CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP050080	Rhizobium leguminosarum bv. trifolii strain 31B chromosome, complete genome	2 crisprs	DEDDh,csa3,cas3,WYL	3	7
NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	0 crisprs	WYL,csa3	0	0
NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	0 crisprs	WYL,csa3,DEDDh	0	54
NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	0 crisprs	RT	0	2
NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	0 crisprs	NA	0	62

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050080_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050080_1

1244633-1244716

Orphan

Consensus_repeat	Method
GCAATTCCGGACGCAAAACCGCTACACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050080_1

>merge|NZ_CP050080|1|1244633-1244716|CRISPRCasFinder
GCAATTCCGGACGCAAAACCGCTACACAGTTTCGCAGGAATTGCTCTTGTTACTGCGCAATTCCGGACGCAAAAACCGCTACAC

>NZ_CP050080|1|1|1244633-1244716|CRISPRCasFinder
GCAATTCCGGACGCAAAACCGCTACACA	GTTTCGCAGGAATTGCTCTTGTTACTGC
GCAATTCCGGACGCAAAAACCGCTACAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050080.1\|WP_018073505.1\|1247536_1249207_-\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
NZ_CP050080.1\|WP_130664545.1\|1245712_1246924_-\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181001
NZ_CP050080.1\|WP_130762243.1\|1237201_1237939_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_018484762.1\|1242606_1243356_+\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|280792
NZ_CP050080.1\|WP_130762242.1\|1237957_1239451_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235870
NZ_CP050080.1\|WP_018073504.1\|1249215_1249530_-\|DUF2849-domain-containing-protein	unknown	unknown	gnl\|CDD\|371340
NZ_CP050080.1\|WP_024321921.1\|1241748_1241943_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_130664546.1\|1244782_1245745_+\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP050080.1\|WP_130762239.1\|1251875_1252721_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
NZ_CP050080.1\|WP_024321920.1\|1242069_1242270_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_011651867.1\|1254047_1255373_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP050080.1\|WP_130762241.1\|1243620_1244556_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293806
NZ_CP050080.1\|WP_130762240.1\|1251237_1251825_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP050080.1\|WP_130655338.1\|1240120_1240348_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_018073536.1\|1239804_1239975_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235485
NZ_CP050080.1\|WP_026171009.1\|1249532_1250969_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|381169
NZ_CP050080.1\|WP_165422730.1\|1241284_1241659_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_018484770.1\|1240477_1240993_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_130681595.1\|1252891_1253821_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP050080.1\|WP_018073506.1\|1247013_1247526_-\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|226272

Protein	Function_ID	Function_description	E-value
NZ_CP050080.1\|WP_018073505.1\|1247536_1249207_-\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
NZ_CP050080.1\|WP_130664545.1\|1245712_1246924_-\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181001	PRK07494, PRK07494, UbiH/UbiF family hydroxylase.	0
NZ_CP050080.1\|WP_018484762.1\|1242606_1243356_+\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|280792	pfam02683, DsbD, Cytochrome C biogenesis protein transmembrane region. This family consists of the transmembrane (i.e. non-catalytic) region of Cytochrome C biogenesis proteins also known as disulphide interchange proteins. These proteins posses a protein disulphide isomerase like domain that is not found within the aligned region of this family.	3.4192e-47
NZ_CP050080.1\|WP_130762242.1\|1237957_1239451_-\|hypothetical-protein	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	0
NZ_CP050080.1\|WP_130681595.1\|1252891_1253821_-\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	3.39708e-28
NZ_CP050080.1\|WP_018073504.1\|1249215_1249530_-\|DUF2849-domain-containing-protein	gnl\|CDD\|371340	pfam11011, DUF2849, Protein of unknown function (DUF2849). This bacterial family of proteins has no known function.	5.0328e-30
NZ_CP050080.1\|WP_130664546.1\|1244782_1245745_+\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	8.77891e-56
NZ_CP050080.1\|WP_130762239.1\|1251875_1252721_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	1.22328e-150
NZ_CP050080.1\|WP_026171009.1\|1249532_1250969_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|381169	cd11642, SUMT, Uroporphyrin-III C-methyltransferase (also known as S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT). SUMT is an enzyme of the cobalamin and siroheme biosynthetic pathway. It catalyzes the first of three steps leading to the formation of siroheme from uroporphyrinogen III; it transfers two methyl groups from S-adenosyl-L-methionine to the C-2 and C-7 atoms of uroporphyrinogen III to yield precorrin-2 via the intermediate formation of precorrin-1. Precorrin-2 is also a precursor for the biosynthesis of vitamin B12, coenzyme F430, siroheme and heme d1. This family includes proteins in which the SUMT domain is fused to other functional domains, such as to a uroporphyrinogen-III synthase domain to form bifunctional uroporphyrinogen-III methylase/uroporphyrinogen-III synthase, or to a dual function dehydrogenase-chelatase domain, as in the case of the multifunctional S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase/dehydrogenase/ferrochelatase CysG, which catalyzes all three steps that transform uroporphyrinogen III into siroheme.	2.17414e-108
NZ_CP050080.1\|WP_130762241.1\|1243620_1244556_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293806	cd07720, OPHC2-like_MBL-fold, Pseudomonas pseudoalcaligenes organophosphorus hydrolase C2, and related proteins; MBL-fold metallo hydrolase domain. Pseudomonas pseudoalcaligenes OPHC2 is a thermostable organophosphorus hydrolase which a broad substrate activity spectrum: it hydrolyzes various phosphotriesters, esters, and a lactone. This subgroup also includes Pseudomonas oleovorans PoOPH which exhibits high lactonase and esterase activities, and latent PTE activity. However, double mutations His250Ile/Ile263Trp switch PoOPH into an efficient and thermostable PTE. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.12343e-86
NZ_CP050080.1\|WP_130762240.1\|1251237_1251825_+\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	1.6001e-36
NZ_CP050080.1\|WP_018073536.1\|1239804_1239975_-\|hypothetical-protein	gnl\|CDD\|235485	PRK05471, PRK05471, CDP-diacylglycerol pyrophosphatase; Provisional.	0.002036
NZ_CP050080.1\|WP_011651867.1\|1254047_1255373_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	6.6962e-174
NZ_CP050080.1\|WP_018073506.1\|1247013_1247526_-\|DUF934-domain-containing-protein	gnl\|CDD\|226272	COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown].	2.61397e-63

>NZ_CP050080.1|WP_130762241.1|1243620_1244556_+|MBL-fold-metallo-hydrolase
MNLETKMSLENTAHTGRPRLDELVPSRYAVQVGEIEVLVVSDGVLPLPTAMLGHNIDPAVRAAWLKDMFLPADAFDWALNVVVVRSGDQTILLDAGLGIDPDLHLPRAGQLIKRLEAAGIDLASVTDVVLTHMHMDHIGGLLVDGVKDQLRPDLRIHVAAAEVKFWEAPDFSRVSMPPGFPDALRATAKRFAKEYRSYFRLFDDEYEVAPGVVVHRTGGHTPGHSVIRVASGGDRLMFAGDAVFAVGFEHPDWYNGFEHDPEEAVRVRLRLLRELADTGEQLVATHLPFPSVGRVAADGDAFRWVAAFWDY
>NZ_CP050080.1|WP_018484762.1|1242606_1243356_+|cytochrome-c-biogenesis-protein-CcdA
MSIADISLWSALIAGALSFLSPCVLPLVPPYLCYMAGISVEQFRGGGAIAVAPGVRRGVFFSALFFTLGFATVFVALGAGASSIGMALRQHLDLLSKIGGLIIIVMGLNFLGLFRIGLLTREARFQDGGKPGTLTGAYVMGLAFAFGWTPCIGPVLGAILGVAASRETVGSGAGLLAIYSLGLAIPFWIAAGFSGAFMRFLSRFRRHLGTVEKVMGLFLVLTGLAFLFGWVSNVAIWFQQTFPILMQIG
>NZ_CP050080.1|WP_024321920.1|1242069_1242270_+|hypothetical-protein
MIRSQIADAQTALSDEEVTLCQRVFDHISSVRQITTDTEREDLARRVIHSYQHGVKDEGALLRLLI
>NZ_CP050080.1|WP_024321921.1|1241748_1241943_+|hypothetical-protein
MALDVFVNLYNLGGLDALNVSLRSLSDDERLGALLSLEKIGYEVIWNAQRKPASAYVWSGPNEN
>NZ_CP050080.1|WP_165422730.1|1241284_1241659_+|hypothetical-protein
MWQQAAREMLAGRRRQQKPGFHRVFAQALPSLATAPVIDVAFNTILFDAIPLLDLALRLLPVSFDPIPIHGRFLLLLMRRKRTAVEVGSCVSADFREAQFQRQRHKALPMSNIHTLMNKTINNS
>NZ_CP050080.1|WP_018484770.1|1240477_1240993_-|hypothetical-protein
MRSFLTLIAATSVGLSAMAAYGQNPVPKASDVLVKYGEVENWTVYTNQTRGDCLIVRDYGASSVQMGVTADQQVGYLGVFSKADIGLQNGTKSEVFVSIGGHLYGGVATSTHGELKGGYSGGYILTDSPEFKRDLAKKYEMIVFPETKGTFVVDLKGTYKAMAMGRKCLKH
>NZ_CP050080.1|WP_130655338.1|1240120_1240348_+|hypothetical-protein
MWAILIGAALIIGGLLFLFTSVLGRRPSDPHQMPQGGTTLEPRRQGLRFLGISKNWPALAVIALGALLLAFGGYS
>NZ_CP050080.1|WP_018073536.1|1239804_1239975_-|hypothetical-protein
MDETPKTAIRGMIFYVLALLVLGVLAGAVYTIYGHPADPSEQPAAETIPQKAPAPQ
>NZ_CP050080.1|WP_130762242.1|1237957_1239451_-|hypothetical-protein
MREHAVVVAGAGPTGLMLAGELALAGVDVAIVERRPDQELAGTRAGGLSARTLEILDQRGIVDRFLAAGQVAQVTGFAVTRLDISDFPTRHNYGLALRQKHIERILAGWVNELAVPIYRSLEVTGFAQDDTGVTIELSDGASLRAGYLVGCDGGRSLVRKVAGIAFEGWDPTTGNILAEVEMEEEPPLGIHRTALGIYAFGREEYEIHEGKIVFAKEGPIGVMVPEKNAGATTEPTLGEIREALIAAFETDYGIHRVNWISRFSDMSRQATAYRKGRVFLAGDAAHVHSPVGGQGLNTGVQDAVNLGWKLAQVVKGTSPEALLDTYHAERHPVAARVLRMTMAQVALQRTDDRTEALRDIVTELLGMEEPRKRIAAEMSGLAIHYEFGDWHPLLGRRMPDLDLVTSDGPVRVFTLLQDARPVLLNLGASGSVDIPRWSDRIRLVDGRYDGPWELPALGAVSAPAAVLIRPDGYVAWVGNGTQDGLQEAVNSWFGPPG
>NZ_CP050080.1|WP_130762243.1|1237201_1237939_+|hypothetical-protein
MDRLVGADEATQSEKQAEKADRREGLARDVTAIKIGDCLLGYKAVQRRMRASRWNHFRGRMREIERLIRHRHGDIVPEADDALIYVEVIAGLALVEFKEEFVEVVLGWSARWLPWAEKADIEDVIYERTKVRFSDLSADALGHALHLSYAERSALDIRTIGAFDVPKRKRAQLQKEKRRQRDRSRKEEQRRAAGALSRADYLANSFSQARPWEAFGISRRTWERRGKPMPDPETISDCGSISLAA
>NZ_CP050080.1|WP_130664546.1|1244782_1245745_+|AEC-family-transporter
MADIVSLLLPFFGLILIGYIAAKATKQPAEALGWLNTFIIYAALPALFFKLVSRTPIEELTRVDFIVTDIAATYAVFILLFVIGRVVRGNSLADCTIQSFAGAYGNIGYMGPGLALLALGEGAAVPVALIICFENALHFIMAPALMAAAGDDKRSARRLIADIVRKVALHPFILSMALGFAVAALHFDPPLAFQRLVDYLAQAAAPCALFAMGVTLALRPLKRIPAEISYIVPAKLILHPIAVFIALTAVGGFEPVWIQAAVLLASLPTATNVFVIGQQYGVWRERASATILITTVFSVVTVSLWLIVIRSGLLPLQLFP
>NZ_CP050080.1|WP_130664545.1|1245712_1246924_-|UbiH/UbiF-family-hydroxylase
MKRFEVAVIGGGLAGMIAAIALARGGRSVALVAPLAPKEDRRTTALMDQSIRFLDRLALWEKLRPAAAPLTSMRIVDGTDRLLRAPTTTFRAAEVGLDAFGYNFPNKALTGILEEAAAGEGNITRFTDMAESIDISAEAVSIRLAGGEMLSADFAVGADGRGSKLRETSGIAVRNWSYPQSAMVLNFAHSLPHQNISTEFHTKHGPFTQVPLPGSRSSLVWVQDPAEAASRMELPLADLGALVEARMQSMLGKVDVEEGVQVWPLSGMMAHRFGRGRIALIGEAAHVFPPIGAQGLNLSLRDIMALADILCDRAELPVPADAGESFDRRRRADIMTRTASVDLLNRSLLSDFLPVQMLRAAGLHILSAIPPLRNIVMREGIEPGRGFRDIPDALREKLKRKKA
>NZ_CP050080.1|WP_018073506.1|1247013_1247526_-|DUF934-domain-containing-protein
MTKIWRETGFVENDPWVIETDEVKATEEQKPLLGLDELIARADESNDIGLGVLIKPADDVRRLEPYLDRLEIVAVAFPAFNDGRAFSHASLLRQRLGYTNELRAVGDVLIDQVPLMLRVGIDSFAVTNATALKRLAENRLPAIPHHYQPAARDAEAGKGYSWRRQAKPAA
>NZ_CP050080.1|WP_018073505.1|1247536_1249207_-|nitrite/sulfite-reductase
MYRYDEFDHAFVTERVEQFRDQVQRRLSGELAEDAFKPLRLMNGVYLQLHAYMLRIAIPYGTLSSRQLRMLAHIARTYDRGYGHFTTRQNLQFNWPKLSDIPDALADLASVEMHALQTSGNCIRNVTADHFAGAAADEIADPRPYAEILRQWSSVHPEFSFLPRKFKIAVTGAERDRAAIQVHDIGLHVKKNDKGEIGFAVYVGGGQGRTPMIAKLIRDFLPEEDLLSYTTAIVRVYNLHGRRDNKYKARIKILVHETGTEELTRQVEAEFAALKDTELKLPEKDVQSIAAYFAPPELPERAEGWENLARWKKADSGFSRWVQQNVQPHKNPDYGMVTISLKPIGGIPGDASDAQMDAIADLAEEYAFDEIRVSHEQNLILPHVALADLEAVYRGLVAINLAEANAGLITDIIACPGLDYCALANARSIPLAQEISRRFGDAERQAEIGELKIKISGCINACGHHHVGHIGLLGVEKKGAELYQITLGGSGDEHTSIGEIIGRGFEPDRVTDAIETIVDTYLGLRLDHSENFLAAYRRVGPQPFKTALYGSAAEAA
>NZ_CP050080.1|WP_018073504.1|1249215_1249530_-|DUF2849-domain-containing-protein
MGDKVLTANRLTDGIAVWLDANGKWSTALQEALVARHAEAVAALEAIGKKSYADNEVVDVAVVDVQETNGILWPLRLRERIRAQGPTMEYAPGYAPADPEFIAV
>NZ_CP050080.1|WP_026171009.1|1249532_1250969_-|uroporphyrinogen-III-C-methyltransferase
MPPKTEQLSVFPAFFRVEGQKTAVFGNGDEAFAKVRLLLNTKARIIAYADRPEADYHAFLIANRIETVRAAFSAEQVEGSALVFAATGNEADDRSIVDAARAARIPANAVDQPDYCDFFTPALVNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGRLAGLATSYRKAVEQLIPRGVSRRVFWRRFFSGAVADAVANGNLPQARHAADRLLHAMDKVAGHVWLVGAGPGAEDLLTLRAQRVMMEADVIVYDALVPQAIVDMGRRDAERLSVGKRKGCHSKSQEEINDLLVDLGRQGKRVVRLKSGDPLVYGRAGEEMAALRAAGITYEVVPGITSAFAAAADFELPLTLRGVASSLVFTTGHDLTGDVLPDWASLAVSGATIAVYMGRTVAASVAERLMQAGIPSETTVAVIENASRADRRLLHGTLADLPDLQHRDELTGPVMVIIGDAVAGANFELSEPLVRANARLEELARS
>NZ_CP050080.1|WP_130762240.1|1251237_1251825_+|nucleoside-deaminase
MPDKTIASRLLQVMEDDILPLTERGVSLGNKVFGAAILRKSDLSLVVAETNNELENPLWHGEVHTLKRFYELGDKPPTKDLIFLSTHEPCTMCMSAITWAGFDNFYYFFSHEDSRDAFAIPHDLKILKEVFGLEPGGYRRQNAFWNSFAIADLVETEEAPLKTALQTQTARIKARYDALSTSYQSSKNANDIPLN
>NZ_CP050080.1|WP_130762239.1|1251875_1252721_+|nucleoside-triphosphate-pyrophosphohydrolase
MEPSKDISRLIEIMAALRHPETGCPWDIVQSFETIKPYTIEEAYEVSDAIERSDMDDLCDELGDLLLQVVFHARMAEEAGEFSFGDVVNAITAKMIRRHPHVFARSAADTPDAVKRQWDEIKQAEKRERAERRSRRGITEDFNSGFLGSVQRSFPALTEALKLQERAAKVGFDWSAPEPILDKIEEEIGELRVALREGDQAKVSDELGDLIFAVVNIGRHVKADPEQAVRGTNTKFRRRFSHIEQVLEAEGETLEAASLERMEEIWQAAKAIERAIVVGAE
>NZ_CP050080.1|WP_130681595.1|1252891_1253821_-|IS110-family-transposase
MEIVVGIDVSKERLDVAILPQEEVFAVGNDHAGIDELAERLKGIGVDAIALEATGGFEMLAVAGLSAAGLTVLVVNPAQVRAYAHAIGRRAKTDPIDAAVIAAFVLATKPEIRPLRDAETQALSELVARRRQIVQMVVAEENRLRMALAKQAQKSIKRLLKALRRELESLDADLDSHIRKSPVWRVREALLTSVPGVGATTARTLLAELPELGSLDRRQIASLAGLAPWTRQSGKWKGKSFIGGGRGKVRAVLFMAALVASRYNPDLKAFRDRLVAAGKPKIVATVATMRKLLTILNAIIRDGRPWQNA
>NZ_CP050080.1|WP_011651867.1|1254047_1255373_-|GTPase-HflX
MRATVVVPVLKSRSRGGQSESASTRTPESRLEEATGLAQAIDLDVVNGSIVPVNDPRPATLLGTGKIEEIKALLDERDSGLVIVDHPLTPVQQRNLEKEWNAKVIDRTGLILEIFGRRASTKEGTLQVDLAHLNYQKGRLVRSWTHLERQRGGGGFMGGPGETQIEADRRMLQDRIIKLERELEQVVRTRQLHRAKRRKVPHPIVALVGYTNAGKSTLFNRITGAGVLAEDMLFATLDPTLRRMKLPHGRTVILSDTVGFISDLPTHLVAAFRATLEEVLEADLILHVRDMSDADNQAQSSDVMRILNDLGIDEAEAEKRLIEVWNKIDRLEPEVHDAMVQKSAGASNVVAVSAVSGEGVDTLMEEISRRLSGVMTVATIRLPVDKLALLPWLYDHAIVDGREDNEDGTITLDLRLSETEATELERRIGNGPKSSKEDWER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050080_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050080_2

2417576-2417748

Orphan

Consensus_repeat	Method
ACGGTCGGCACCGGCGGCTC	CRT

3 spacers

csa3

The CRISPR arrays of NZ_CP050080_2

>merge|NZ_CP050080|2|2417576-2417748|CRT
ACGGTCGGCACCGGCGGCTCTTCGGCCGGCGGCGGCAAATCGAGCAGCACCGTCGGCACCGGCGGCTCCGCTGCGGGCTCTGGGTCGGGTTCAGGTTCTGCTTCGACGCTTGGCACCGGCGGTTCGTCGGCCGGCGGCGGCACCTCTAGCAGTTCGGTCGGCACCGGCGGCTC

>NZ_CP050080|2|1|2417576-2417748|CRT
ACGGTCGGCACCGGCGGCTC	TTCGGCCGGCGGCGGCAAATCGAGCAGC
ACCGTCGGCACCGGCGGCTC	CGCTGCGGGCTCTGGGTCGGGTTCAGGTTCTGCTTCG
ACGCTTGGCACCGGCGGTTC	GTCGGCCGGCGGCGGCACCTCTAGCAGT
TCGGTCGGCACCGGCGGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050080.1\|WP_024323043.1\|2419032_2420865_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP050080.1\|WP_130681161.1\|2414489_2414819_-\|NIPSNAP-family-protein	unknown	unknown	gnl\|CDD\|311781
NZ_CP050080.1\|WP_130664184.1\|2412292_2412658_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP050080.1\|WP_130762108.1\|2427398_2430311_+\|sensor-domain-containing-phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP050080.1\|WP_075224701.1\|2410578_2411670_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|224115
NZ_CP050080.1\|WP_024323045.1\|2417992_2418343_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_130664183.1\|2412825_2413965_-\|site-specific-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223931
NZ_CP050080.1\|WP_003557162.1\|2416292_2416502_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_018069134.1\|2421098_2421788_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319828
NZ_CP050080.1\|WP_017963152.1\|2425459_2426758_+\|insulinase-family-protein	unknown	unknown	gnl\|CDD\|223685
NZ_CP050080.1\|WP_130762111.1\|2411672_2412287_+\|HAD-family-phosphatase	unknown	unknown	gnl\|CDD\|319790
NZ_CP050080.1\|WP_024323040.1\|2424031_2425456_+\|threonine-synthase	unknown	unknown	gnl\|CDD\|236418
NZ_CP050080.1\|WP_024323047.1\|2416591_2416978_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_032989572.1\|2423119_2423764_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273447
NZ_CP050080.1\|WP_024323044.1\|2418352_2418796_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_130691478.1\|2415622_2416075_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050080.1\|WP_024323042.1\|2421853_2422570_-\|PDZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|238487
NZ_CP050080.1\|WP_130762110.1\|2414890_2415577_+\|helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|378968
NZ_CP050080.1\|WP_024323039.1\|2426787_2427402_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP050080.1\|WP_130681163.1\|2414142_2414493_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209

Protein	Function_ID	Function_description	E-value
NZ_CP050080.1\|WP_024323040.1\|2424031_2425456_+\|threonine-synthase	gnl\|CDD\|236418	PRK09225, PRK09225, threonine synthase; Validated.	0
NZ_CP050080.1\|WP_130681161.1\|2414489_2414819_-\|NIPSNAP-family-protein	gnl\|CDD\|311781	pfam07978, NIPSNAP, NIPSNAP. Members of this family include many hypothetical proteins. It also includes members of the NIPSNAP family which have putative roles in vesicular transport. This domain is often found in duplicate.	1.4717e-27
NZ_CP050080.1\|WP_130664184.1\|2412292_2412658_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.91012e-09
NZ_CP050080.1\|WP_130762108.1\|2427398_2430311_+\|sensor-domain-containing-phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	2.89588e-96
NZ_CP050080.1\|WP_024323043.1\|2419032_2420865_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	4.11499e-63
NZ_CP050080.1\|WP_075224701.1\|2410578_2411670_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|224115	COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair].	4.10794e-152
NZ_CP050080.1\|WP_130664183.1\|2412825_2413965_-\|site-specific-DNA-methyltransferase	gnl\|CDD\|223931	COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair].	3.08431e-89
NZ_CP050080.1\|WP_018069134.1\|2421098_2421788_+\|HAD-family-hydrolase	gnl\|CDD\|319828	cd07526, HAD_BPGM_like, subfamily of beta-phosphoglucomutase-like family, similar to Escherichia coli 6-phosphogluconate phosphatase YieH. This subfamily includes Escherichia coli YieH/HAD3 an 6-phosphogluconate phosphatase, which can hydrolyzed purines and pyrimidines as secondary substrates. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate, and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.83288e-55
NZ_CP050080.1\|WP_130762111.1\|2411672_2412287_+\|HAD-family-phosphatase	gnl\|CDD\|319790	cd02603, HAD_sEH-N_like, N-terminal lipase phosphatase domain of human soluble epoxide hydrolase, Escherichia coli YihX/HAD4 alpha-D-glucose 1-phosphate phosphatase, and related domains, may be inactive. This family includes the N-terminal phosphatase domain of human soluble epoxide hydrolase (sEH). sEH is a bifunctional enzyme with two distinct enzyme activities, the C-terminal domain has epoxide hydrolysis activity and the N-terminal domain (Ntermphos), which belongs to this family, has lipid phosphatase activity. The latter prefers mono-phosphate esters, and lysophosphatidic acids (LPAs) are the best natural substrates found to date. In addition this family includes Gallus gallus sEH and Xenopus sEH which appears to lack phosphatase activity, and Escherichia coli YihX/HAD4 which selectively hydrolyzes alpha-Glucose-1-P, phosphatase, has significant phosphatase activity against pyridoxal phosphate, and has low beta phosphoglucomutase activity. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.2473e-36
NZ_CP050080.1\|WP_017963152.1\|2425459_2426758_+\|insulinase-family-protein	gnl\|CDD\|223685	COG0612, PqqL, Predicted Zn-dependent peptidases [General function prediction only].	8.93916e-133
NZ_CP050080.1\|WP_032989572.1\|2423119_2423764_-\|hypothetical-protein	gnl\|CDD\|273447	TIGR01108, Oxaloacetate_decarboxylase_alpha_chain, oxaloacetate decarboxylase alpha subunit. This model describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea. The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane. [Transport and binding proteins, Cations and iron carrying compounds, Energy metabolism, Other].	0.00549344
NZ_CP050080.1\|WP_024323042.1\|2421853_2422570_-\|PDZ-domain-containing-protein	gnl\|CDD\|238487	cd00987, PDZ_serine_protease, PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.	1.09784e-09
NZ_CP050080.1\|WP_130762110.1\|2414890_2415577_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|378968	pfam12840, HTH_20, Helix-turn-helix domain. This domain represents a DNA-binding Helix-turn-helix domain found in transcriptional regulatory proteins.	4.21387e-13
NZ_CP050080.1\|WP_024323039.1\|2426787_2427402_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	2.23163e-38
NZ_CP050080.1\|WP_130681163.1\|2414142_2414493_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	4.86907e-17

>NZ_CP050080.1|WP_024323047.1|2416591_2416978_-|hypothetical-protein
MDMTSPSGQLSGLSFLVFWVLLAILLFSGLRQSLSAGPKDDDRSSARDRSVGRIARYLLKDDRERRAAGLAVEAKARSYFARRMGKIHLAALAFFAVTTLLLAISNLHEAKMHRASQIQAASPSQQVK
>NZ_CP050080.1|WP_003557162.1|2416292_2416502_-|hypothetical-protein
MRLSAFVRPAAAVVLLFAFTSTDVIAKGKHRSCAQLQAMKDNALTGGKHAGDGTDKRAKIERKMRKKGC
>NZ_CP050080.1|WP_130691478.1|2415622_2416075_-|hypothetical-protein
MDEEEDCMTIEDIIETLEKTDMPDSRIDAFITCAFLLKQLRPAEPNDFDGPNDYLPSSIKSEHGFLMARPFTHDVNHAIDLCREVRPDAVWHLARGRQTPDDSLYGAQLREIKESESVLGEAESNHAALALTLAALRAHVRQEDEKRAGG
>NZ_CP050080.1|WP_130762110.1|2414890_2415577_+|helix-turn-helix-transcriptional-regulator
MKEGPDIAQIGALIGDPARANMLAALTGGRALTATELAGVGGITVQTASTHLAKLEAGGLLTQRKQGRHRYFTLADEAVARLIESMMGFAAGRGHLRHQPGPKEPALRKARICYDHLAGDYGVRMLDNLIASGSIDAVGDGLALTEKGEGDLKRIGIDVGDLRSSRRPLCRSCLDWSERRAHLAGSLGKALLSSFLDKGWARRTAESRSILFSPEGDRQFLKLFPVDP
>NZ_CP050080.1|WP_130681161.1|2414489_2414819_-|NIPSNAP-family-protein
MITCFIRYQIDPFKKEAFAEYARNWGQAIPRNGADLIGYFGPHEGSATTAYGVYNIESLAAYEAYRARLAADPLGRENYEFARREGFILKEDRIFLKNVSAPHAKLVLP
>NZ_CP050080.1|WP_130681163.1|2414142_2414493_-|antibiotic-biosynthesis-monooxygenase
MIAVIFEVVPYMGERHKYLDLAGELRGELEKIDGFISIERFESLTNRGKLLSLSFFRDEAAVKEWRNLESHRAAQQAGRGGIFADYRLRIASVVRDYGMFERDEAPGDSRRVHDAA
>NZ_CP050080.1|WP_130664183.1|2412825_2413965_-|site-specific-DNA-methyltransferase
MASVFPLADLKASVKSDSRPASWVDTIIKGDCVSALEALPSHSVDIIFADPPYNLQLGGTLHRPDQSLVDAVDDEWDQFASFEAYDAFTRAWLLACRRVLKPTGSIWVIGSYHNIFRVGATLQDLNFWILNDIIWRKTNPMPNFKGRRFQNAHETMIWASPSAKAKGYTFNYDALKAANDDVQMRSDWLFPICNGSERLKGEDGKKAHPTQKPEALLARVIMASTKPGDIVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYIDAASARIAAVEPLGKAELTVMTGKKAEVRVAFNVLVESGLIKPGQVLTDAKRRYSAIVRADGTVASGGEAGSIHRLGAKVQGLDACNGWTFWHFEDGQSLRPIDDLRSVIRSDLAKA
>NZ_CP050080.1|WP_130664184.1|2412292_2412658_+|nuclear-transport-factor-2-family-protein
MAFDPAEEIERFHAAINALDFPTIEAYFAEDATYVSNGVGDLTGRAEIMAAFRRYFDDYPDQTAENSLVETLTPLSGRSVWSVRATHSKTGKPLIREGEETITFNAEGRVTRVEVTDYQEF
>NZ_CP050080.1|WP_130762111.1|2411672_2412287_+|HAD-family-phosphatase
MTTDIRHIVFDIGKVLIHYDPHLPFSRLIPDETERNWFFANVCTHDWNIEQDRGRTWAEAEALLIEQHPEREEHIRAFRKYWHEMVPHAYDGSVAIMEGLIAEGRDVTMLTNFASDTFREAQARFPFLTKPRGVTVSGDVGLIKPDIAIYETHTKSFGLDPAATIFIDDAPVNVEGAKAFGWNAVLFSGPEKLRSDLAAHGLKV
>NZ_CP050080.1|WP_075224701.1|2410578_2411670_+|A/G-specific-adenine-glycosylase
MTITTLDTPLAKPLLDWYDRHHRDLPWRVSPGMAARGVKADPYRVWLSEVMLQQTTVQAVKPYFERFLQRWPEVTDLAAAENDAVMAAWAGLGYYARARNLKKCAEAVANEHGGVFPDTEEGLKSLPGIGDYTAAAVAAIAFNRRAAVMDGNVERVISRLYAIATPLPAAKPAMKQKVALLTPETRPGDFAQAMMDLGATICTPKRPACSLCPFRGACEALKLSDPELFPVKAAKKEKPVRYGAAFIAVTGDGEILLRRRIDSGLLGGMTEVPTTAWTARIDGETSAAAAPFEAAWQASGTVIHVFTHFELRLSIWRAAIAAKVGTNDGWWEPVTNLEAQALPTIMKKAIAAAIPLAFKTSKG
>NZ_CP050080.1|WP_024323045.1|2417992_2418343_+|hypothetical-protein
MANFSTIALGASLALIAGQAMSEEIKLDDGTTCTIVQSQSSQGDMSSTVTAGNGHVSSSTTTSGGSSGSSSSSASAGSSAESGGVDSFSTASITRPDGTVITKRSDGTCSITKPKK
>NZ_CP050080.1|WP_024323044.1|2418352_2418796_+|hypothetical-protein
MKHINLIAAASIALLASSPAVLAEECNAAGTVGTGGSASAGGTSASSVGTAGTCRTDGGTTSSIGSGGSAATTDGNAQSKTHINDNGDKLKAQTKAQAVDKGTFSKSRTKTSTDGSTLESTTRTMSHVPGEKPVKNTTKRKIILPEE
>NZ_CP050080.1|WP_024323043.1|2419032_2420865_+|methyl-accepting-chemotaxis-protein
MASIQHKIIIASIAIFGLAGGATGVGIWSASILSANSADVSQSAQILRNHMQADMMHDALRADVLASMLASNPAAGIAADAVKADLVEHEASFREMIDANKALASDDKTKTILAGVERPLLAYMESATKMVDLAGKDPTAALKALPDFMAQFSTLETAMEQTGDQITAASDDISKHSAEIKASVDIVLKALLAAAALFALGLYFLTRKTVTKPILALSNDMQKLAGGDTAIACTGIGRTDEIGTMASAVEIFRQAAIANKQLEQDAEAARLQGETERVTARKQADEDAAERLRAATSGLAAGLKRLASGDLAFQIEEPFAPDFEGLRHDFNMSIRQLDQTLGAIAAAIAAIDEGTREIASGAGDLSKRTEQQAAALEETAAALDQITANVSNSSKRTDEARTEATDANRNAVKSSEVVSHAEEAMRRIEASSQQISSIIGVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAQAAKEIKGHIQKSSVEVESGVKLVLDTSQVLKAISEQIARINQHMDAIAVSAREQSTGLAEVNTAVNSMDHVTQQNAAMVEQSTAASGHLAEEAAKLRELVSRFKLRATASTQSAAGRRSGQLAA
>NZ_CP050080.1|WP_018069134.1|2421098_2421788_+|HAD-family-hydrolase
MDGFELIIFDCDGVLVDSEIIAAEVESALLTEAGYPIGAEEMGERFAGMTWRNILLQIEREASIPLSASLLDKSEHMLDLRLAQDVQAIPGVEFAVSRLPMKRCICSNSSTKRLDMMLTKVGLKPLFAPTIFSAKDLGPDRAKPKPDIFLHGASQMGVSPDKVVVVEDSVHGVHAARAAGMRVIGFTGASHTYPAHADKLTDAGAETAISRMNDLPGVVAALAAWDNVL
>NZ_CP050080.1|WP_024323042.1|2421853_2422570_-|PDZ-domain-containing-protein
MKNSYRAFRALIVVAHIASPFAGVHSAFAATPPAAHAKSGPMISKALDALLLPINKGVIKKFKLDKGAHGVLVLSVKPGGVADKQGIKPGDVLAEVQGHKVHKPIDVDVAVRRQLKAGHSDMSFSVARGGAVIAVAAIITLESYNDTIAVSEISSWETDTTVSSSSYEEYVSVESTEIETSEESEETTVEEDLTQDESADADSSDDADDSSDDNSDDSGDDSSDDSGDDGSDDSGDDG
>NZ_CP050080.1|WP_032989572.1|2423119_2423764_-|hypothetical-protein
MLGKVSRLIVSASFLALLTGCNSLGIGGDSKSSAPPTQSTGTAQIMPLAPANPSSNNPSIGTATTAQGTVAPVVQGACPQIFMRDQDAIFRTYAKGKKDDPQQIVFQASFGDYTRQCTLNDTNLTMTVVAQLRLITGPAGTPGPVTLPIRISVVDGETVLYSEVTKFPTEIPAGAPGTQVIFRKDGITMPVGSGALVRINIGFDTQPAKTKKSS
>NZ_CP050080.1|WP_024323040.1|2424031_2425456_+|threonine-synthase
MTNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPRKWPSFSKKEIRALRGKTYQEIAFTILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQLLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQMTTSSSPNVHALAVEGNFDDCQNLVKAMFNDVAFRDKVRLSGVNSINWARIMAQIVYYFTAAVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARTLKTGRYDMKAVKATSSPSMDIQISSNFERLLFEAYDRDASKVRAAMESLKQSNGFEIGEQALKAIRRDFRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPVAVKSACGIDPALPTWLADLMHREERFQIIKPELKAVETFIGQHARGETTAGAER
>NZ_CP050080.1|WP_017963152.1|2425459_2426758_+|insulinase-family-protein
MTVECTRLKSGLTVVTETMPHLESVALGVWIKSGSRNETDNEHGIAHLLEHMAFKGTARRTARQIAEEIEDVGGEVNAATSTETTSYYARVLKDYVPLAVDILADILTESAFEEEELEREKQVILQEINAANDTPDDVVFDRFSEAAYRDQTLGRAILGTPETVVSFTPQQIRGYLGRNYTTDRMFVVATGAVEHEEFLRMVEDRFASLPTTPSAPPVMEPARYIGGSVREPRDLMDAQILLGFEGKPYHARDFYCSQILANILGGGMSSRLFQEVREFRGLCYSVYAFHWGFSDTGIFGIHAATGGENLPELVPVIIDELHKSADAIHQKEIERARAQIRAQLLMGAESPAARAGQIARQMMLYGRPISNPEMMERLEGITIERLTDLAGRLFYDTVPTLSAIGPLEQLAPMEDITASLSVPASKTLQASR
>NZ_CP050080.1|WP_024323039.1|2426787_2427402_+|GNAT-family-N-acetyltransferase
MPKSVFRFLSRQPEAVELENDRYLLRLPRYQDFNQWHRLRAESRKFLEPWEPTWRRDELTEGAYRARVVRGKQEYASGQAVPLFIFLKDDMTLVGGVTIGYIRRGAAQSCMIGYWMGERHAGQGHMFAALQMVIPYIFTGLELHRIEAACIPDNARSIRLLEKAGFQREGYLRGYLKINGQWHDHVMFSRLATDTDKGRKTDSR
>NZ_CP050080.1|WP_130762108.1|2427398_2430311_+|sensor-domain-containing-phosphodiesterase
MTRDRMLPKSPSGRVIAVIAALFLAAFAFMAGVAQAAEPVKISRDDTALDLTATTEIYANQGEAFQVSTAAGADGIRRRIEVRASSENHQGDWAVFALANVSEEQLERVIVAPHFRLVNSKLFWPDLGSQRISAITPSEGFALDRQPSDEADVFRITLNPGAVITFVAELSTPELPQIYLWEPDAYKDTINAFTLYRGIVLGIAGLLAVFLTILFVVKGTSMLPATAALAWAVLGYICVDFGFLGKLISVASADQRIWRACAEVALASSFVIFLFTYLNLNRWHAHLGYATLAWVLGLALLFGVAIYDPSIAAGIARLSFALTATMGLLLIIYLGFNRYDRAILLVPAWALILVWLFGAWLTVTGRLDNDIIQPALGGGLVLIVLLIGFTVMQHAFAGGAYQQGLFSDLERQSLALTGSGDMVWDWDVARDRVVTIPDVSIKLGLSQGAMHGAARNWLPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRIRAEDGHFHWLLIRARPVLGSNGEIIRCVGTIVDVTEQKNSVERLLHDALHDNLTGLPNRQVFLDRLQSVLALAPGGDTLRPTVMVIDIDRYKLVNDSLGVAAGDNILIALTRRLRRLLKPQDTLARLAGDQFGLILVSEHNPAKVADFADAISKAIMVPINFSNREIILTASVGLASWVDRQESATGLLSDAELAMYRAKRAGGNRVEPFQPAFRDFGTDRLQLETDLRRAIERKELSMVYQPIARLEDVEVAGFEALMRWEHPKRGNIPPSEFIPIAEASDLIGPLGMFALEQATNDLMSWQHQTGELPIFVSINLSSVQLLNNELYDDVRSVLAKTHCNPSRLKLELTESMVMENPEQARLVLQKLKEAGIGLALDDFGTGYSSLAYLTRFPFDMIKLDKALVRDSSDKKATVLKSVIAMARELEMKVVAEGIESNEDAIELAKMGCSYGQSYLFGPPIPSESVLRLLRDRFPLTKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_AP022607	Mycobacterium branderi strain JCM 12687 plasmid pJCM12687	228336-228363	4	0.857
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	NZ_CP015601	Pseudomonas antarctica strain PAMC 27494 plasmid pP27494_1, complete sequence	87747-87774	5	0.821
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	578195-578222	5	0.821
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	424988-425015	5	0.821
NZ_CP050080_1	1.1\|1244661\|28\|NZ_CP050080\|CRISPRCasFinder	1244661-1244688	28	MH779523	Lactococcus phage vB_Llc_bIBBAm4, complete genome	13991-14018	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	405122-405149	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	JN698995	Mycobacterium phage Dori, complete genome	29838-29865	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	CP000876	Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence	27432-27459	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	CP000876	Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence	59965-59992	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	MF377441	Arthrobacter phage Timinator, complete genome	577-604	6	0.786
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	MH825703	Arthrobacter phage LeeroyJ, complete genome	577-604	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	56848-56875	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	56848-56875	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	56848-56875	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	56848-56875	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	56848-56875	6	0.786
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	56848-56875	6	0.786
NZ_CP050080_1	1.1\|1244661\|28\|NZ_CP050080\|CRISPRCasFinder	1244661-1244688	28	MN694137	Marine virus AFVG_250M241, complete genome	28289-28316	7	0.75
NZ_CP050080_1	1.1\|1244661\|28\|NZ_CP050080\|CRISPRCasFinder	1244661-1244688	28	MN692991	Marine virus AFVG_117M48, complete genome	31199-31226	7	0.75
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	MT776811	Arthrobacter phage King2, complete genome	578-605	7	0.75
NZ_CP050080_2	2.1\|2417596\|28\|NZ_CP050080\|CRT	2417596-2417623	28	NZ_CP024308	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence	322127-322154	7	0.75
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	670995-671022	7	0.75
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NC_008759	Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence	146216-146243	7	0.75
NZ_CP050080_2	2.3\|2417701\|28\|NZ_CP050080\|CRT	2417701-2417728	28	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1393833-1393860	7	0.75

1. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_AP022607 (Mycobacterium branderi strain JCM 12687 plasmid pJCM12687) position: , mismatch: 4, identity: 0.857

gtcggccggcggcggcacctctagcagt	CRISPR spacer
gtcggccggcggcggcacccccagcggc	Protospacer
*******************.*.***.*.

2. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to NZ_CP015601 (Pseudomonas antarctica strain PAMC 27494 plasmid pP27494_1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcggccggcggcggcaaatcgagcagc-	CRISPR spacer
atccgccggcggcggcaaatcg-gcgccg	Protospacer
 ** ****************** **. *

3. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcggcaccaccagcaac	Protospacer
 ****************** *.****..

4. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

gtcggccggcggcggcacctctagcagt-	CRISPR spacer
gtcggccgtcggcggcacctc-ggcgttc	Protospacer
******** ************ .**. *

5. spacer 1.1|1244661|28|NZ_CP050080|CRISPRCasFinder matches to MH779523 (Lactococcus phage vB_Llc_bIBBAm4, complete genome) position: , mismatch: 6, identity: 0.786

gtttcgcaggaattgctcttgttactgc	CRISPR spacer
ttaatgcaggaattggtcttgttactgg	Protospacer
 *  .********** ***********

6. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
ttcggccggcggcgtcaaatcggacctg	Protospacer
************** *******..*

7. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to JN698995 (Mycobacterium phage Dori, complete genome) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
cgcggccgtcggcggcaaatcgaccacg	Protospacer
. ****** ************** **

8. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to CP000876 (Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
tgcccacggcggcggcatatcgagcagt	Protospacer
* *   *********** *********.

9. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to CP000876 (Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
tgcccacggcggcggcatatcgagcagt	Protospacer
* *   *********** *********.

10. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to MF377441 (Arthrobacter phage Timinator, complete genome) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
cgcggctggcggcggcaaatcgcgcttc	Protospacer
. ****.*************** **  *

11. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to MH825703 (Arthrobacter phage LeeroyJ, complete genome) position: , mismatch: 6, identity: 0.786

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
cgcggctggcggcggcaaatcgcgcttc	Protospacer
. ****.*************** **  *

12. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

13. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

14. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

15. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

16. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

17. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.786

gtcggccggcggcggcacctctagcagt	CRISPR spacer
ctcggccggcggcgccacctctatccag	Protospacer
 ************* ******** * .

18. spacer 1.1|1244661|28|NZ_CP050080|CRISPRCasFinder matches to MN694137 (Marine virus AFVG_250M241, complete genome) position: , mismatch: 7, identity: 0.75

gtttcgcaggaattgctcttgttactgc	CRISPR spacer
cgactgcaggaagtgctcttgttacagc	Protospacer
   ..******* ************ **

19. spacer 1.1|1244661|28|NZ_CP050080|CRISPRCasFinder matches to MN692991 (Marine virus AFVG_117M48, complete genome) position: , mismatch: 7, identity: 0.75

gtttcgcaggaattgctcttgttactgc	CRISPR spacer
cgactgcaggaagtgctcttgttacagc	Protospacer
   ..******* ************ **

20. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to MT776811 (Arthrobacter phage King2, complete genome) position: , mismatch: 7, identity: 0.75

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
cgcggctggcggcggcaaatcgaaattc	Protospacer
. ****.****************.   *

21. spacer 2.1|2417596|28|NZ_CP050080|CRT matches to NZ_CP024308 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3a, complete sequence) position: , mismatch: 7, identity: 0.75

ttcggccggcggcggcaaatcgagcagc	CRISPR spacer
cgtggccggcggcggcagatcgagggac	Protospacer
. .**************.****** ..*

22. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctctagcagt	CRISPR spacer
cagcgccggcggcgggacctcaagcagc	Protospacer
    *********** ***** *****.

23. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NC_008759 (Polaromonas naphthalenivorans CJ2 plasmid pPNAP03, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctctagcagt	CRISPR spacer
acaggccggcggcggcacttcaagcatg	Protospacer
.. ***************.** ****

24. spacer 2.3|2417701|28|NZ_CP050080|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

gtcggccggcggcggcacctctagcagt	CRISPR spacer
gtcggccagcggcggcacctcggtctcg	Protospacer
*******.************* . *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

392444 : 427160

Rhizobium_phage(26.32%)

protease,head,tRNA,capsid,portal,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130762300.1\|392444_393401_+\|protease	trypsin-like serine protease	A0A1B1IRH0	uncultured_Mediterranean_phage	1.2e-13	33.3
WP_130686593.1\|393438_394461_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_130686591.1\|395793_396006_+	DNA-binding protein	NA	NA	NA	NA
WP_130814695.1\|396100_396493_+	hypothetical protein	NA	NA	NA	NA
WP_166477415.1\|396763_399091_+	DUF3987 domain-containing protein	NA	NA	NA	NA
WP_166477309.1\|399319_399721_+	hypothetical protein	NA	NA	NA	NA
WP_166477416.1\|399720_400884_+	hypothetical protein	NA	NA	NA	NA
WP_166477310.1\|401023_401713_-	hypothetical protein	NA	NA	NA	NA
WP_166477311.1\|402718_403105_+	hypothetical protein	A0A0U2C0X7	Paracoccus_phage	4.3e-10	36.8
WP_166477312.1\|405027_406275_+\|portal	phage portal protein	B0VK31	Azospirillum_phage	3.1e-94	44.0
WP_166477313.1\|406271_407027_+\|head,protease	HK97 family phage prohead protease	A0A2D1GNL2	Pseudomonas_phage	1.2e-24	41.1
WP_166477314.1\|407081_408368_+\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	1.7e-47	33.4
WP_130814686.1\|408424_408811_+	hypothetical protein	A0A142K633	Streptomyces_phage	7.6e-15	46.8
WP_166477315.1\|409043_409613_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	9.5e-06	45.6
WP_166477316.1\|409629_410040_+	hypothetical protein	B4UTP8	Rhizobium_phage	4.0e-30	58.3
WP_166477317.1\|410204_410561_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_166477318.1\|410560_411055_+	HK97 gp10 family phage protein	NA	NA	NA	NA
WP_166477319.1\|411058_411469_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_166477320.1\|411509_411941_+\|tail	phage tail protein	NA	NA	NA	NA
WP_166477321.1\|411964_412324_+	hypothetical protein	NA	NA	NA	NA
WP_130686572.1\|412344_412533_+\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_166477322.1\|412529_413006_-	YbjQ family protein	M4STD1	Rhodobacter_phage	1.4e-23	40.0
WP_166477323.1\|413063_416210_+\|tail	tail length tape measure protein	A0A076G7H2	Sinorhizobium_phage	5.5e-111	42.0
WP_166477324.1\|416206_416557_+	hypothetical protein	NA	NA	NA	NA
WP_166477325.1\|416553_417057_+	DUF1833 family protein	A0A1B0T6D7	Thiobacimonas_phage	6.0e-12	29.8
WP_166477326.1\|417056_417527_+	C40 family peptidase	G8GWF9	Rhodobacter_phage	4.9e-16	36.8
WP_166477327.1\|417441_421083_+	hypothetical protein	G8GWG0	Rhodobacter_phage	1.0e-92	30.2
WP_166477328.1\|421079_422222_+	hypothetical protein	L7TMF7	Rhizobium_phage	1.7e-70	52.0
WP_166477329.1\|422221_422578_+	hypothetical protein	L7TJM3	Rhizobium_phage	1.2e-14	37.4
WP_130686563.1\|422574_423003_+	hypothetical protein	NA	NA	NA	NA
WP_166477330.1\|423031_423286_+	hypothetical protein	NA	NA	NA	NA
WP_166477417.1\|423317_423755_+	lysozyme	A0A0K1Y6F2	Rhodobacter_phage	5.2e-28	43.7
WP_130686560.1\|423751_424123_+	hypothetical protein	NA	NA	NA	NA
WP_166477331.1\|424043_424355_+	dehydrogenase	NA	NA	NA	NA
WP_130686558.1\|424351_424693_+	hypothetical protein	B4UTS1	Rhizobium_phage	5.8e-35	64.3
WP_130686557.1\|425321_425513_-	hypothetical protein	NA	NA	NA	NA
WP_166477332.1\|425653_425917_+	hypothetical protein	A0A1J0GUZ4	Halomonas_phage	9.8e-06	40.9
WP_166477333.1\|425909_427160_+	hypothetical protein	A0A068CDE5	Rhizobium_phage	2.1e-170	78.3

DBSCAN-SWA_2

1150587 : 1160853

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003539661.1\|1150587_1151097_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.5e-45	59.4
WP_130655513.1\|1151126_1151699_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	2.0e-43	54.4
WP_130762253.1\|1151741_1152236_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.0e-24	37.2
WP_024321987.1\|1152372_1152651_+	hypothetical protein	NA	NA	NA	NA
WP_003539654.1\|1152784_1152940_+	hypothetical protein	NA	NA	NA	NA
WP_024321986.1\|1153277_1156127_-	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	8.3e-74	41.3
WP_018069570.1\|1156364_1157012_+	MarC family protein	NA	NA	NA	NA
WP_024321985.1\|1157141_1157648_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	7.1e-45	57.1
WP_018494639.1\|1157931_1160853_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.2

DBSCAN-SWA_3

1305748 : 1347822

uncultured_Mediterranean_phage(25.0%)

protease,transposase,lysis,integrase

attL 1300572:1300586|attR 1348663:1348677

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1300572:1300586	attL	NA	NA	NA	NA
WP_018073463.1\|1305748_1306882_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_018073462.1\|1306910_1307741_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_018484698.1\|1307740_1308484_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.2e-20	41.9
WP_017964143.1\|1308521_1309082_-	ribosome recycling factor	NA	NA	NA	NA
WP_003539289.1\|1309134_1309857_-	UMP kinase	NA	NA	NA	NA
WP_018073460.1\|1309953_1310880_-	elongation factor Ts	NA	NA	NA	NA
WP_018073459.1\|1311135_1311903_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_018073458.1\|1312084_1313191_-	solute-binding protein	NA	NA	NA	NA
WP_018073457.1\|1313190_1313808_-\|lysis	5-bromo-4-chloroindolyl phosphate hydrolysis protein	NA	NA	NA	NA
WP_130762559.1\|1313815_1315384_-	solute-binding protein	NA	NA	NA	NA
WP_024320703.1\|1315398_1316475_-	toxic anion resistance protein	H6X3X9	Enterobacteria_phage	3.5e-09	22.4
WP_018073454.1\|1316666_1317503_-	cell envelope integrity EipB family protein	NA	NA	NA	NA
WP_024320702.1\|1317639_1318110_+	RidA family protein	NA	NA	NA	NA
WP_024320701.1\|1318106_1318826_+	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	1.2e-13	27.5
WP_024320700.1\|1318904_1320095_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_024320699.1\|1320250_1320682_+	HIT family protein	NA	NA	NA	NA
WP_018073449.1\|1320739_1321030_+	Dabb family protein	NA	NA	NA	NA
WP_018073448.1\|1321102_1323595_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.9e-171	41.8
WP_017988219.1\|1323605_1323956_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.7e-13	45.1
WP_018073447.1\|1324232_1324604_-	phasin family protein	NA	NA	NA	NA
WP_003539277.1\|1324878_1325082_-	DUF3126 family protein	NA	NA	NA	NA
WP_011651805.1\|1325222_1326056_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_024320698.1\|1326184_1326970_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_018073445.1\|1327128_1327374_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_024320697.1\|1327401_1328556_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_018073443.1\|1328587_1329778_-	cystathionine beta-lyase	NA	NA	NA	NA
WP_024320696.1\|1330139_1331165_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	6.6e-82	44.9
WP_024320695.1\|1331268_1332471_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_024320694.1\|1332472_1333627_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_018073440.1\|1333662_1334436_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-32	39.6
WP_130661506.1\|1334597_1335263_-	hypothetical protein	NA	NA	NA	NA
WP_018073439.1\|1335664_1336093_+	DUF3597 domain-containing protein	NA	NA	NA	NA
WP_130681589.1\|1336305_1336617_+	hypothetical protein	NA	NA	NA	NA
WP_017964118.1\|1336769_1336949_-	hypothetical protein	NA	NA	NA	NA
WP_130762235.1\|1337402_1337750_+	hypothetical protein	NA	NA	NA	NA
WP_018073436.1\|1337873_1338164_+	DUF982 domain-containing protein	NA	NA	NA	NA
WP_130681585.1\|1338860_1340915_+	RTX toxin	NA	NA	NA	NA
WP_130762234.1\|1341143_1341677_-	chloramphenicol phosphotransferase	NA	NA	NA	NA
WP_130682780.1\|1343437_1343938_+	hypothetical protein	NA	NA	NA	NA
WP_130762233.1\|1344187_1345231_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_075223909.1\|1345547_1345880_+	nuclease	G8DH70	Emiliania_huxleyi_virus	4.0e-12	39.3
WP_130838787.1\|1346424_1347822_+\|integrase	site-specific integrase	NA	NA	NA	NA
1348663:1348677	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1429064 : 1442447

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320660.1\|1429064_1431605_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.3e-57	48.6
WP_003558894.1\|1431650_1431998_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_018073382.1\|1432204_1433077_+	ATP-binding protein	NA	NA	NA	NA
WP_024320659.1\|1433325_1434930_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_064251154.1\|1435171_1435825_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.6e-15	34.1
WP_018481196.1\|1435821_1436595_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	4.0e-23	30.2
WP_024320657.1\|1436599_1437883_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.3
WP_003558883.1\|1437984_1438812_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.0e-53	46.5
WP_024320656.1\|1438808_1439420_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_018073376.1\|1439471_1439663_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.8e-08	69.8
WP_018481201.1\|1439844_1440561_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
WP_024320655.1\|1440557_1441415_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	2.5e-34	38.5
WP_024320654.1\|1441433_1442447_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.5e-25	42.7

DBSCAN-SWA_5

1798085 : 1807130

Escherichia_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130762211.1\|1798085_1800053_+	glycosyltransferase family 1 protein	A0A0G2Y9S0	Acanthamoeba_polyphaga_mimivirus	6.7e-06	27.5
WP_105005630.1\|1800077_1800656_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A1D8EQH2	Escherichia_phage	1.4e-36	41.0
WP_105005629.1\|1800662_1801718_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.7e-96	51.8
WP_130681465.1\|1801721_1802609_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_130664388.1\|1802619_1803489_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	6.8e-96	59.2
WP_130664387.1\|1803609_1804221_-	riboflavin synthase	A0A2I2L4R9	Orpheovirus	2.0e-17	35.4
WP_130664386.1\|1804220_1805342_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.7e-36	34.3
WP_003547190.1\|1805345_1805822_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_018070506.1\|1805831_1807130_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	9.8e-99	51.5

DBSCAN-SWA_6

4137228 : 4147292

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130665162.1\|4137228_4139514_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-124	40.8
WP_017968025.1\|4140265_4140487_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	3.6e-17	53.4
WP_024323811.1\|4140496_4140901_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	6.5e-17	44.8
WP_024323812.1\|4140879_4143084_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	4.3e-211	52.1
WP_024323813.1\|4143170_4144145_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	1.6e-138	74.1
WP_130682510.1\|4144249_4145482_+	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	1.9e-14	29.3
WP_024323815.1\|4145500_4146229_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	9.0e-41	38.8
WP_024323816.1\|4146225_4146582_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_024323817.1\|4146581_4147292_-	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	7.1e-51	49.6

DBSCAN-SWA_7

5100254 : 5113783

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130762340.1\|5100254_5101460_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.3e-39	33.0
WP_018242983.1\|5101732_5102188_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.9e-15	38.7
WP_130762339.1\|5102191_5103082_-	hypothetical protein	NA	NA	NA	NA
WP_075224500.1\|5103752_5105762_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.6e-87	41.5
WP_130760930.1\|5105761_5107630_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	1.1e-77	35.7
WP_130760929.1\|5107800_5108529_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	9.5e-51	42.8
WP_018074037.1\|5108694_5109882_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	1.5e-37	28.6
WP_130664892.1\|5109992_5111030_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.1e-15	68.6
WP_018074040.1\|5111725_5113783_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP050082

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5826

Rhizobium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018071585.1\|1192_2188_+	plasmid partitioning protein RepB	NA	NA	NA	NA
WP_166477441.1\|2342_3557_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	3.0e-17	26.9
WP_166477442.1\|3737_4871_+	DUF1612 and helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_027689416.1\|4883_5826_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	6.0e-13	20.6

DBSCAN-SWA_2

9078 : 11604

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688914.1\|9078_11604_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.1e-85	36.4

DBSCAN-SWA_3

28685 : 29498

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017991931.1\|28685_29498_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-33	36.8

DBSCAN-SWA_4

33678 : 34602

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024321697.1\|33678_34602_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.1e-06	31.7

DBSCAN-SWA_5

45537 : 53979

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024321690.1\|45537_47436_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	3.4e-23	28.4
WP_130688972.1\|47531_49340_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.6e-46	28.6
WP_130688925.1\|49605_50223_+	flavodoxin family protein	NA	NA	NA	NA
WP_130688926.1\|50575_51982_+	hypothetical protein	NA	NA	NA	NA
WP_130688927.1\|52050_53979_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.0e-06	21.9

DBSCAN-SWA_6

62226 : 64941

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018071539.1\|62226_64941_-	ATP-binding cassette domain-containing protein	A0A1V0SJ29	Klosneuvirus	6.0e-05	24.2

DBSCAN-SWA_7

72908 : 78143

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075224641.1\|72908_74798_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-20	32.7
WP_024321672.1\|74953_76297_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_024321671.1\|76805_78143_+	nucleotide sugar dehydrogenase	M1HZW8	Acanthocystis_turfacea_Chlorella_virus	1.1e-36	30.5

DBSCAN-SWA_8

82532 : 88614

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688937.1\|82532_83315_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-34	39.7
WP_130688938.1\|83334_84315_+	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	4.3e-06	24.5
WP_130688939.1\|84865_86020_-	DUF3095 domain-containing protein	NA	NA	NA	NA
WP_024321663.1\|86245_86725_+	hypothetical protein	NA	NA	NA	NA
WP_130688940.1\|86823_88614_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.6e-35	27.8

DBSCAN-SWA_9

104303 : 105243

Bodo_saltans_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027689416.1\|104303_105243_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	6.0e-13	20.6

DBSCAN-SWA_10

114558 : 118009

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020397503.1\|114558_115287_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.8e-33	38.6
WP_130688955.1\|115331_116399_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_027690011.1\|116403_117234_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_017991872.1\|117241_118009_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	9.8e-22	34.0

DBSCAN-SWA_11

127892 : 128348

Burkholderia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689148.1\|127892_128348_-	DNA mismatch endonuclease Vsr	E5E3X5	Burkholderia_phage	8.1e-32	55.1

DBSCAN-SWA_12

137434 : 138760

Acidithiobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689152.1\|137434_138760_-	DNA cytosine methyltransferase	K4HZD0	Acidithiobacillus_phage	2.7e-67	38.4

DBSCAN-SWA_13

160975 : 164602

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689160.1\|160975_161866_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.8e-06	30.9
WP_130689161.1\|162601_162865_-	hypothetical protein	NA	NA	NA	NA
WP_130689162.1\|162869_163682_-	Ku protein	NA	NA	NA	NA
WP_130665795.1\|163693_164602_-	Ku protein	A0A068LLA2	Mycobacterium_phage	8.3e-12	26.4

DBSCAN-SWA_14

171336 : 173124

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689167.1\|171336_173124_+	HAMP domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	7.6e-17	32.0

DBSCAN-SWA_15

180973 : 181429

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024323544.1\|180973_181429_+	NUDIX hydrolase	S5VVF8	Pseudomonas_phage	2.3e-10	34.5

DBSCAN-SWA_16

190627 : 194623

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130665782.1\|190627_191563_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	1.4e-30	36.1
WP_130665781.1\|191570_192422_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.1e-12	34.9
WP_130665780.1\|192544_193150_-	cupin domain-containing protein	NA	NA	NA	NA
WP_130689237.1\|193534_194623_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-23	33.7

DBSCAN-SWA_17

204678 : 210658

Mycobacterium_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688752.1\|204678_206010_+	aspartate aminotransferase family protein	A0A2D1G879	Mycobacterium_phage	4.1e-07	30.0
WP_130688753.1\|206006_207302_+	DUF3422 family protein	NA	NA	NA	NA
WP_027689416.1\|207483_208426_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	6.0e-13	20.6
WP_130689251.1\|208531_208978_+	hypothetical protein	NA	NA	NA	NA
WP_166477427.1\|209469_210658_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.2e-52	44.4

DBSCAN-SWA_18

238120 : 239464

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130655367.1\|238120_239464_-	chloride channel protein	A0A1X9I5Z9	Streptococcus_phage	1.2e-06	27.1

DBSCAN-SWA_19

245925 : 247306

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075225166.1\|245925_246126_-	hypothetical protein	A0A291AUQ4	Sinorhizobium_phage	2.7e-08	56.6
WP_130655373.1\|246259_247306_+	ATP-dependent DNA ligase	A0A068CDF3	Rhizobium_phage	1.5e-150	75.4

DBSCAN-SWA_20

251369 : 251999

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075225172.1\|251369_251999_-	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.9e-10	48.3

DBSCAN-SWA_21

255295 : 256831

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688769.1\|255295_256831_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	4.0e-75	36.3

DBSCAN-SWA_22

268645 : 270912

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018482978.1\|268645_269422_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.9e-30	35.3
WP_130688776.1\|269418_270912_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	2.5e-45	33.1

DBSCAN-SWA_23

277053 : 280911

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024319896.1\|277053_278724_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	1.1e-44	30.0
WP_130688780.1\|279024_280911_+	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	2.4e-05	30.8

DBSCAN-SWA_24

301484 : 302918

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688790.1\|301484_302918_+	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	5.9e-121	49.2

DBSCAN-SWA_25

305968 : 306811

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080634369.1\|305968_306811_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	3.0e-08	35.5

DBSCAN-SWA_26

313003 : 314671

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130655402.1\|313003_314671_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-16	33.2

DBSCAN-SWA_27

337514 : 338600

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018069916.1\|337514_338600_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-24	29.3

DBSCAN-SWA_28

344679 : 345516

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018069923.1\|344679_345516_-	alpha/beta hydrolase	A0A249XU20	Mycobacterium_phage	1.8e-08	24.8

DBSCAN-SWA_29

355154 : 359918

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018069934.1\|355154_356051_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.2e-12	33.8
WP_018069935.1\|356126_356432_-	hypothetical protein	NA	NA	NA	NA
WP_024319943.1\|356601_357372_-	glucose 1-dehydrogenase	A0A0N9R355	Chrysochromulina_ericina_virus	8.6e-10	24.6
WP_024319944.1\|357491_358118_-	hypothetical protein	NA	NA	NA	NA
WP_166477445.1\|358507_358831_-	hypothetical protein	NA	NA	NA	NA
WP_130688802.1\|358997_359918_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	1.8e-62	46.9

DBSCAN-SWA_30

364511 : 368660

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018071042.1\|364511_366755_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.7e-13	31.0
WP_018071043.1\|366861_367674_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-14	32.4
WP_130688804.1\|367670_368660_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.6e-11	22.1

DBSCAN-SWA_31

384233 : 402058

Diadromus_pulchellus_ascovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020397468.1\|384233_385028_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	2.3e-10	27.1
WP_130688806.1\|385131_387288_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_130688807.1\|387303_388311_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	1.5e-30	29.7
WP_130688808.1\|388307_389186_+	DNA polymerase domain-containing protein	NA	NA	NA	NA
WP_075225848.1\|389198_389924_-	glutathione S-transferase	NA	NA	NA	NA
WP_018071062.1\|389930_390221_-	DUF3175 domain-containing protein	A0A0F6TH17	Sinorhizobium_phage	3.0e-24	63.4
WP_130688809.1\|390271_390586_-	plasmid stabilization protein	NA	NA	NA	NA
WP_075225850.1\|390739_391117_+	hypothetical protein	NA	NA	NA	NA
WP_130688810.1\|391162_393880_-	response regulator	B5LWN8	Feldmannia_species_virus	7.0e-06	24.9
WP_018071066.1\|394051_394225_-	hypothetical protein	NA	NA	NA	NA
WP_018071067.1\|394234_394405_-	hypothetical protein	NA	NA	NA	NA
WP_024319964.1\|394544_394799_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_130688811.1\|394941_395583_-	UdgX family uracil-DNA binding protein	A0A2I6PIA1	Pseudomonas_phage	2.4e-13	32.7
WP_130666363.1\|395796_397260_+	phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase family protein	NA	NA	NA	NA
WP_130683164.1\|397353_398169_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_075225853.1\|398379_399270_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.0e-14	28.0
WP_130688812.1\|400234_402058_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-14	35.6

DBSCAN-SWA_32

407377 : 413919

Trichoplusia_ni_ascovirus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075225863.1\|407377_408175_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.3e-24	33.6
WP_075225864.1\|408298_409183_+	sugar phosphate isomerase/epimerase	NA	NA	NA	NA
WP_130688818.1\|409197_410070_+	TIM barrel protein	NA	NA	NA	NA
WP_130663463.1\|410168_410891_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.0e-20	34.4
WP_075225868.1\|411349_412360_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_130663464.1\|412389_413919_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.0e-09	26.3

DBSCAN-SWA_33

423100 : 423769

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688821.1\|423100_423769_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	6.1e-12	32.9

DBSCAN-SWA_34

430440 : 431613

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018071089.1\|430440_431613_+	hypothetical protein	A0A0B5JD48	Pandoravirus	1.8e-14	31.4

DBSCAN-SWA_35

434782 : 440293

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075225506.1\|434782_435841_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.9e-24	34.5
WP_130683190.1\|435913_436666_+	metallophosphatase	NA	NA	NA	NA
WP_130688826.1\|436770_438003_+	peptidase T	NA	NA	NA	NA
WP_018071096.1\|438149_438986_-	cell wall hydrolase	A0A142EZU6	Stenotrophomonas_phage	1.1e-07	31.7
WP_024319985.1\|439252_440293_-	sulfate/molybdate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.0e-31	37.4

DBSCAN-SWA_36

445019 : 456910

Bacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688827.1\|445019_445712_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-21	31.1
WP_130688828.1\|445708_448417_-	sensor histidine kinase KdpD	Q8QNA2	Ectocarpus_siliculosus_virus	1.3e-12	36.5
WP_130688829.1\|448498_449068_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_018483394.1\|449143_451204_-	potassium-transporting ATPase subunit KdpB	E4ZFI9	Streptococcus_phage	8.4e-36	27.9
WP_018071107.1\|451248_451404_-	hypothetical protein	NA	NA	NA	NA
WP_027690228.1\|451413_453117_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_003547774.1\|453186_453276_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_130688830.1\|453766_454810_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.7e-08	23.5
WP_027690227.1\|454935_455505_-	DedA family protein	NA	NA	NA	NA
WP_130688831.1\|455548_456910_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.7e-64	35.0

DBSCAN-SWA_37

474039 : 480026

Bacillus_virus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688841.1\|474039_474822_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.8e-15	28.1
WP_130688842.1\|474821_475523_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-14	27.5
WP_018071130.1\|475527_476415_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_024320006.1\|476416_477406_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_018071132.1\|477539_479135_+\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	2.8e-55	30.8
WP_130688843.1\|479144_480026_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	7.1e-24	29.9

DBSCAN-SWA_38

484620 : 488086

Amsacta_moorei_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688848.1\|484620_486156_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.7e-12	25.8
WP_024320014.1\|486229_487225_-	rhamnose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018071139.1\|487273_488086_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.1e-18	28.4

DBSCAN-SWA_39

496182 : 497040

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026170824.1\|496182_497040_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	5.4e-61	46.6

DBSCAN-SWA_40

501992 : 503507

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688853.1\|501992_503507_-\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	1.3e-22	26.3

DBSCAN-SWA_41

506521 : 508221

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688856.1\|506521_507421_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-17	31.4
WP_130688857.1\|507417_508221_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.8e-11	26.7

DBSCAN-SWA_42

517711 : 520341

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688859.1\|517711_519400_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.7e-16	27.6
WP_130688860.1\|519396_520341_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	3.0e-28	29.3

DBSCAN-SWA_43

531851 : 533687

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688863.1\|531851_533687_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.2e-18	29.6

DBSCAN-SWA_44

537249 : 537564

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688865.1\|537249_537564_-	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	7.6e-05	35.7

DBSCAN-SWA_45

550931 : 552560

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320067.1\|550931_552560_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-26	34.6

DBSCAN-SWA_46

563503 : 564637

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320076.1\|563503_564637_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	7.7e-23	34.5

DBSCAN-SWA_47

577898 : 585570

Bordetella_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688052.1\|577898_578639_+	helix-turn-helix transcriptional regulator	A0A291LAM3	Bordetella_phage	9.5e-14	46.1
WP_130687757.1\|578751_579753_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_130657296.1\|579802_580618_-	oxidoreductase	NA	NA	NA	NA
WP_130687755.1\|580708_581185_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_130687753.1\|581272_583294_-	beta-N-acetylhexosaminidase	A0A2H4UUW7	Bodo_saltans_virus	1.8e-06	25.9
WP_130657293.1\|583349_583820_-	N-acetyltransferase	NA	NA	NA	NA
WP_130657292.1\|583831_584758_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-19	31.3
WP_130687751.1\|584754_585570_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	6.8e-13	25.6

DBSCAN-SWA_48

600916 : 605750

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130687735.1\|600916_601897_-	3'-5' exonuclease	A0A223W0B0	Agrobacterium_phage	1.9e-30	36.9
WP_130687733.1\|601989_603369_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_018495109.1\|603365_604040_-	response regulator transcription factor	NA	NA	NA	NA
WP_018071246.1\|604163_604763_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_018071247.1\|604859_605750_-	haloalkane dehalogenase	B9U1C3	Vaccinia_virus	4.4e-42	34.6

DBSCAN-SWA_49

613651 : 613861

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003548109.1\|613651_613861_+	cold-shock protein	A0A218MMZ6	uncultured_virus	8.9e-10	54.7

DBSCAN-SWA_50

623145 : 624030

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003548134.1\|623145_624030_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	6.9e-11	40.4

DBSCAN-SWA_51

627580 : 628489

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024321767.1\|627580_628489_-	glutamine amidotransferase family protein	F2Y1G4	Organic_Lake_phycodnavirus	1.1e-06	29.2

DBSCAN-SWA_52

659817 : 663547

Yaba_monkey_tumor_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688891.1\|659817_661002_-	serpin family protein	Q6TUM5	Yaba_monkey_tumor_virus	1.1e-11	25.5
WP_130688892.1\|661015_663547_-\|protease	trypsin-like serine protease	Q6JKF3	Neodiprion_sertifer_nucleopolyhedrovirus	2.6e-26	33.9

DBSCAN-SWA_53

679194 : 679599

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018071616.1\|679194_679599_+	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	1.3e-17	45.4

DBSCAN-SWA_54

689046 : 689820

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_128403610.1\|689046_689820_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.6e-34	40.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP050084

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

218852 : 306115

Ochrobactrum_phage(22.22%)

transposase,integrase,protease

attL 236488:236503|attR 304465:304480

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166477473.1\|218852_219614_+\|transposase	transposase	NA	NA	NA	NA
WP_166477471.1\|219939_221088_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_003551659.1\|221280_221607_+	hypothetical protein	NA	NA	NA	NA
WP_018483756.1\|222275_222647_-	hypothetical protein	NA	NA	NA	NA
WP_042941685.1\|224382_225648_-	plasmid replication protein RepCa2	NA	NA	NA	NA
WP_027689819.1\|225886_226927_-	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	9.2e-39	38.3
WP_027689818.1\|226911_228129_-	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.2e-93	47.8
WP_027689817.1\|228493_229117_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_018495925.1\|230868_231579_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_027689815.1\|233777_235736_+	elongation factor G	NA	NA	NA	NA
236488:236503	attL	NA	NA	NA	NA
WP_018068576.1\|237034_237799_-	slipin family protein	A0A2K9L035	Tupanvirus	3.4e-22	29.5
WP_130690324.1\|237827_239177_-	nodulation protein NfeD	NA	NA	NA	NA
WP_165417481.1\|239699_240011_+	AAA family ATPase	NA	NA	NA	NA
WP_085065918.1\|240085_240427_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_027689811.1\|240476_240662_-	hypothetical protein	NA	NA	NA	NA
WP_042941683.1\|241853_242807_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_085994721.1\|243115_244105_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_027689809.1\|244556_245297_-	response regulator transcription factor	NA	NA	NA	NA
WP_027689808.1\|245901_246612_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.5e-08	24.9
WP_027689807.1\|246601_247996_+	amidohydrolase family protein	NA	NA	NA	NA
WP_027689806.1\|248131_249493_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_027689805.1\|249508_250573_-	ornithine cyclodeaminase	NA	NA	NA	NA
WP_020397333.1\|250933_251797_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
WP_027689804.1\|251793_252447_-	dimethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_130688986.1\|252491_253358_-	TauD/TfdA family dioxygenase	NA	NA	NA	NA
WP_130657836.1\|253478_254564_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.2e-26	33.8
WP_018068592.1\|254560_255364_-	ABC transporter permease	NA	NA	NA	NA
WP_018068593.1\|255360_256260_-	ABC transporter permease	NA	NA	NA	NA
WP_027689800.1\|256270_257314_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018068605.1\|259893_260202_+	WGR domain-containing protein	NA	NA	NA	NA
WP_018068606.1\|260490_260802_-	DUF736 domain-containing protein	NA	NA	NA	NA
WP_018068607.1\|261546_262089_-	hypothetical protein	NA	NA	NA	NA
WP_018068608.1\|262088_262397_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_027689799.1\|262966_264496_-	SulP family inorganic anion transporter	NA	NA	NA	NA
WP_018068610.1\|264500_265205_-	carbonic anhydrase	NA	NA	NA	NA
WP_130663678.1\|265736_266297_-	hypothetical protein	NA	NA	NA	NA
WP_027689797.1\|266427_267090_-	transcriptional regulator	NA	NA	NA	NA
WP_018068064.1\|267593_268358_-	response regulator	W8CYM9	Bacillus_phage	8.3e-29	35.1
WP_027689796.1\|268623_269133_-	invasion protein	NA	NA	NA	NA
WP_166477472.1\|280107_285213_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.8e-138	26.4
WP_027689789.1\|286905_287454_+	hypothetical protein	NA	NA	NA	NA
WP_130663931.1\|291958_293431_+	benzaldehyde dehydrogenase	NA	NA	NA	NA
WP_027689891.1\|294658_295588_+	alpha/beta hydrolase	A0A2P1EM31	Moumouvirus	5.0e-12	26.7
WP_130663929.1\|295610_296327_+\|transposase	IS6 family transposase	NA	NA	NA	NA
WP_156925176.1\|297525_298251_+	hypothetical protein	NA	NA	NA	NA
WP_027689888.1\|298432_299146_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_130689793.1\|302107_302968_-\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	9.0e-32	33.5
WP_027688354.1\|303101_303302_-	hypothetical protein	NA	NA	NA	NA
WP_051320192.1\|304113_304746_+	NYN domain-containing protein	NA	NA	NA	NA
304465:304480	attR	NA	NA	NA	NA
WP_130663926.1\|305175_305718_-\|protease	omptin family outer membrane protease	NA	NA	NA	NA
WP_130683353.1\|305599_306115_-\|protease	omptin family outer membrane protease	NA	NA	NA	NA

DBSCAN-SWA_2

432698 : 456268

Leptospira_phage(33.33%)

transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130683361.1\|432698_434072_+\|transposase	ISNCY family transposase	A1YTJ2	Porcine_endogenous_retrovirus	3.0e-05	27.3
WP_027688456.1\|435670_436321_-	porin family protein	NA	NA	NA	NA
WP_130661517.1\|437257_437524_+	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_027688458.1\|438041_438785_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_130683385.1\|439039_440228_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-52	44.4
WP_027688461.1\|440817_441477_-\|tail	tail fiber protein	A0A291LA10	Bordetella_phage	2.9e-14	38.5
WP_027688462.1\|441525_442221_-	hypothetical protein	NA	NA	NA	NA
WP_027688463.1\|442787_443354_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_017958612.1\|443665_443824_+	hypothetical protein	NA	NA	NA	NA
WP_027688465.1\|445813_447370_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_027688466.1\|447828_448056_+	hypothetical protein	NA	NA	NA	NA
WP_027688469.1\|450008_451136_+	hypothetical protein	NA	NA	NA	NA
WP_165418154.1\|452445_452655_+	hypothetical protein	NA	NA	NA	NA
WP_165406167.1\|453409_453586_-	hypothetical protein	NA	NA	NA	NA
WP_130661511.1\|453828_455424_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.6e-56	31.5
WP_130661512.1\|455478_455832_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	2.7e-19	45.2
WP_130681969.1\|455812_456268_-\|transposase	transposase	A0A0P0ZBP6	Stx2-converting_phage	2.9e-05	51.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP050083

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3710

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130676310.1\|1213_2203_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	2.4e-44	36.9
WP_130688975.1\|2402_3710_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	8.6e-18	26.2

DBSCAN-SWA_2

12343 : 18094

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689229.1\|12343_13735_-	hypothetical protein	A0A1V0SCZ9	Indivirus	9.5e-07	30.5
WP_130762667.1\|13742_14609_-	hypothetical protein	NA	NA	NA	NA
WP_130689224.1\|14695_18094_-	UvrD-helicase domain-containing protein	G3MA40	Bacillus_virus	4.5e-34	26.0

DBSCAN-SWA_3

36843 : 37461

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689231.1\|36843_37461_+	hypothetical protein	A0A0H4SQ70	Cyanophage	3.4e-17	33.5

DBSCAN-SWA_4

43972 : 44995

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689234.1\|43972_44995_-\|transposase	IS110 family transposase	A0A1X9I5Z0	Streptococcus_phage	4.5e-06	27.1

DBSCAN-SWA_5

51524 : 57715

Leptospira_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166477452.1\|51524_52672_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.4e-48	40.8
WP_130688336.1\|53046_54246_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	1.5e-93	48.2
WP_130688988.1\|55201_55537_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_130688989.1\|55634_56525_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.8e-06	30.9
WP_130688990.1\|56794_57715_+	DUF1738 domain-containing protein	A0A1V0EEV1	Caulobacter_phage	2.1e-63	47.2

DBSCAN-SWA_6

72513 : 74289

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688995.1\|72513_74289_+	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	5.4e-31	37.2

DBSCAN-SWA_7

81135 : 82775

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130688999.1\|81135_81990_-	ABC transporter permease subunit	G3M9Y4	Bacillus_virus	7.8e-20	27.6
WP_062944783.1\|81986_82775_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.3e-32	36.5

DBSCAN-SWA_8

87343 : 88189

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689002.1\|87343_88189_+	alpha/beta fold hydrolase	A0A249XPN5	Mycobacterium_phage	5.2e-08	32.6

DBSCAN-SWA_9

94798 : 95878

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130680745.1\|94798_95878_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-31	39.3

DBSCAN-SWA_10

98976 : 104061

Synechococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166477454.1\|98976_100194_-	NAD(P)-dependent oxidoreductase	A0A2D2W2J1	Stenotrophomonas_phage	2.7e-05	30.7
WP_018071769.1\|100203_101184_-	GHMP kinase	A0A222YW25	Synechococcus_phage	8.4e-34	30.5
WP_130689010.1\|101180_103130_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_024322589.1\|103119_104061_-	SDR family NAD(P)-dependent oxidoreductase	A0A0E3FNQ3	Synechococcus_phage	7.1e-22	29.0

DBSCAN-SWA_11

108293 : 108920

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024322586.1\|108293_108920_-	SIS domain-containing protein	A0A067XQR2	Caulobacter_phage	9.2e-18	36.7

DBSCAN-SWA_12

112813 : 113896

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130657561.1\|112813_113896_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-22	31.2

DBSCAN-SWA_13

118056 : 119034

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689018.1\|118056_119034_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	5.4e-25	35.8

DBSCAN-SWA_14

125691 : 126708

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130663051.1\|125691_126708_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.1e-26	29.6

DBSCAN-SWA_15

131993 : 133094

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689025.1\|131993_133094_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	8.3e-22	32.4

DBSCAN-SWA_16

145598 : 147706

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032989428.1\|145598_146648_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-05	34.6
WP_032989426.1\|146644_147706_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.2e-17	30.6

DBSCAN-SWA_17

151320 : 152337

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689033.1\|151320_152337_+	hydroxyacid dehydrogenase	M1HST2	Paramecium_bursaria_Chlorella_virus	5.5e-12	26.9

DBSCAN-SWA_18

155916 : 162350

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027688882.1\|155916_159063_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.1e-62	23.0
WP_027688881.1\|159062_160136_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_018071821.1\|160371_161058_+	response regulator	W8CYM9	Bacillus_phage	1.9e-29	32.4
WP_130689034.1\|161060_162350_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.8e-12	22.4

DBSCAN-SWA_19

167097 : 168708

Pike_perch_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130657592.1\|167097_168708_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	3.6e-18	62.5

DBSCAN-SWA_20

171829 : 172597

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689041.1\|171829_172597_+	3-hydroxyacyl-CoA dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-06	28.3

DBSCAN-SWA_21

178503 : 179901

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689045.1\|178503_179901_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.7e-38	27.1

DBSCAN-SWA_22

186576 : 189574

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024322523.1\|186576_187428_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.6e-19	30.9
WP_024322522.1\|187592_188378_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.0e-15	30.5
WP_024322521.1\|188425_189574_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.0e-23	32.8

DBSCAN-SWA_23

206676 : 211145

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027688854.1\|206676_207489_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-15	28.6
WP_018483888.1\|208180_208447_+	DUF2277 domain-containing protein	NA	NA	NA	NA
WP_024322508.1\|208984_210049_-	GDP-L-fucose synthase	R9S8B8	Prochlorococcus_phage	9.2e-95	56.6
WP_130674279.1\|210041_211145_-	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	9.2e-130	63.4

DBSCAN-SWA_24

223831 : 224878

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024322496.1\|223831_224878_+	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	5.0e-85	47.8

DBSCAN-SWA_25

229755 : 233750

Bathycoccus_sp._RCC1105_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024322492.1\|229755_230859_+	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	1.4e-48	32.8
WP_130674282.1\|230848_231568_+	acyltransferase	NA	NA	NA	NA
WP_027688842.1\|231564_232536_+	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	6.3e-42	35.1
WP_130663034.1\|232532_233750_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	2.8e-39	32.5

DBSCAN-SWA_26

253040 : 255185

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024323477.1\|253040_255185_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.7e-39	29.2

DBSCAN-SWA_27

268817 : 269276

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024323465.1\|268817_269276_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	4.6e-27	49.6

DBSCAN-SWA_28

272784 : 273870

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130674295.1\|272784_273870_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.1e-32	35.5

DBSCAN-SWA_29

289238 : 290069

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075223651.1\|289238_290069_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-28	39.9

DBSCAN-SWA_30

296485 : 297568

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075223653.1\|296485_297568_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.4e-26	35.0

DBSCAN-SWA_31

302692 : 306117

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075223656.1\|302692_304384_-	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	3.0e-07	28.3
WP_130666052.1\|304380_306117_-	thiol reductant ABC exporter subunit CydD	A0A076FI99	Aureococcus_anophage	7.4e-09	26.5

DBSCAN-SWA_32

314267 : 323365

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075223663.1\|314267_315323_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-27	35.0
WP_166477455.1\|315322_316102_+	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	3.7e-08	35.2
WP_130666047.1\|316085_317090_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.5e-19	28.0
WP_130666046.1\|317089_317899_+	inositol monophosphatase	NA	NA	NA	NA
WP_130689055.1\|317973_319629_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.7e-18	34.8
WP_130689056.1\|319758_320631_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_018069338.1\|320694_321789_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_018069339.1\|321800_322583_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-18	32.4
WP_018069340.1\|322579_323365_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	33.0

DBSCAN-SWA_33

329417 : 330902

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166477457.1\|329417_330902_-	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-11	29.5

DBSCAN-SWA_34

342964 : 347122

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018069357.1\|342964_344041_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.8e-25	35.0
WP_018069358.1\|344289_345312_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	3.9e-26	29.6
WP_018069359.1\|345350_346304_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_024320145.1\|346300_347122_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-15	29.0

DBSCAN-SWA_35

353567 : 358275

Bodo_saltans_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027689416.1\|353567_354507_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	6.0e-13	20.6
WP_018069369.1\|354597_355071_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_130689171.1\|355070_356861_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-09	32.2
WP_130689172.1\|357192_358275_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.4e-20	46.0

DBSCAN-SWA_36

362831 : 366445

Trichoplusia_ni_ascovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689174.1\|362831_363617_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-07	26.9
WP_130674346.1\|363644_364343_+	ribonuclease activity regulator RraA	NA	NA	NA	NA
WP_130689175.1\|364615_365530_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_166477458.1\|365501_366445_-\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	2.7e-13	20.9

DBSCAN-SWA_37

371613 : 373146

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689179.1\|371613_373146_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-16	28.7

DBSCAN-SWA_38

378300 : 379215

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689182.1\|378300_379215_-	J domain-containing protein	A0A1V0SF83	Hokovirus	1.0e-09	23.8

DBSCAN-SWA_39

384114 : 394195

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320174.1\|384114_385824_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-10	26.8
WP_024320175.1\|385820_386672_-	ABC transporter permease	NA	NA	NA	NA
WP_018069399.1\|386668_387607_-	ABC transporter permease	NA	NA	NA	NA
WP_130662976.1\|387658_388549_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_024320177.1\|388691_389489_+	LuxR family transcriptional regulator	A0A1I9KF49	Aeromonas_phage	1.5e-09	26.6
WP_018069402.1\|389553_390456_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_027688756.1\|390546_391404_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_042941104.1\|391503_392400_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_027688754.1\|392417_393329_-	acetamidase	A0A1V0S8X7	Catovirus	6.9e-06	25.6
WP_130689186.1\|393577_394195_-	porin family protein	O11861	Bartonella_henselae_phage	5.1e-13	35.7

DBSCAN-SWA_40

401277 : 410327

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027688748.1\|401277_402072_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	5.4e-15	30.8
WP_027688747.1\|402156_402960_+	TIM barrel protein	NA	NA	NA	NA
WP_130689107.1\|403002_403995_+	inositol 2-dehydrogenase	NA	NA	NA	NA
WP_018070821.1\|404119_404407_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_130689106.1\|404697_405930_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-25	43.5
WP_130674367.1\|405940_406393_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003549481.1\|406477_407242_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_130657722.1\|407266_408331_-	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
WP_025398453.1\|408327_409320_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-18	30.3
WP_018070816.1\|409319_410327_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.9e-12	24.3

DBSCAN-SWA_41

422736 : 423525

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689103.1\|422736_423525_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-23	37.4

DBSCAN-SWA_42

427536 : 429087

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689101.1\|427536_429087_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.0e-09	26.2

DBSCAN-SWA_43

437726 : 443271

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320211.1\|437726_438806_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-16	28.4
WP_024320212.1\|438847_440359_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_018070788.1\|440479_441253_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.5e-17	28.0
WP_165419547.1\|441350_442256_-	DMT family transporter	NA	NA	NA	NA
WP_166477466.1\|442341_443271_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.1e-14	25.1

DBSCAN-SWA_44

447099 : 448722

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689095.1\|447099_448722_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.3e-59	29.9

DBSCAN-SWA_45

458583 : 460599

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018070768.1\|458583_460599_-	polysaccharide biosynthesis protein	L7RD47	Acanthamoeba_polyphaga_moumouvirus	4.9e-12	23.4

DBSCAN-SWA_46

463917 : 470477

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018070764.1\|463917_465435_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-15	26.5
WP_018070763.1\|465431_466430_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.6e-24	28.3
WP_075223726.1\|466628_467069_+	fucose dissimilation pathway protein FucU	NA	NA	NA	NA
WP_075223727.1\|467142_467436_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_075223728.1\|467432_467768_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_163856570.1\|467840_468743_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	3.4e-13	24.4
WP_130687235.1\|468845_469478_-	DsbA family protein	NA	NA	NA	NA
WP_075223731.1\|469592_470477_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	7.6e-10	25.7

DBSCAN-SWA_47

475718 : 485163

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075223735.1\|475718_477239_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-21	28.8
WP_130662941.1\|477238_478339_+	ABC transporter permease	NA	NA	NA	NA
WP_130662940.1\|478335_479247_+	ABC transporter permease	NA	NA	NA	NA
WP_130689092.1\|479345_479879_-	NUDIX hydrolase	A0A1C3NEZ8	Phage_NCTB	9.5e-08	32.3
WP_130689091.1\|479974_480619_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_166477460.1\|480618_481623_+	inorganic phosphate transporter	M4QMY4	Ostreococcus_lucimarinus_virus	3.4e-06	29.5
WP_026238791.1\|482090_483404_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018070743.1\|483460_484354_+	nitrate ABC transporter permease	NA	NA	NA	NA
WP_017958153.1\|484365_485163_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-26	33.7

DBSCAN-SWA_48

492375 : 495783

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689089.1\|492375_493926_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-11	28.0
WP_018070733.1\|493925_494594_+	cysteine hydrolase	NA	NA	NA	NA
WP_018070732.1\|494586_494940_+	allophanate hydrolase	NA	NA	NA	NA
WP_018486125.1\|494991_495783_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.3e-32	39.4

DBSCAN-SWA_49

503218 : 507785

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130657776.1\|503218_505609_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.1e-18	31.7
WP_018070721.1\|505714_506521_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_018070720.1\|506594_507785_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	4.8e-07	26.3

DBSCAN-SWA_50

521375 : 523007

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689084.1\|521375_523007_+	ABC transporter ATP-binding protein	A0A1V0SBM3	Catovirus	6.3e-18	25.9

DBSCAN-SWA_51

526723 : 528871

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018070704.1\|526723_528871_+	VWA domain-containing protein	U5PV67	Salmonella_phage	1.5e-06	28.2

DBSCAN-SWA_52

532281 : 537182

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018486096.1\|532281_533223_-	2-hydroxyacid dehydrogenase	M1H3H9	Paramecium_bursaria_Chlorella_virus	1.0e-12	25.2
WP_018496302.1\|533358_534123_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.5e-09	25.1
WP_130689111.1\|534136_534694_+	gluconokinase	NA	NA	NA	NA
WP_027688677.1\|534683_535577_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_130689082.1\|535685_537182_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-16	30.0

DBSCAN-SWA_53

541174 : 542799

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689079.1\|541174_542074_+	ABC transporter permease	G3M9Y4	Bacillus_virus	4.5e-18	24.8
WP_130689078.1\|542049_542799_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-27	38.7

DBSCAN-SWA_54

552696 : 553476

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020572104.1\|552696_553476_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.7e-27	37.2

DBSCAN-SWA_55

559344 : 560115

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130657807.1\|559344_560115_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.0e-28	33.3

DBSCAN-SWA_56

565879 : 567394

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130737396.1\|565879_567394_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.7e-22	30.4

DBSCAN-SWA_57

574301 : 576137

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689121.1\|574301_576137_-	3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	1.6e-22	24.8

DBSCAN-SWA_58

581479 : 582292

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024320314.1\|581479_582292_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.7e-11	24.4

DBSCAN-SWA_59

587299 : 590323

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027688639.1\|587299_588064_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-33	42.2
WP_003538412.1\|588060_588819_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_130689124.1\|588815_589523_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_166477462.1\|589519_590323_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	8.7e-05	38.7

DBSCAN-SWA_60

600824 : 601541

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130674156.1\|600824_601541_+	SDR family NAD(P)-dependent oxidoreductase	F2NZ12	Diadromus_pulchellus_ascovirus	6.0e-05	26.9

DBSCAN-SWA_61

612352 : 613435

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130722795.1\|612352_613435_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.4e-18	53.9

DBSCAN-SWA_62

631866 : 635519

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130689140.1\|631866_632631_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-19	33.6
WP_130689141.1\|632686_633415_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	3.8e-07	31.8
WP_130722804.1\|633441_634701_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_130689143.1\|634697_635519_-	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.1e-18	31.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050080

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP050082

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP050084

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP050083

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection