLGLLAAGCASSPSAMAQPSYTISAGQIQEAMGQKFPRSYGFGGLMNLALSNPQIHLRPDRNRLNTVIAVAATGPLLQARSYLGMLDVDFSLRYEASDRTLRATDLHLNGLRMEGLNAQMEQMLQQYGSTLAQRSLQEVVLHQLTDKDLAMVNGLGLEPGKFTVTPKGLLVTLQNKAVP
>NZ_CP049910.1|WP_166311285.1|5795636_5796677_+|SDR-family-oxidoreductase
MSLQARRDSSSRTSSSSTSPLSSSATQQRPLVVVIVGASSGIGHATAVAFANRGAKLVLAARSADTLSHVVTECLAAGGSALGIPTDVTDAVAVQKLANRAVSHFGRIDVWVNAAGVGAVGRFDGVPLEANRRVIESNLLGHMHGAHVAMQHFRETGRGLLVNLNSMGGWVGTPFEAAYSASKFGVRGLSESLRAEVADLPNVHICDVAPTRVDTPGLANGANYTGHRLRSVMPVLDPRRVGLAIVALAYSSHPKPVTWLGAAALPSRVANAVSPHLFGRARRWFGERNLEHGLPTPLSDGNLYEPTADAFIDGGIRTARAEAATAAIVLGTVGLALGWWIGSRSR
>NZ_CP049910.1|WP_166311286.1|5796839_5797307_+|GyrI-like-domain-containing-protein
MIEPPQITDLARHHVTAIIHVRCTREEIQLVMGRGVRELLDAVQAQGAKPVAALYTHHLSRPTDRFDFEIGVPVNRPVEATGRVLPGVWPSMRVARTVHCGRYEDLPQSWGQFKQWIETQGLCITSELWECYVTGPERGSDARLWRTELIQPLQL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP049910_2	2.2\|5786209\|29\|NZ_CP049910\|PILER-CR	5786209-5786237	29	NZ_CP050315	Shewanella aestuarii strain PN3F2 plasmid pPN3F2_2, complete sequence	204752-204780	7	0.759

1. spacer 2.2|5786209|29|NZ_CP049910|PILER-CR matches to NZ_CP050315 (Shewanella aestuarii strain PN3F2 plasmid pPN3F2_2, complete sequence) position: , mismatch: 7, identity: 0.759

ctcccgtggtgcccgttcctgagtcaccg	CRISPR spacer
ttggtgtgccgcccgttcctgagtcacct	Protospacer
.*  .*** .******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

898 : 14042

Burkholderia_virus(25.0%)

integrase

attL 2866:2879|attR 24447:24460

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166299514.1\|898_1591_-	helix-turn-helix transcriptional regulator	A4JWN8	Burkholderia_virus	3.1e-06	42.0
WP_166299516.1\|1717_1918_+	hypothetical protein	NA	NA	NA	NA
WP_166299518.1\|2225_2516_+	hypothetical protein	NA	NA	NA	NA
WP_166311784.1\|2561_2987_+	ogr/Delta-like zinc finger family protein	A4JWR6	Burkholderia_virus	1.6e-13	55.4
2866:2879	attL	NA	NA	NA	NA
WP_166299520.1\|3098_3638_+	replication endonuclease	NA	NA	NA	NA
WP_166299522.1\|3634_3814_+	hypothetical protein	NA	NA	NA	NA
WP_166299524.1\|3810_4248_+	hypothetical protein	NA	NA	NA	NA
WP_166311785.1\|4322_6404_+	replication endonuclease	R4JJS4	Burkholderia_phage	2.4e-62	35.8
WP_166311786.1\|6490_6712_+	hypothetical protein	NA	NA	NA	NA
WP_166299526.1\|6756_6969_+	hypothetical protein	NA	NA	NA	NA
WP_166299528.1\|6972_7269_+	DUF4406 domain-containing protein	A0A2K8I958	Pseudomonas_phage	4.2e-21	55.7
WP_166299530.1\|7278_7422_+	hypothetical protein	NA	NA	NA	NA
WP_166299532.1\|7808_8492_+	Rha family transcriptional regulator	W8CYS3	Bacillus_phage	1.1e-16	43.6
WP_166299534.1\|8521_9109_-	hypothetical protein	NA	NA	NA	NA
WP_166299536.1\|9105_10530_-	AAA family ATPase	A0A2I7RNF1	Vibrio_phage	3.7e-38	28.0
WP_166299538.1\|10578_11808_-\|integrase	tyrosine-type recombinase/integrase	A0A077KET4	Ralstonia_phage	1.6e-90	47.6
WP_166299540.1\|12119_14042_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	1.7e-17	27.4
24447:24460	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2921290 : 3019122

105

Ralstonia_phage(13.51%)

transposase,capsid,head,plate,terminase,tail,integrase

attL 2939104:2939119|attR 2969425:2969440

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166306052.1\|2921290_2922496_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	2.4e-83	46.3
WP_166306055.1\|2922590_2923613_+	hypothetical protein	NA	NA	NA	NA
WP_166306058.1\|2924016_2924277_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_166306061.1\|2924266_2925817_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_166306064.1\|2926137_2927124_+	inovirus Gp2 family protein	NA	NA	NA	NA
WP_166306067.1\|2927278_2927677_-	thioredoxin family protein	NA	NA	NA	NA
WP_166306070.1\|2927696_2929073_-	hypothetical protein	NA	NA	NA	NA
WP_166306073.1\|2929084_2930095_-	hypothetical protein	NA	NA	NA	NA
WP_166306076.1\|2930106_2931276_-	hypothetical protein	NA	NA	NA	NA
WP_166306079.1\|2931298_2931688_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_166306082.1\|2931690_2932767_-	hypothetical protein	NA	NA	NA	NA
WP_166306085.1\|2932763_2933873_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_166312055.1\|2933884_2934343_-	hypothetical protein	NA	NA	NA	NA
WP_166306088.1\|2934425_2936717_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.0e-50	28.6
WP_166306091.1\|2936796_2937834_-	AP2 domain-containing protein	NA	NA	NA	NA
WP_166306094.1\|2937896_2938490_-	hypothetical protein	NA	NA	NA	NA
WP_166306097.1\|2938789_2939110_-	hypothetical protein	NA	NA	NA	NA
WP_166306100.1\|2939049_2939892_-\|terminase	terminase small subunit	I6NV32	Burkholderia_virus	3.0e-32	39.2
2939104:2939119	attL	NA	NA	NA	NA
WP_166306102.1\|2939984_2941259_-	hypothetical protein	NA	NA	NA	NA
WP_166306105.1\|2941550_2941808_-\|transposase	transposase	A0A1B1P773	Bacillus_phage	3.9e-07	43.9
WP_166306108.1\|2941834_2942353_-\|transposase	transposase	NA	NA	NA	NA
WP_166306111.1\|2942484_2942754_-	hypothetical protein	NA	NA	NA	NA
WP_166306114.1\|2942766_2943783_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_166306117.1\|2943797_2944127_-	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_166306120.1\|2944308_2945808_-	PAS domain S-box protein	NA	NA	NA	NA
WP_166306123.1\|2946028_2947363_+	acetamidase	NA	NA	NA	NA
WP_166306126.1\|2947407_2948610_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_166306129.1\|2948624_2948972_+	hypothetical protein	NA	NA	NA	NA
WP_166306132.1\|2949039_2949525_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_166312056.1\|2949762_2950812_+	porin	NA	NA	NA	NA
WP_166306135.1\|2950830_2952246_+	purine-cytosine permease-like transporter	NA	NA	NA	NA
WP_166306138.1\|2952533_2953172_-	response regulator transcription factor	NA	NA	NA	NA
WP_166306141.1\|2953547_2954813_+	hypothetical protein	NA	NA	NA	NA
WP_166306144.1\|2954802_2955342_+	flavin reductase family protein	NA	NA	NA	NA
WP_166306147.1\|2955338_2956163_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_166306150.1\|2956267_2957200_+	catechol 1,2-dioxygenase	NA	NA	NA	NA
WP_166306153.1\|2957480_2959394_-	hypothetical protein	NA	NA	NA	NA
WP_166306156.1\|2960254_2960593_-	hypothetical protein	NA	NA	NA	NA
WP_166299538.1\|2961294_2962524_+\|integrase	tyrosine-type recombinase/integrase	A0A077KET4	Ralstonia_phage	1.6e-90	47.6
WP_166299536.1\|2962572_2963997_+	AAA family ATPase	A0A2I7RNF1	Vibrio_phage	3.7e-38	28.0
WP_166299534.1\|2963993_2964581_+	hypothetical protein	NA	NA	NA	NA
WP_166306159.1\|2964645_2965293_-	Rha family transcriptional regulator	W8CYS3	Bacillus_phage	1.0e-16	43.6
WP_166306162.1\|2965620_2965824_-	hypothetical protein	NA	NA	NA	NA
WP_166299528.1\|2965833_2966130_-	DUF4406 domain-containing protein	A0A2K8I958	Pseudomonas_phage	4.2e-21	55.7
WP_166299526.1\|2966133_2966346_-	hypothetical protein	NA	NA	NA	NA
WP_166311786.1\|2966390_2966612_-	hypothetical protein	NA	NA	NA	NA
WP_166311785.1\|2966698_2968780_-	replication endonuclease	R4JJS4	Burkholderia_phage	2.4e-62	35.8
WP_166299524.1\|2968854_2969292_-	hypothetical protein	NA	NA	NA	NA
WP_166299522.1\|2969288_2969468_-	hypothetical protein	NA	NA	NA	NA
2969425:2969440	attR	NA	NA	NA	NA
WP_166306165.1\|2969464_2970064_-	replication endonuclease	NA	NA	NA	NA
WP_166311784.1\|2970114_2970540_-	ogr/Delta-like zinc finger family protein	A4JWR6	Burkholderia_virus	1.6e-13	55.4
WP_166299518.1\|2970585_2970876_-	hypothetical protein	NA	NA	NA	NA
WP_166299516.1\|2971182_2971383_-	hypothetical protein	NA	NA	NA	NA
WP_166299514.1\|2971509_2972202_+	helix-turn-helix transcriptional regulator	A4JWN8	Burkholderia_virus	3.1e-06	42.0
WP_166299512.1\|2972248_2972731_+	hypothetical protein	NA	NA	NA	NA
WP_166306168.1\|2972994_2973558_+	hypothetical protein	NA	NA	NA	NA
WP_166306171.1\|2973625_2973931_-	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	4.6e-07	40.0
WP_166306174.1\|2973905_2974184_-	BrnT family toxin	NA	NA	NA	NA
WP_166306177.1\|2974242_2975352_-	phage late control D family protein	E5FFG3	Burkholderia_phage	7.2e-82	47.4
WP_166306180.1\|2975348_2975813_-\|tail	phage tail protein	A0A2H4JG54	uncultured_Caudovirales_phage	1.3e-32	50.0
WP_166306183.1\|2975828_2978384_-\|tail	phage tail tape measure protein	V5YUN9	Pseudomonas_phage	7.7e-71	40.0
WP_166306188.1\|2978414_2978639_-	hypothetical protein	NA	NA	NA	NA
WP_166306191.1\|2978669_2978798_-\|tail	GpE family phage tail protein	A0A2H4JFK5	uncultured_Caudovirales_phage	5.2e-05	55.3
WP_166306194.1\|2978806_2979187_-\|tail	phage tail assembly protein	A4PE51	Ralstonia_virus	8.3e-14	50.0
WP_166306197.1\|2979310_2979823_-\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	8.8e-35	45.6
WP_166306200.1\|2979858_2981055_-\|tail	phage tail protein	E5FFG9	Burkholderia_phage	1.3e-126	58.6
WP_166306203.1\|2981078_2981822_-	hypothetical protein	NA	NA	NA	NA
WP_166306206.1\|2982794_2983517_-	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_166306209.1\|2983537_2984479_-\|tail	tail fiber domain-containing protein	I6W7C9	Vibriophage	3.2e-14	49.5
WP_166306212.1\|2984489_2985521_-	virulence-associated protein	NA	NA	NA	NA
WP_166306215.1\|2985510_2987655_-	DUF4815 domain-containing protein	K4ICQ5	Acidithiobacillus_phage	1.3e-103	34.3
WP_166306218.1\|2987665_2988154_-	hypothetical protein	K4I002	Acidithiobacillus_phage	1.6e-14	36.5
WP_166306221.1\|2988159_2989113_-\|tail	phage tail protein	NA	NA	NA	NA
WP_166312057.1\|2989109_2989868_-\|plate	baseplate J protein	K4HZB7	Acidithiobacillus_phage	2.2e-21	33.2
WP_166312058.1\|2989960_2990314_-	hypothetical protein	V9IQW0	Stenotrophomonas_phage	1.5e-22	55.6
WP_166306224.1\|2990313_2990988_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	1.2e-15	32.5
WP_166306227.1\|2991062_2991536_-	phage virion morphogenesis protein	E5FFH6	Burkholderia_phage	2.3e-29	43.6
WP_166306230.1\|2991547_2992075_-\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	1.4e-22	35.7
WP_166306233.1\|2992040_2992604_-	hypothetical protein	NA	NA	NA	NA
WP_166306236.1\|2992629_2992896_-	hypothetical protein	NA	NA	NA	NA
WP_166306239.1\|2992892_2993432_-	lysozyme	A0A0U1UNS2	Pseudomonas_phage	6.2e-55	60.4
WP_166306242.1\|2993431_2993638_-	hypothetical protein	NA	NA	NA	NA
WP_166306245.1\|2993642_2993870_-\|tail	phage tail protein	NA	NA	NA	NA
WP_166306248.1\|2993866_2994364_-\|head	head completion/stabilization protein	E5G6M8	Salmonella_phage	7.8e-12	32.3
WP_166306251.1\|2994491_2995190_-\|terminase	terminase	A0A077K804	Ralstonia_phage	8.6e-33	37.9
WP_166306254.1\|2995270_2996299_-\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	1.1e-105	58.5
WP_166306257.1\|2996375_2997209_-\|capsid	GPO family capsid scaffolding protein	A4JWU8	Burkholderia_virus	3.3e-47	43.7
WP_166306260.1\|2997351_2999253_+\|terminase	terminase	A4JWU9	Burkholderia_virus	9.4e-207	61.6
WP_166306263.1\|3000996_3001260_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_166306266.1\|3001670_3002360_-	hypothetical protein	NA	NA	NA	NA
WP_166306269.1\|3003633_3004647_-	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	2.0e-46	36.4
WP_166306272.1\|3004824_3005820_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	3.1e-60	42.0
WP_166312059.1\|3005837_3006218_-	hypothetical protein	NA	NA	NA	NA
WP_129324623.1\|3006518_3007484_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	9.2e-134	74.8
WP_166306275.1\|3008362_3008794_-	hypothetical protein	NA	NA	NA	NA
WP_166306278.1\|3009737_3010199_-	universal stress protein	NA	NA	NA	NA
WP_166306281.1\|3010438_3011854_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_099737556.1\|3012048_3013146_-	NAD(P)-dependent alcohol dehydrogenase	NA	NA	NA	NA
WP_166306284.1\|3013292_3014528_-	MgtC/SapB family protein	NA	NA	NA	NA
WP_166306287.1\|3015641_3016109_-	hypothetical protein	NA	NA	NA	NA
WP_082585479.1\|3016226_3016451_-	hypothetical protein	NA	NA	NA	NA
WP_056265797.1\|3016450_3016735_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_056265800.1\|3016749_3017124_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_056265803.1\|3017166_3017604_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_166311894.1\|3017592_3019122_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-113	46.6

DBSCAN-SWA_3

4137553 : 4144935

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166308823.1\|4137553_4138048_-	phage virion morphogenesis protein	G8GWE3	Rhodobacter_phage	1.0e-16	30.6
WP_166308826.1\|4138047_4138749_-	hypothetical protein	J9STS2	Pseudomonas_phage	2.2e-81	63.3
WP_166308829.1\|4138741_4140328_-	DUF935 domain-containing protein	J9SVY0	Pseudomonas_phage	1.3e-174	60.4
WP_166308832.1\|4140337_4141993_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	4.8e-114	46.4
WP_166312150.1\|4141989_4142538_-	DUF3486 family protein	J9SH37	Pseudomonas_phage	1.6e-26	48.2
WP_166308835.1\|4142539_4142833_-	ArsR family transcriptional regulator	J9SNG3	Pseudomonas_phage	5.8e-23	58.2
WP_166308838.1\|4142829_4143132_-	DUF2730 family protein	NA	NA	NA	NA
WP_166308841.1\|4143128_4143368_-	TraR/DksA family transcriptional regulator	Q9ZXI6	Pseudomonas_virus	1.8e-06	41.1
WP_166308844.1\|4143473_4143887_-	hypothetical protein	X4Y6P1	Pseudomonas_phage	2.5e-08	38.9
WP_166312151.1\|4143883_4144438_-	transglycosylase SLT domain-containing protein	Q6QIC7	Burkholderia_phage	1.0e-36	49.7
WP_166312152.1\|4144584_4144935_-	hypothetical protein	Q6QIC8	Burkholderia_phage	1.9e-25	57.8

DBSCAN-SWA_4

4153703 : 4161565

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166308888.1\|4153703_4154621_+	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	8.2e-108	65.4
WP_166308891.1\|4154617_4155085_+	hypothetical protein	NA	NA	NA	NA
WP_166312153.1\|4155367_4155607_+	hypothetical protein	NA	NA	NA	NA
WP_166308894.1\|4155611_4156058_+	regulatory protein GemA	R9U1B6	Rhizobium_phage	4.0e-07	30.8
WP_166308897.1\|4156082_4156511_+	hypothetical protein	NA	NA	NA	NA
WP_166308900.1\|4156600_4157752_+	hypothetical protein	J9SH47	Pseudomonas_phage	4.2e-69	46.3
WP_166308903.1\|4157774_4158197_+	hypothetical protein	A0A1B0T6E4	Thiobacimonas_phage	1.5e-11	37.3
WP_166308906.1\|4158237_4159149_+	hypothetical protein	J9SVY7	Pseudomonas_phage	2.0e-74	46.9
WP_166308909.1\|4159263_4159776_+	DUF1320 domain-containing protein	J9SNI4	Pseudomonas_phage	1.4e-40	52.3
WP_166308912.1\|4159780_4160263_+	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	2.7e-25	44.7
WP_166308915.1\|4160249_4160576_+	hypothetical protein	NA	NA	NA	NA
WP_166308918.1\|4160568_4161051_+	hypothetical protein	NA	NA	NA	NA
WP_166308921.1\|4161058_4161565_+	hypothetical protein	A0A218M342	Acidovorax_phage	2.2e-54	70.6

DBSCAN-SWA_5

4763778 : 4803958

uncultured_virus(33.33%)

integrase,transposase,tRNA

attL 4766852:4766870|attR 4796431:4796449

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003049965.1\|4763778_4766694_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
WP_166310043.1\|4766842_4768018_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	5.6e-85	43.2
4766852:4766870	attL	NA	NA	NA	NA
WP_166312206.1\|4767938_4768463_+\|transposase	transposase	NA	NA	NA	NA
WP_005303904.1\|4768982_4769597_-	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	2.8e-35	49.0
WP_166310045.1\|4769657_4770875_-	TniQ family protein	NA	NA	NA	NA
WP_166310047.1\|4770871_4771780_-	AAA family ATPase	NA	NA	NA	NA
WP_013741669.1\|4771782_4773501_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_092701352.1\|4774485_4776171_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_092701349.1\|4776869_4777364_-	peptide methionine sulfoxide reductase	NA	NA	NA	NA
WP_137749173.1\|4777699_4778068_-	DUF427 domain-containing protein	NA	NA	NA	NA
WP_137749172.1\|4778133_4778406_-	glutaredoxin 3	A0A1X7BZ88	Faustovirus	4.7e-11	44.1
WP_137749171.1\|4778986_4779394_-	RidA family protein	NA	NA	NA	NA
WP_137749170.1\|4779565_4780018_-	hypothetical protein	NA	NA	NA	NA
WP_137749169.1\|4780103_4780676_-	hypothetical protein	NA	NA	NA	NA
WP_137749168.1\|4780770_4781739_-	magnesium and cobalt transport protein CorA	NA	NA	NA	NA
WP_092701358.1\|4781735_4782440_-	glutathione S-transferase	NA	NA	NA	NA
WP_092701346.1\|4782565_4783081_-	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_092701343.1\|4783080_4783524_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_092701340.1\|4784066_4785023_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_092701337.1\|4785049_4785553_-	OsmC family protein	NA	NA	NA	NA
WP_166310049.1\|4786399_4787401_+	glutathione synthase	NA	NA	NA	NA
WP_092701334.1\|4787522_4788530_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_092701331.1\|4788529_4788868_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_166310051.1\|4789261_4790800_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_166310053.1\|4790878_4791169_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_166310055.1\|4791171_4792116_-	DnaJ domain-containing protein	A0A1V0SF83	Hokovirus	9.0e-09	48.5
WP_092701323.1\|4793229_4793877_+	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_082585479.1\|4793997_4794222_-	hypothetical protein	NA	NA	NA	NA
WP_056265797.1\|4794221_4794506_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_056265800.1\|4794520_4794895_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_056265803.1\|4794937_4795375_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_166311894.1\|4795363_4796893_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-113	46.6
4796431:4796449	attR	NA	NA	NA	NA
WP_056265807.1\|4796974_4797307_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_056265811.1\|4797303_4797654_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_166310057.1\|4797890_4798112_+	hypothetical protein	NA	NA	NA	NA
WP_166312207.1\|4798168_4799437_-	ergothioneine biosynthesis protein EgtB	NA	NA	NA	NA
WP_166312208.1\|4799667_4800669_-	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_166310059.1\|4800991_4803958_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.4

DBSCAN-SWA_6

4810885 : 4846425

uncultured_virus(40.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166310073.1\|4810885_4812024_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.6e-74	53.8
WP_166310075.1\|4812192_4812858_-	AhpC/TSA family protein	NA	NA	NA	NA
WP_166310077.1\|4813030_4813942_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_166310079.1\|4814237_4814495_-	hypothetical protein	NA	NA	NA	NA
WP_166310081.1\|4814846_4815464_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_166310083.1\|4815649_4816546_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_166310085.1\|4818580_4819603_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_082759168.1\|4820033_4820582_+\|transposase	transposase	NA	NA	NA	NA
WP_166301587.1\|4820578_4820911_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_066787318.1\|4820976_4822491_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.5e-119	46.6
WP_166310087.1\|4823098_4824145_+	sulfurtransferase	NA	NA	NA	NA
WP_166310090.1\|4824488_4824962_+	redoxin domain-containing protein	NA	NA	NA	NA
WP_092701355.1\|4825463_4826732_+	MFS transporter	NA	NA	NA	NA
WP_166310092.1\|4826974_4827736_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_066787318.1\|4827857_4829372_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.5e-119	46.6
WP_166301587.1\|4829437_4829770_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_082759168.1\|4829766_4830315_-\|transposase	transposase	NA	NA	NA	NA
WP_139285414.1\|4830755_4830869_+	hypothetical protein	NA	NA	NA	NA
WP_092701399.1\|4831044_4832277_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_092701396.1\|4832558_4834415_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	2.5e-156	50.0
WP_092701393.1\|4834377_4835325_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_092701391.1\|4835321_4835735_-	VOC family protein	NA	NA	NA	NA
WP_092701388.1\|4836047_4836836_-	hypothetical protein	NA	NA	NA	NA
WP_092701385.1\|4836835_4837444_-	sulfite oxidase-like oxidoreductase	NA	NA	NA	NA
WP_092701382.1\|4838259_4838886_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_092701379.1\|4838800_4839265_+	thiol-disulfide isomerase	NA	NA	NA	NA
WP_092701376.1\|4839368_4840835_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.6e-52	33.7
WP_092701406.1\|4841259_4841856_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_166310094.1\|4841852_4843250_+	mercuric reductase	NA	NA	NA	NA
WP_166310096.1\|4843509_4846425_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

5574495 : 5624935

Ralstonia_phage(33.33%)

integrase,transposase

attL 5587388:5587402|attR 5620525:5620539

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166311138.1\|5574495_5575668_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_166311139.1\|5575689_5577120_+	hypothetical protein	NA	NA	NA	NA
WP_166311140.1\|5577217_5577427_-	hypothetical protein	NA	NA	NA	NA
WP_166311141.1\|5577489_5579565_-	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	4.1e-22	26.3
WP_166311142.1\|5579639_5580464_-	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	1.8e-45	38.1
WP_166311143.1\|5581034_5581823_+	hypothetical protein	NA	NA	NA	NA
WP_166301875.1\|5582050_5583284_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	4.5e-117	74.4
WP_129324623.1\|5583580_5584546_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	9.2e-134	74.8
WP_088166943.1\|5584669_5587120_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.0e-85	35.6
5587388:5587402	attL	NA	NA	NA	NA
WP_043387573.1\|5587471_5588398_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_003078546.1\|5588402_5588789_-	copper homeostasis periplasmic binding protein CopC	NA	NA	NA	NA
WP_029158334.1\|5588899_5589655_-	copper resistance protein B	NA	NA	NA	NA
WP_166311144.1\|5589896_5591840_-	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_166311145.1\|5592205_5592889_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	6.7e-30	34.7
WP_166311146.1\|5592889_5594293_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_166311147.1\|5594333_5594618_-	cation transporter	NA	NA	NA	NA
WP_003052298.1\|5594914_5595259_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_129324623.1\|5595664_5596630_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	9.2e-134	74.8
WP_166311148.1\|5598534_5599254_+	hypothetical protein	NA	NA	NA	NA
WP_166311149.1\|5599250_5600321_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_166311150.1\|5600326_5601241_+	hypothetical protein	NA	NA	NA	NA
WP_166311151.1\|5601237_5601870_+	hypothetical protein	NA	NA	NA	NA
WP_166311152.1\|5601880_5603836_+	large ATP-binding protein	NA	NA	NA	NA
WP_166311153.1\|5603835_5605953_+	hypothetical protein	NA	NA	NA	NA
WP_166311154.1\|5605968_5606682_+	TIGR02391 family protein	NA	NA	NA	NA
WP_166311155.1\|5606846_5608577_+	AAA family ATPase	NA	NA	NA	NA
WP_166311156.1\|5608563_5609982_+	UvrD-helicase domain-containing protein	NA	NA	NA	NA
WP_166312262.1\|5610057_5611503_+	hypothetical protein	NA	NA	NA	NA
WP_166311157.1\|5611637_5612837_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A221SAN4	Ralstonia_phage	1.0e-33	29.9
WP_166311158.1\|5616864_5621748_+	AAA family ATPase	NA	NA	NA	NA
5620525:5620539	attR	NA	NA	NA	NA
WP_166311159.1\|5621744_5622590_+	hypothetical protein	NA	NA	NA	NA
WP_056265811.1\|5622644_5622995_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_056265807.1\|5622991_5623324_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_166311894.1\|5623405_5624935_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.3e-113	46.6

DBSCAN-SWA_8

6424521 : 6476892

Pseudomonas_phage(18.18%)

portal,capsid,tRNA,head,plate,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166311756.1\|6424521_6426591_-\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_166311757.1\|6426671_6427895_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_166312329.1\|6427919_6428495_-	restriction endonuclease	NA	NA	NA	NA
WP_166311758.1\|6428625_6429717_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_166311759.1\|6429812_6432104_+	FdhF/YdeP family oxidoreductase	NA	NA	NA	NA
WP_166312330.1\|6432211_6432415_+	hypothetical protein	NA	NA	NA	NA
WP_166311760.1\|6432424_6433360_-	bile acid:sodium symporter family protein	NA	NA	NA	NA
WP_166311761.1\|6433632_6434772_-	hypothetical protein	NA	NA	NA	NA
WP_166311762.1\|6434982_6436035_-\|tRNA	tRNA 2-selenouridine(34) synthase MnmH	NA	NA	NA	NA
WP_166311763.1\|6436181_6437267_+	selenide, water dikinase SelD	NA	NA	NA	NA
WP_166311764.1\|6437335_6437821_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_166311765.1\|6438366_6439635_-	Zn-dependent hydrolase	NA	NA	NA	NA
WP_166312331.1\|6439674_6441144_-	dihydropyrimidinase	NA	NA	NA	NA
WP_166311766.1\|6441447_6442938_-	NCS1 family nucleobase:cation symporter-1	NA	NA	NA	NA
WP_166311767.1\|6443101_6444421_-	NAD-dependent dihydropyrimidine dehydrogenase subunit PreA	NA	NA	NA	NA
WP_166311768.1\|6444467_6445823_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_166312332.1\|6446299_6446977_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_166299510.1\|6447189_6447360_-	hypothetical protein	NA	NA	NA	NA
WP_166311769.1\|6447456_6447612_+	hypothetical protein	NA	NA	NA	NA
WP_166311770.1\|6447675_6448503_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_166311771.1\|6448541_6449198_-	LysE family translocator	NA	NA	NA	NA
WP_166311772.1\|6450210_6451287_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	2.0e-105	56.1
WP_166306260.1\|6451290_6453192_-\|terminase	terminase	A4JWU9	Burkholderia_virus	9.4e-207	61.6
WP_166306257.1\|6453334_6454168_+\|capsid	GPO family capsid scaffolding protein	A4JWU8	Burkholderia_virus	3.3e-47	43.7
WP_166306254.1\|6454244_6455273_+\|capsid	phage major capsid protein, P2 family	Q9ZXM3	Pseudomonas_virus	1.1e-105	58.5
WP_166306251.1\|6455353_6456052_+\|terminase	terminase	A0A077K804	Ralstonia_phage	8.6e-33	37.9
WP_166306248.1\|6456179_6456677_+\|head	head completion/stabilization protein	E5G6M8	Salmonella_phage	7.8e-12	32.3
WP_166306242.1\|6456904_6457111_+	hypothetical protein	NA	NA	NA	NA
WP_166306239.1\|6457110_6457650_+	lysozyme	A0A0U1UNS2	Pseudomonas_phage	6.2e-55	60.4
WP_166306236.1\|6457646_6457913_+	hypothetical protein	NA	NA	NA	NA
WP_166311773.1\|6457938_6458454_+	hypothetical protein	NA	NA	NA	NA
WP_166306230.1\|6458466_6458994_+\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	1.4e-22	35.7
WP_166306227.1\|6459005_6459479_+	phage virion morphogenesis protein	E5FFH6	Burkholderia_phage	2.3e-29	43.6
WP_166306224.1\|6459553_6460228_+\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	1.2e-15	32.5
WP_166312058.1\|6460227_6460581_+	hypothetical protein	V9IQW0	Stenotrophomonas_phage	1.5e-22	55.6
WP_166312057.1\|6460673_6461432_+\|plate	baseplate J protein	K4HZB7	Acidithiobacillus_phage	2.2e-21	33.2
WP_166306221.1\|6461428_6462382_+\|tail	phage tail protein	NA	NA	NA	NA
WP_166311774.1\|6462885_6463371_+	DUF4815 domain-containing protein	K4ICQ5	Acidithiobacillus_phage	1.1e-13	44.6
WP_166311775.1\|6463289_6465029_+	DUF4815 domain-containing protein	A0A1B2LRP5	Wolbachia_phage	3.7e-69	32.2
WP_166306212.1\|6465018_6466050_+	virulence-associated protein	NA	NA	NA	NA
WP_166306209.1\|6466060_6467002_+\|tail	tail fiber domain-containing protein	I6W7C9	Vibriophage	3.2e-14	49.5
WP_166311776.1\|6466998_6467274_+	hypothetical protein	NA	NA	NA	NA
WP_166311777.1\|6467282_6467744_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_166306203.1\|6468716_6469460_+	hypothetical protein	NA	NA	NA	NA
WP_166306200.1\|6469483_6470680_+\|tail	phage tail protein	E5FFG9	Burkholderia_phage	1.3e-126	58.6
WP_166306197.1\|6470715_6471228_+\|tail	phage major tail tube protein	V9IQX1	Stenotrophomonas_phage	8.8e-35	45.6
WP_166306191.1\|6471739_6471868_+\|tail	GpE family phage tail protein	A0A2H4JFK5	uncultured_Caudovirales_phage	5.2e-05	55.3
WP_166306188.1\|6471898_6472123_+	hypothetical protein	NA	NA	NA	NA
WP_166311778.1\|6472153_6473059_+\|tail	phage tail tape measure protein	V5YUN9	Pseudomonas_phage	1.7e-09	30.9
WP_166311779.1\|6473084_6473228_+\|tail	phage tail tape measure protein	V5YUN9	Pseudomonas_phage	4.3e-08	67.4
WP_166311780.1\|6473224_6474406_+\|tail	phage tail tape measure protein	V5YUN9	Pseudomonas_phage	1.3e-28	45.0
WP_166311781.1\|6474398_6474578_-	hypothetical protein	NA	NA	NA	NA
WP_166311782.1\|6476589_6476892_+	BrnA antitoxin family protein	K4NZP3	Burkholderia_phage	5.0e-06	38.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP049911

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP049910

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection