CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP050112	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b5, complete sequence	0 crisprs	DEDDh	0	0
NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	0 crisprs	csa3	0	0
NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	0 crisprs	csa3,DEDDh	0	48
NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	0 crisprs	NA	0	58
NZ_CP050108	Rhizobium leguminosarum bv. trifolii strain 3B chromosome, complete genome	3 crisprs	DEDDh,csa3,cas3,WYL	3	6

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2242

Ochrobactrum_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654110.1\|1201_2242_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	1.2e-35	32.4

DBSCAN-SWA_2

7270 : 14633

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654112.1\|7270_8188_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	1.9e-32	53.1
WP_020572886.1\|9195_10341_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_026231066.1\|10696_11743_+	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	8.0e-83	47.9
WP_130654113.1\|11742_12729_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.2e-49	37.1
WP_130654114.1\|12725_14633_+	glycosyltransferase	M1I7Q5	Paramecium_bursaria_Chlorella_virus	8.5e-75	41.1

DBSCAN-SWA_3

22471 : 23518

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654117.1\|22471_23518_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	2.6e-25	32.7

DBSCAN-SWA_4

27494 : 28475

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130729852.1\|27494_28475_-	alpha/beta hydrolase	A0A249XU20	Mycobacterium_phage	6.0e-08	24.8

DBSCAN-SWA_5

39416 : 40211

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018247048.1\|39416_40211_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	4.1e-15	30.8

DBSCAN-SWA_6

48268 : 48727

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018247039.1\|48268_48727_-	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	3.0e-26	49.6

DBSCAN-SWA_7

52237 : 53323

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654127.1\|52237_53323_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-31	34.7

DBSCAN-SWA_8

68755 : 69586

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654136.1\|68755_69586_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-29	41.0

DBSCAN-SWA_9

76012 : 77095

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654140.1\|76012_77095_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.4e-26	35.0

DBSCAN-SWA_10

82333 : 85764

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654144.1\|82333_84025_-	amino acid ABC transporter ATP-binding/permease protein	A0A1V0SE00	Indivirus	1.4e-07	25.6
WP_130654145.1\|84021_85764_-	thiol reductant ABC exporter subunit CydD	F2Y302	Organic_Lake_phycodnavirus	1.4e-12	32.4

DBSCAN-SWA_11

94008 : 103117

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654149.1\|94008_95064_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-27	35.0
WP_130654150.1\|95063_95843_+	glycerophosphodiester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	3.7e-08	35.2
WP_130654151.1\|95826_96831_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.0e-18	28.8
WP_130654152.1\|96830_97640_+	inositol monophosphatase	NA	NA	NA	NA
WP_130654153.1\|97715_99374_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.8e-20	37.8
WP_130654154.1\|99502_100375_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_130654155.1\|100437_101532_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_130654156.1\|101543_102326_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-17	31.1
WP_130654157.1\|102322_103117_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-17	31.2

DBSCAN-SWA_12

109295 : 110780

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654163.1\|109295_110780_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-13	26.2

DBSCAN-SWA_13

122760 : 126925

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654174.1\|122760_123837_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-24	35.0
WP_130654175.1\|124092_125115_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	7.9e-27	29.6
WP_130654176.1\|125153_126107_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018246974.1\|126103_126925_+	sugar ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.3e-15	29.0

DBSCAN-SWA_14

133215 : 134295

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654180.1\|133215_134295_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.6e-20	45.2

DBSCAN-SWA_15

138856 : 139642

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654184.1\|138856_139642_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.8e-10	26.9

DBSCAN-SWA_16

143726 : 145259

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654188.1\|143726_145259_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-15	28.7

DBSCAN-SWA_17

150383 : 151298

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654191.1\|150383_151298_-	J domain-containing protein	A0A1V0SF83	Hokovirus	1.0e-09	23.1

DBSCAN-SWA_18

155635 : 163653

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654196.1\|155635_157345_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-10	26.4
WP_105010209.1\|157341_158193_-	ABC transporter permease	NA	NA	NA	NA
WP_130654197.1\|158189_159128_-	ABC transporter permease	NA	NA	NA	NA
WP_130654198.1\|159179_160070_-	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_026188815.1\|160214_161012_+	LuxR family transcriptional regulator	A0A1I9KF49	Aeromonas_phage	1.2e-09	26.6
WP_130654199.1\|161075_161978_+	proline iminopeptidase-family hydrolase	NA	NA	NA	NA
WP_130654200.1\|162510_163653_+	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A0F7LAY0	uncultured_marine_virus	3.9e-14	30.8

DBSCAN-SWA_19

169566 : 172446

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654237.1\|169566_170478_-	acetamidase	A0A1V0S8X7	Catovirus	1.2e-05	27.1
WP_047620560.1\|170711_171329_-	porin family protein	O11861	Bartonella_henselae_phage	3.0e-13	37.4
WP_130654238.1\|171639_172446_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.8e-16	30.6

DBSCAN-SWA_20

181832 : 189192

Trichoplusia_ni_ascovirus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047620578.1\|181832_182654_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.2e-18	31.1
WP_047620556.1\|182650_183910_+	ABC transporter permease	NA	NA	NA	NA
WP_130654210.1\|184036_184765_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-06	29.4
WP_018449031.1\|184808_185573_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-21	34.0
WP_018449032.1\|185750_186146_-	VOC family protein	NA	NA	NA	NA
WP_018449033.1\|186238_186667_-	hypothetical protein	NA	NA	NA	NA
WP_018449034.1\|186786_187386_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_018449035.1\|187459_188488_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	3.1e-07	26.7
WP_018449036.1\|188487_189192_-	response regulator	W8CYM9	Bacillus_phage	2.4e-38	38.1

DBSCAN-SWA_21

194198 : 194435

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246906.1\|194198_194435_+	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	6.7e-06	52.9

DBSCAN-SWA_22

199651 : 200737

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654214.1\|199651_200737_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	4.2e-18	53.9

DBSCAN-SWA_23

220488 : 221253

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246881.1\|220488_221253_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.5e-34	42.6

DBSCAN-SWA_24

229930 : 231445

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166465934.1\|229930_231445_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.3e-21	30.2

DBSCAN-SWA_25

237200 : 237971

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028732415.1\|237200_237971_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.2e-28	32.9

DBSCAN-SWA_26

241502 : 242282

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246857.1\|241502_242282_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.1e-27	37.2

DBSCAN-SWA_27

252094 : 253716

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653970.1\|252094_252844_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-26	37.2
WP_047620511.1\|252819_253716_-	ABC transporter permease subunit	G3M9Y4	Bacillus_virus	2.0e-18	24.8

DBSCAN-SWA_28

257703 : 262604

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653973.1\|257703_259200_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.4e-17	30.5
WP_130653974.1\|259308_260202_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_130654229.1\|260191_260749_-	gluconokinase	NA	NA	NA	NA
WP_130653975.1\|260762_261527_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	8.6e-10	25.4
WP_130653976.1\|261662_262604_+	2-hydroxyacid dehydrogenase	M1H3H9	Paramecium_bursaria_Chlorella_virus	1.0e-12	26.0

DBSCAN-SWA_29

272119 : 273751

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653982.1\|272119_273751_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-19	30.0

DBSCAN-SWA_30

287345 : 291898

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653987.1\|287345_288536_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	3.6e-07	25.9
WP_130653988.1\|288619_289426_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_130653989.1\|289531_291898_+	EAL domain-containing protein	G3MA91	Bacillus_virus	6.3e-19	31.2

DBSCAN-SWA_31

301162 : 304568

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653994.1\|301162_301954_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-32	40.7
WP_128400744.1\|302003_302357_-	allophanate hydrolase	NA	NA	NA	NA
WP_065277314.1\|302349_303018_-	cysteine hydrolase	NA	NA	NA	NA
WP_130653995.1\|303017_304568_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.1e-11	28.0

DBSCAN-SWA_32

311673 : 321118

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654000.1\|311673_312471_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-26	33.2
WP_130654001.1\|312482_313376_-	nitrate ABC transporter permease	NA	NA	NA	NA
WP_130654002.1\|313435_314749_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018246791.1\|315216_316221_-	inorganic phosphate transporter	E5ES24	Ostreococcus_lucimarinus_virus	4.7e-08	30.5
WP_018246790.1\|316220_316865_-	DUF47 domain-containing protein	NA	NA	NA	NA
WP_018246789.1\|316961_317495_+	NUDIX hydrolase	A0A1C3NEZ8	Phage_NCTB	1.5e-08	32.3
WP_130654003.1\|317589_318501_-	ABC transporter permease	NA	NA	NA	NA
WP_047620483.1\|318497_319598_-	ABC transporter permease	NA	NA	NA	NA
WP_130654004.1\|319594_321118_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-21	28.8

DBSCAN-SWA_33

330913 : 333907

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654012.1\|330913_331765_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.3e-19	30.1
WP_130654013.1\|331926_332712_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.9e-14	30.5
WP_130654014.1\|332758_333907_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-24	33.8

DBSCAN-SWA_34

345968 : 347366

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654022.1\|345968_347366_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	7.2e-39	27.6

DBSCAN-SWA_35

353291 : 358020

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028732357.1\|353291_354059_-	3-hydroxyacyl-CoA dehydrogenase	F2NZ40	Diadromus_pulchellus_ascovirus	1.5e-06	27.3
WP_130654026.1\|354189_355224_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_018449167.1\|355267_356413_+	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
WP_130654027.1\|356409_358020_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	6.2e-18	61.1

DBSCAN-SWA_36

362792 : 372264

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654030.1\|362792_364091_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.7e-11	21.0
WP_018246752.1\|364093_364780_-	response regulator	W8CYM9	Bacillus_phage	5.1e-30	32.9
WP_130654031.1\|365014_366088_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_130759815.1\|366087_369234_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.3e-63	23.4
WP_130654033.1\|369829_371251_-	mandelate racemase	NA	NA	NA	NA
WP_130654034.1\|371247_372264_-	hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	6.5e-13	28.5

DBSCAN-SWA_37

375884 : 377992

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032980091.1\|375884_376946_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.1e-18	30.6
WP_018246743.1\|376942_377992_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.9e-05	33.3

DBSCAN-SWA_38

390574 : 391675

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654040.1\|390574_391675_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	8.3e-22	32.4

DBSCAN-SWA_39

396957 : 397974

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246727.1\|396957_397974_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.3e-26	29.6

DBSCAN-SWA_40

404630 : 405608

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113542929.1\|404630_405608_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.2e-24	35.3

DBSCAN-SWA_41

408752 : 409832

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018446103.1\|408752_409832_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-31	39.3

DBSCAN-SWA_42

416437 : 417283

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654052.1\|416437_417283_-	alpha/beta fold hydrolase	A0A1J0GVH7	Mycobacterium_phage	5.2e-08	36.3

DBSCAN-SWA_43

421868 : 423508

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047620429.1\|421868_422657_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-32	36.0
WP_130654054.1\|422653_423508_+	ABC transporter permease subunit	G3M9Y4	Bacillus_virus	2.7e-20	28.1

DBSCAN-SWA_44

435076 : 436852

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654065.1\|435076_436852_-	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-31	37.7

DBSCAN-SWA_45

445313 : 450941

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654072.1\|445313_446546_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.2e-26	44.1
WP_047620416.1\|446556_447009_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_003549481.1\|447091_447856_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_115157797.1\|447880_448945_-	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
WP_130654233.1\|448941_449934_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-18	30.3
WP_018246675.1\|449933_450941_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-12	24.3

DBSCAN-SWA_46

462376 : 463165

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018446148.1\|462376_463165_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-23	37.4

DBSCAN-SWA_47

467123 : 468674

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654077.1\|467123_468674_+	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	3.9e-09	25.7

DBSCAN-SWA_48

477339 : 482883

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246650.1\|477339_478419_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.8e-20	30.3
WP_020493452.1\|478460_479975_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_018246648.1\|480094_480868_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.6e-18	28.4
WP_032980275.1\|480962_481868_-	DMT family transporter	NA	NA	NA	NA
WP_130654078.1\|481953_482883_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.0e-13	24.4

DBSCAN-SWA_49

486751 : 488374

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047620397.1\|486751_488374_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.3e-59	29.7

DBSCAN-SWA_50

498207 : 500202

Acanthamoeba_polyphaga_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654082.1\|498207_500202_-	polysaccharide biosynthesis protein	L7RD47	Acanthamoeba_polyphaga_moumouvirus	1.1e-11	24.3

DBSCAN-SWA_51

507016 : 509161

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654087.1\|507016_509161_-	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	1.9e-38	28.2

DBSCAN-SWA_52

529035 : 533030

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047622238.1\|529035_530253_-	DegT/DnrJ/EryC1/StrS family aminotransferase	A0A2K9L470	Tupanvirus	1.8e-38	32.0
WP_130654093.1\|530249_531221_-	NAD-dependent epimerase/dehydratase family protein	A0A2H4UUK0	Bodo_saltans_virus	2.2e-42	36.1
WP_047622236.1\|531217_531937_-	acyltransferase	NA	NA	NA	NA
WP_047622235.1\|531926_533030_-	DegT/DnrJ/EryC1/StrS family aminotransferase	E5ES42	Bathycoccus_sp._RCC1105_virus	6.1e-49	33.6

DBSCAN-SWA_53

537962 : 539006

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064648744.1\|537962_539006_-	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	1.4e-84	47.2

DBSCAN-SWA_54

542301 : 543303

Brevibacillus_phage(100.0%)

integrase

attL 542186:542212|attR 545558:545584

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
542186:542212	attL	NA	NA	NA	NA
WP_166465938.1\|542301_543303_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	1.1e-12	23.9
WP_166465938.1\|542301_543303_-\|integrase	tyrosine-type recombinase/integrase	S5M9V8	Brevibacillus_phage	1.1e-12	23.9
545558:545584	attR	NA	NA	NA	NA

DBSCAN-SWA_55

549978 : 550929

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654098.1\|549978_550929_+	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	4.1e-09	37.0

DBSCAN-SWA_56

555464 : 557538

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112907995.1\|555464_556568_+	GDP-mannose 4,6-dehydratase	M1IBC3	Acanthocystis_turfacea_Chlorella_virus	1.4e-130	64.2
WP_130654101.1\|556560_557538_+	GDP-L-fucose synthase	R9S8B8	Prochlorococcus_phage	6.5e-95	55.3

DBSCAN-SWA_57

564510 : 565949

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130654105.1\|564510_565230_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-12	27.4
WP_018247089.1\|565229_565949_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.1e-13	31.3

DBSCAN-SWA_58

575753 : 578266

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028732504.1\|575753_577271_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-15	26.5
WP_018247078.1\|577267_578266_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.7e-24	27.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP050110

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3557

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653819.1\|1192_2188_+	plasmid partitioning protein RepB	NA	NA	NA	NA
WP_130748251.1\|2342_3557_+	replication initiation protein RepC	L7TKN6	Rhizobium_phage	3.2e-19	28.9

DBSCAN-SWA_2

8027 : 10553

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653816.1\|8027_10553_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	5.1e-83	36.5

DBSCAN-SWA_3

31966 : 40425

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653812.1\|31966_33865_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.6e-23	28.8
WP_130653959.1\|33956_35765_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-45	28.8
WP_018246246.1\|36039_36657_+	flavodoxin family protein	NA	NA	NA	NA
WP_018246247.1\|37019_38426_+	hypothetical protein	NA	NA	NA	NA
WP_018246248.1\|38496_40425_+	PAS domain-containing hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	1.7e-06	21.1

DBSCAN-SWA_4

58753 : 67646

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246263.1\|58753_60649_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.2e-21	32.7
WP_026188741.1\|60803_62147_-	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_018246265.1\|62601_63939_+	nucleotide sugar dehydrogenase	M1HZW8	Acanthocystis_turfacea_Chlorella_virus	3.8e-37	30.8
WP_026188742.1\|63928_65104_-	DUF3095 domain-containing protein	NA	NA	NA	NA
WP_130653809.1\|65329_65809_+	hypothetical protein	NA	NA	NA	NA
WP_130653808.1\|65855_67646_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.4e-34	27.8

DBSCAN-SWA_5

91024 : 94490

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020572945.1\|91024_91753_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-33	38.6
WP_130653801.1\|91812_92880_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_130653800.1\|92884_93715_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_130653799.1\|93722_94490_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-21	32.8

DBSCAN-SWA_6

117474 : 121034

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653955.1\|117474_119226_-	acetolactate synthase 3 large subunit	E4WLQ6	Ostreococcus_tauri_virus	1.5e-62	31.2
WP_027687751.1\|119418_120024_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_130653781.1\|120080_121034_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.1e-34	33.5

DBSCAN-SWA_7

140013 : 141744

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653765.1\|140013_141744_-	ubiquinone-dependent pyruvate dehydrogenase	E5EQ70	Micromonas_sp._RCC1109_virus	1.4e-31	24.8

DBSCAN-SWA_8

147105 : 155823

IC4_retrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653761.1\|147105_152682_-	AAA family ATPase	Q67624	IC4_retrovirus	3.4e-07	28.5
WP_027687776.1\|153070_154018_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_130653760.1\|154040_155102_+	ABC transporter permease	NA	NA	NA	NA
WP_130653759.1\|155079_155823_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	5.8e-11	26.6

DBSCAN-SWA_9

160933 : 164461

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653753.1\|160933_164461_+	adenylate/guanylate cyclase domain-containing protein	A0A218MLZ2	uncultured_virus	2.0e-13	29.3

DBSCAN-SWA_10

191310 : 201036

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653728.1\|191310_193257_-	PAS domain S-box protein	A0A2K9L0Z8	Tupanvirus	3.3e-05	26.3
WP_130653727.1\|193431_193824_+	DUF983 domain-containing protein	NA	NA	NA	NA
WP_130653726.1\|193835_194270_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_112908861.1\|194545_195376_+	alpha/beta hydrolase	A0A1J0GNR5	Mycobacterium_phage	5.8e-20	29.4
WP_130653725.1\|195567_201036_+	AAA family ATPase	M1I231	Acanthocystis_turfacea_Chlorella_virus	5.6e-10	25.7

DBSCAN-SWA_11

206036 : 206696

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653722.1\|206036_206696_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-31	37.6

DBSCAN-SWA_12

216141 : 216771

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653716.1\|216141_216771_-	J domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	8.3e-11	50.0

DBSCAN-SWA_13

220048 : 221584

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653713.1\|220048_221584_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	3.8e-73	36.3

DBSCAN-SWA_14

226103 : 227801

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653709.1\|226103_227801_+	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	3.8e-26	29.0

DBSCAN-SWA_15

233527 : 235788

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246352.1\|233527_234304_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.6e-30	35.7
WP_130653706.1\|234300_235788_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	9.4e-45	32.9

DBSCAN-SWA_16

241794 : 245656

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653702.1\|241794_243465_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	9.8e-51	31.4
WP_130653701.1\|243760_245656_+	HAMP domain-containing histidine kinase	A0A2K9L0Z8	Tupanvirus	3.4e-07	24.0

DBSCAN-SWA_17

257979 : 258822

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080763963.1\|257979_258822_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	6.8e-08	34.6

DBSCAN-SWA_18

265071 : 266739

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653690.1\|265071_266739_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-16	32.7

DBSCAN-SWA_19

273584 : 275372

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018448444.1\|273584_275372_+	HAMP domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	1.4e-15	31.0

DBSCAN-SWA_20

283467 : 288999

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653949.1\|283467_288999_-	AAA family ATPase	M1I1I7	Paramecium_bursaria_Chlorella_virus	5.1e-11	28.3

DBSCAN-SWA_21

302028 : 302925

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653678.1\|302028_302925_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.8e-12	34.4

DBSCAN-SWA_22

315941 : 321623

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130723514.1\|315941_316862_+	DUF1738 domain-containing protein	A0A1V0EBY3	Caulobacter_phage	2.5e-64	51.4
WP_130653666.1\|316905_317151_-	WGR domain-containing protein	NA	NA	NA	NA
WP_130653665.1\|317248_317377_-	hypothetical protein	NA	NA	NA	NA
WP_130653664.1\|317459_319700_-	EAL domain-containing protein	G3MA91	Bacillus_virus	7.6e-14	32.0
WP_115156824.1\|319824_320637_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-13	32.4
WP_130653663.1\|320633_321623_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-12	29.7

DBSCAN-SWA_23

337202 : 343285

Diadromus_pulchellus_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_027687878.1\|337202_337997_+	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.2e-09	26.7
WP_130653654.1\|338092_340249_+	glycogen debranching protein GlgX	NA	NA	NA	NA
WP_018246433.1\|340257_341265_+	DNA topoisomerase IB	A0A0U2TSJ7	Niemeyer_virus	8.9e-31	29.4
WP_018246434.1\|341261_342140_+	DNA polymerase domain-containing protein	NA	NA	NA	NA
WP_130653653.1\|342262_342988_-	glutathione S-transferase	NA	NA	NA	NA
WP_130653652.1\|342994_343285_-	DUF3175 domain-containing protein	A0A0F6TH17	Sinorhizobium_phage	2.6e-23	60.2

DBSCAN-SWA_24

348110 : 348752

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020493448.1\|348110_348752_-	UdgX family uracil-DNA binding protein	A0A2I6PIA1	Pseudomonas_phage	2.2e-14	34.0

DBSCAN-SWA_25

355494 : 360111

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166465927.1\|355494_360111_+	Ti-type conjugative transfer relaxase TraA	V5UQN3	Mycobacterium_phage	2.3e-17	27.1

DBSCAN-SWA_26

366384 : 381259

Acanthocystis_turfacea_Chlorella_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653939.1\|366384_369063_-	HAD-IC family P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	1.8e-70	28.1
WP_018246458.1\|369288_369612_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_018246459.1\|369640_371503_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.7e-59	29.7
WP_130653938.1\|371499_372321_-	universal stress protein	NA	NA	NA	NA
WP_026188768.1\|372450_372909_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_166465928.1\|372955_373327_+	hypothetical protein	NA	NA	NA	NA
WP_018246462.1\|373337_373748_-	universal stress protein	NA	NA	NA	NA
WP_018246463.1\|373749_374049_-	hypothetical protein	NA	NA	NA	NA
WP_018246464.1\|374195_375197_+	zinc-dependent alcohol dehydrogenase family protein	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	5.9e-19	29.7
WP_018246465.1\|375305_376661_+	PDZ domain-containing protein	W5SAB9	Pithovirus	6.4e-08	27.8
WP_026188770.1\|376785_377433_+	BON domain-containing protein	NA	NA	NA	NA
WP_018246467.1\|377761_379681_-	PAS domain-containing hybrid sensor histidine kinase/response regulator	A0A1V0SGX0	Hokovirus	6.9e-08	18.8
WP_018246468.1\|379658_380393_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_018246469.1\|380515_381259_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.4e-25	31.0

DBSCAN-SWA_27

391362 : 392739

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246480.1\|391362_392739_+	adenylate/guanylate cyclase domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	2.2e-16	26.0

DBSCAN-SWA_28

400635 : 401808

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246491.1\|400635_401808_+	hypothetical protein	A0A0B5JD48	Pandoravirus	2.0e-13	31.6

DBSCAN-SWA_29

404977 : 410378

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246494.1\|404977_406036_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-24	35.0
WP_018246495.1\|406106_406859_+	metallophosphatase	NA	NA	NA	NA
WP_018246496.1\|406966_408199_+	peptidase T	NA	NA	NA	NA
WP_018246497.1\|408236_409073_-	cell wall hydrolase	A0A142EZU6	Stenotrophomonas_phage	1.3e-06	30.7
WP_018246498.1\|409337_410378_-	sulfate/molybdate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-31	38.3

DBSCAN-SWA_30

415080 : 429349

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246504.1\|415080_415773_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.0e-21	31.1
WP_018246505.1\|415769_418478_-	sensor histidine kinase KdpD	Q8QNA2	Ectocarpus_siliculosus_virus	3.8e-12	34.6
WP_130653932.1\|418590_419160_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_018246507.1\|419194_421255_-	potassium-transporting ATPase subunit KdpB	E4ZFI9	Streptococcus_phage	4.2e-35	27.9
WP_018246509.1\|421464_423168_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
WP_003547774.1\|423237_423327_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
WP_130747913.1\|423817_424861_+	NAD(P)-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.4e-08	23.8
WP_018246511.1\|424876_425446_-	DedA family protein	NA	NA	NA	NA
WP_018246512.1\|425476_426838_-	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	6.3e-64	35.0
WP_018246513.1\|426834_427293_-	membrane protein	NA	NA	NA	NA
WP_018246514.1\|427347_428271_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_018246515.1\|428359_429349_+	hypothetical protein	M1H2P4	Paramecium_bursaria_Chlorella_virus	7.0e-12	26.3

DBSCAN-SWA_31

433780 : 439768

Bacillus_virus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018246521.1\|433780_434563_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-14	27.6
WP_130653929.1\|434562_435264_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-13	27.5
WP_018246523.1\|435268_436156_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_018246524.1\|436157_437147_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_026188776.1\|437281_438877_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.5e-56	31.4
WP_018246526.1\|438886_439768_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	4.1e-24	30.2

DBSCAN-SWA_32

444476 : 447941

Amsacta_moorei_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_115156777.1\|444476_446012_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.3e-12	25.8
WP_018448549.1\|446084_447080_-	rhamnose ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_018246533.1\|447128_447941_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.1e-18	28.4

DBSCAN-SWA_33

456510 : 457368

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653925.1\|456510_457368_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.2e-61	46.6

DBSCAN-SWA_34

462221 : 463736

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653922.1\|462221_463736_-\|holin	choline-sulfatase	A0A1V0SA98	Catovirus	7.9e-23	25.6

DBSCAN-SWA_35

468207 : 469907

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_047617922.1\|468207_469107_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-17	31.4
WP_047617924.1\|469103_469907_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-12	26.1

DBSCAN-SWA_36

495801 : 498431

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166465929.1\|495801_497490_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-16	28.0
WP_130653913.1\|497486_498431_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	5.6e-27	29.6

DBSCAN-SWA_37

509323 : 512969

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130653907.1\|509323_509836_+	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	1.2e-18	36.8
WP_130653906.1\|509904_511101_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_130653905.1\|511133_512969_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-17	30.8

DBSCAN-SWA_38

530101 : 531730

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748323.1\|530101_531730_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-25	34.2

DBSCAN-SWA_39

542628 : 543804

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018448635.1\|542628_543804_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.6e-23	35.0

DBSCAN-SWA_40

557865 : 562129

Bodo_saltans_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748314.1\|557865_559887_-	beta-N-acetylhexosaminidase	A0A2H4UUW7	Bodo_saltans_virus	1.2e-05	23.8
WP_130748313.1\|559908_560379_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_018246108.1\|560390_561317_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-16	29.3
WP_113543205.1\|561313_562129_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.2e-13	25.1

DBSCAN-SWA_41

573072 : 580468

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032980998.1\|573072_573828_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	8.2e-21	34.3
WP_018246118.1\|573833_574670_-	5-dehydro-4-deoxy-D-glucuronate isomerase	NA	NA	NA	NA
WP_003548073.1\|575294_575441_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_026231026.1\|575631_576612_-	3'-5' exonuclease	U5Q053	Bacillus_virus	4.6e-08	37.3
WP_130748309.1\|576706_578086_-	sensor histidine kinase	NA	NA	NA	NA
WP_130748308.1\|578082_578757_-	response regulator transcription factor	NA	NA	NA	NA
WP_130748307.1\|578881_579481_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_130748306.1\|579577_580468_-	haloalkane dehalogenase	B9U1C3	Vaccinia_virus	4.0e-43	34.6

DBSCAN-SWA_42

590264 : 590474

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003548109.1\|590264_590474_+	cold-shock protein	A0A218MMZ6	uncultured_virus	8.9e-10	54.7

DBSCAN-SWA_43

599752 : 600637

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748300.1\|599752_600637_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	3.4e-10	39.3

DBSCAN-SWA_44

604295 : 605204

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112908747.1\|604295_605204_-	glutamine amidotransferase family protein	F2Y1G4	Organic_Lake_phycodnavirus	1.1e-06	29.2

DBSCAN-SWA_45

614125 : 617762

Halovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748296.1\|614125_615682_+	RNA-binding protein	R4TL80	Halovirus	4.7e-31	25.7
WP_047618088.1\|616355_617762_+	RtcB family protein	L7TNL0	Rhizobium_phage	3.2e-127	50.6

DBSCAN-SWA_46

637521 : 638292

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748333.1\|637521_638292_+	glucose 1-dehydrogenase	A0A0N9R355	Chrysochromulina_ericina_virus	2.8e-08	23.8

DBSCAN-SWA_47

650708 : 654438

Yaba_monkey_tumor_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130748278.1\|650708_651893_-	serpin family protein	Q6TUM5	Yaba_monkey_tumor_virus	5.8e-13	26.5
WP_130748277.1\|651906_654438_-\|protease	trypsin-like serine protease	Q6JKF3	Neodiprion_sertifer_nucleopolyhedrovirus	3.0e-27	33.4

DBSCAN-SWA_48

670019 : 670424

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112908785.1\|670019_670424_+	helix-turn-helix transcriptional regulator	Q8W6G2	Sinorhizobium_phage	5.9e-18	44.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP050108

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050108_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050108_1

1091062-1091148

Orphan

Consensus_repeat	Method
TGCGCAATTCCGGACGCAAAACCGCTACACA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050108_1

>merge|NZ_CP050108|1|1091062-1091148|CRISPRCasFinder
TGCGCAATTCCGGACGCAAAACCGCTACACAGTTTCGCTGGAATTGCTCTTGTTTCTGCGCAATTCCGAACGCAAAACCGCTACACA

>NZ_CP050108|1|1|1091062-1091148|CRISPRCasFinder
TGCGCAATTCCGGACGCAAAACCGCTACACA	GTTTCGCTGGAATTGCTCTTGTTTC
TGCGCAATTCCGAACGCAAAACCGCTACACA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050108.1\|WP_130652334.1\|1090063_1090999_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293806
NZ_CP050108.1\|WP_112906557.1\|1095963_1097400_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|381169
NZ_CP050108.1\|WP_130652331.1\|1093967_1095638_-\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
NZ_CP050108.1\|WP_018241933.1\|1086803_1087004_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_018241935.1\|1086024_1086228_-\|CsbD-family-protein	unknown	unknown	gnl\|CDD\|225777
NZ_CP050108.1\|WP_018241928.1\|1093444_1093957_-\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|226272
NZ_CP050108.1\|WP_130652336.1\|1082820_1083558_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_003539403.1\|1100556_1100799_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP050108.1\|WP_130652328.1\|1099153_1100479_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP050108.1\|WP_018241932.1\|1089071_1089821_+\|cytochrome-c-biogenesis-protein-CcdA	unknown	unknown	gnl\|CDD\|223856
NZ_CP050108.1\|WP_165403088.1\|1085409_1085580_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_130652330.1\|1097668_1098256_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|223663
NZ_CP050108.1\|WP_018445435.1\|1087834_1088458_+\|porin-family-protein	unknown	unknown	gnl\|CDD\|226163
NZ_CP050108.1\|WP_130652335.1\|1083577_1085071_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235870
NZ_CP050108.1\|WP_130652329.1\|1098276_1099122_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
NZ_CP050108.1\|WP_130652333.1\|1091213_1092176_+\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
NZ_CP050108.1\|WP_011651871.1\|1095646_1095961_-\|DUF2849-domain-containing-protein	unknown	unknown	gnl\|CDD\|371340
NZ_CP050108.1\|WP_130652332.1\|1092143_1093355_-\|UbiH/UbiF-family-hydroxylase	unknown	unknown	gnl\|CDD\|181001
NZ_CP050108.1\|WP_018445432.1\|1085725_1085953_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_018241934.1\|1086483_1086678_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP050108.1\|WP_130652334.1\|1090063_1090999_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293806	cd07720, OPHC2-like_MBL-fold, Pseudomonas pseudoalcaligenes organophosphorus hydrolase C2, and related proteins; MBL-fold metallo hydrolase domain. Pseudomonas pseudoalcaligenes OPHC2 is a thermostable organophosphorus hydrolase which a broad substrate activity spectrum: it hydrolyzes various phosphotriesters, esters, and a lactone. This subgroup also includes Pseudomonas oleovorans PoOPH which exhibits high lactonase and esterase activities, and latent PTE activity. However, double mutations His250Ile/Ile263Trp switch PoOPH into an efficient and thermostable PTE. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.79819e-86
NZ_CP050108.1\|WP_112906557.1\|1095963_1097400_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|381169	cd11642, SUMT, Uroporphyrin-III C-methyltransferase (also known as S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT). SUMT is an enzyme of the cobalamin and siroheme biosynthetic pathway. It catalyzes the first of three steps leading to the formation of siroheme from uroporphyrinogen III; it transfers two methyl groups from S-adenosyl-L-methionine to the C-2 and C-7 atoms of uroporphyrinogen III to yield precorrin-2 via the intermediate formation of precorrin-1. Precorrin-2 is also a precursor for the biosynthesis of vitamin B12, coenzyme F430, siroheme and heme d1. This family includes proteins in which the SUMT domain is fused to other functional domains, such as to a uroporphyrinogen-III synthase domain to form bifunctional uroporphyrinogen-III methylase/uroporphyrinogen-III synthase, or to a dual function dehydrogenase-chelatase domain, as in the case of the multifunctional S-adenosyl-L-methionine (SAM)-dependent bismethyltransferase/dehydrogenase/ferrochelatase CysG, which catalyzes all three steps that transform uroporphyrinogen III into siroheme.	1.16279e-108
NZ_CP050108.1\|WP_130652335.1\|1083577_1085071_-\|hypothetical-protein	gnl\|CDD\|235870	PRK06834, PRK06834, hypothetical protein; Provisional.	0
NZ_CP050108.1\|WP_018241935.1\|1086024_1086228_-\|CsbD-family-protein	gnl\|CDD\|225777	COG3237, COG3237, Uncharacterized protein conserved in bacteria [Function unknown].	1.10016e-19
NZ_CP050108.1\|WP_018241928.1\|1093444_1093957_-\|DUF934-domain-containing-protein	gnl\|CDD\|226272	COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown].	7.4932e-62
NZ_CP050108.1\|WP_130652329.1\|1098276_1099122_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	2.51643e-151
NZ_CP050108.1\|WP_130652328.1\|1099153_1100479_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	2.72251e-173
NZ_CP050108.1\|WP_018241932.1\|1089071_1089821_+\|cytochrome-c-biogenesis-protein-CcdA	gnl\|CDD\|223856	COG0785, CcdA, Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones].	1.48552e-47
NZ_CP050108.1\|WP_130652330.1\|1097668_1098256_+\|nucleoside-deaminase	gnl\|CDD\|223663	COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis].	1.1276e-35
NZ_CP050108.1\|WP_130652331.1\|1093967_1095638_-\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
NZ_CP050108.1\|WP_003539403.1\|1100556_1100799_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	9.6229e-50
NZ_CP050108.1\|WP_130652333.1\|1091213_1092176_+\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	4.97788e-57
NZ_CP050108.1\|WP_011651871.1\|1095646_1095961_-\|DUF2849-domain-containing-protein	gnl\|CDD\|371340	pfam11011, DUF2849, Protein of unknown function (DUF2849). This bacterial family of proteins has no known function.	4.18174e-31
NZ_CP050108.1\|WP_130652332.1\|1092143_1093355_-\|UbiH/UbiF-family-hydroxylase	gnl\|CDD\|181001	PRK07494, PRK07494, UbiH/UbiF family hydroxylase.	0
NZ_CP050108.1\|WP_018445435.1\|1087834_1088458_+\|porin-family-protein	gnl\|CDD\|226163	COG3637, COG3637, Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane].	2.00587e-28

>NZ_CP050108.1|WP_130652334.1|1090063_1090999_+|MBL-fold-metallo-hydrolase
MNLETKTSRENTAHTGRPRLDELVPSRYAVRVGEIEVLVVSDGVLPLPTAMLGHNIDPSVRATWLKDMFLPADAFDWALNVVVVRSGDQTILLDAGLGIDPDLHLPRAGQLIKRLEAAGIDLASVTDVVLTHMHMDHIGGLLVDGVKDQLRPDLRIHVAAAEVKFWEAPDFSRVSMPPGFPDALRATAKRFAKEYRSHFRLFDDEYEVAPGVVVHRTGGHTPGHSVIRLASGGDRLMFAGDAVFAVGFEHPDWYNGFEHDPEEAARVRVRLLRELAETGEQLVATHLPFPSVGRVAVDGDAFRWVAAFWDY
>NZ_CP050108.1|WP_018241932.1|1089071_1089821_+|cytochrome-c-biogenesis-protein-CcdA
MSIADISLWSALIAGALSFLSPCVLPLVPPYLCYMAGISVEQFRGGGAVVVAPDVRRGVFFSALFFTLGFATVFVALGAGASSIGMALRQHLDLLSKIGGLIIIVMGLNFLGLFRIGVLAREARFQGSGKPATLTGAYIMGLAFAFGWTPCIGPVLGAILGVAASRETVGSGAGLLAIYSLGLAIPFWIAAGFSGAFMRFLSRFRRHLGTVEKVMGLFLVLTGLAFLFGWVSNVAIWFQQTFPILMQIG
>NZ_CP050108.1|WP_018445435.1|1087834_1088458_+|porin-family-protein
MKLTIATTFLALFTTTALAADAVQDIPAAPVAAAPVFTWSGPYFGIDGGAGWLNGDFSVGGASASEDFNGGVFGGFAGYNFQFDNVVVGIEGNLEHNWNEKDALGADIGTDWSGAVRGRVGYAFDKALIYGAAGWTATRGYVDVPGFDKETETFNGYTVGGGVDFAITNNIFARGEYRFNDFGEKDILGVDVDLDQHELKFGVGVKF
>NZ_CP050108.1|WP_018241933.1|1086803_1087004_+|hypothetical-protein
MIRSQIADAQTVLGDEEVALCQRVFDHVISVRQITTDTEREDLAQRVIHSYQHGVKDEGALLRLLI
>NZ_CP050108.1|WP_018241934.1|1086483_1086678_+|hypothetical-protein
MALDVFVNLYNLGGLDALNVSLRSLSDDERLGTLLSLEKIGYEVIWNAQRKPASAYVWSGPNEN
>NZ_CP050108.1|WP_018241935.1|1086024_1086228_-|CsbD-family-protein
MDWNRIEGNWKQAKGKIKEQWGKLTDDDLDQIAGKRDQLEGKIQERYGIEKDRIRRDIDDWTGRQTW
>NZ_CP050108.1|WP_018445432.1|1085725_1085953_+|hypothetical-protein
MWAILTGAALIIGGLLFLFTSALGRRPSDPHQMPQGGTTLEPRRQGLRFLGITKNWPALAVIAIGALLLAFGGYS
>NZ_CP050108.1|WP_165403088.1|1085409_1085580_-|hypothetical-protein
MDKTPKTAIRGMMLYVLALLVLGVLAGAVYTIYGHPADPSERPAAETILQKAPAPQ
>NZ_CP050108.1|WP_130652335.1|1083577_1085071_-|hypothetical-protein
MREHAVVVAGAGPTGLMLAGELALAGVDVAIVERRPDQKLAGTRAGGLSARTLEVLDQRGIVDRFLAEGQIAQVTGFAVTRLDISDFPTRHNYGLALRQKHIERILAGWVGELAVPIYRSLEVTGFAQDDTGVTIELSDGSQLRAGYLVGCDGGRSLVRKAAGIAFEGWDPTTSNILAEVEMEEEPPLGIHRTALGIYAFGREEYEIHDGKIVFAQEGPIGVMVPEKNAGATTEPTLGDLREALIAAFGTDYGLHRVNWISRFTDMSRQATAYRKGRLFLAGDAAHVHSPVGGQGLNTGVQDAVNLGWKLAQVVKGTSPETLLDTYHAERHPVAARVLRTTMAQVALQRTDDRTEVLRDIVTELLGMEEPRKRIAAEMSGLGIHYDLGDGHPLLGRRMPDLDLVTSDGPVRVFTLLQDARPVLLNLGTPGSIGLPRWSDRIRLVDAGYAGAWELPALGVVSAPAALLIRPDGYVAWVGDGTEDGLQEAVNTWFGPSG
>NZ_CP050108.1|WP_130652336.1|1082820_1083558_+|hypothetical-protein
MACLVSADEATQSEKPAVKADRPDGLTRDVAAIKVGDCLLGYKAVQRRMRASRWNHFRGRMREIEKLIRHRHGNIVPEADDALIYVEVIASLALVEFKEEFVDVVLGWATRWLPWAGKAEIEEVIYERTKLRFSPLSADALGHALHLSYAERSALDIRTIGAFDVPTRKRTKLQKEKRRQRDRARKEEQRRAAGALSRADYLANSFSQVRPWEAFGISRRTWERRGKPMPDPETISDCGSISLAA
>NZ_CP050108.1|WP_130652333.1|1091213_1092176_+|AEC-family-transporter
MADIVSLLLPFFGLILIGYIAAKATKQPAEALGWLNTFIIYAALPALFFKLVSRTPIEELTRVDFIVTDIAATYAVFILLFVIGRLVRGNSLADCTIQSFAGAYGNIGYMGPGLALLALGEGAAVPVALIICFENALHFIVAPALMAAAGDDKRSTGQLVADIVRKVALHPFILSTAAGFVVAALHIDQPPAFQRLVDYLAQAAAPCALFAMGVTLALRPLKRIPAEISYIVPAKLILHPIAVFIALTAVGGFEPVWIQAAVLLACLPTATNVFVIGQQYGVWQERASATILITTVLSVVTVSLWLIVIRSGLLPLQLFP
>NZ_CP050108.1|WP_130652332.1|1092143_1093355_-|UbiH/UbiF-family-hydroxylase
MKTFEVAVIGGGLAGMIAAIALARGGRSVALVAPVAPKEDRRTTALMDQSIRFLDRLALWEKLRPAAAPLTSMRIVDGTDRLLRAPTTTFRAAEVGLDAFGYNFPNKALTGILEEAAAGEGNITRFTDMAESIEISAVSVSITLTGGETLSADFAVGADGRGSKLRETSGITVRNWSYPQSAMVLNFAHSLPHQNISTEFHTKHGPFTQVPLPGSRSSLVWVQDPAEAASRMELPLAELGALVEARMQSMLGKVDVEEGVQVWPLSGMMAHRFGKGRIALIGEAAHVFPPIGAQGLNLSLRDIMALADILCDRAELPVPADAGESFDRRRRADIMTRTASVDILNRSLLSDFLPVQMLRAAGLHILSAIPPLRNIVMREGIEPGRGFRDIPEALREKLKRKKA
>NZ_CP050108.1|WP_018241928.1|1093444_1093957_-|DUF934-domain-containing-protein
MTKIWRETGFVENDPWVIETDEVKATEEQKPLLGLDELIAKADESNDVGLGVLIKPADDVRRLEPYLYRLEIVAVAFPAFNDGRAFSHASLLRQRLGYTNELRAVGDVLIDQVPLMLRVGIDSFSVTNATALKRLGENRLPAIPHHYQPAVRDAEAGKGYSWRRQAKPAA
>NZ_CP050108.1|WP_130652331.1|1093967_1095638_-|nitrite/sulfite-reductase
MYRYDEFDHAFVTERVEQFRDQVERRLSGELAEDAFKPLRLMNGVYLQLHAYMLRIAIPYGTLSSRQLRMLAHIARTYDRGYGHFTTRQNLQFNWPKLSDIPDALANLASVEMHALQTSGNCIRNVTADHFAGAAADEIADPRPYAEILRQWSSVHPEFSFLPRKFKIAVTGAERDRAAIQVHDIGLHVKTNDKGEIGFAVYVGGGQGRTPMIAKLIRDFLPEEDLLSYTTAIVRVYNLHGRRDNKYKARIKILVHETGTEELTRQVEAEFAALKDTELKLPEKDVQSIAAYFAPPDLPERAEGWENLARWKKADSGFSRWVQQNVQPHKNPDYGMVTISLKPIGGIPGDASDAQMDAIADLAEEYAFDEIRVSHEQNLILPHVALADLEAVYRGLVAINLAEANAGLITDIIACPGLDYCALANARSIPLAQEISRRFGDAERQAEIGELKIKISGCINACGHHHVGHIGLLGVEKKGAELYQITLGGSGDEHTSIGEIIGRGFEPDRVTDAIETIVDTYLGLRLDQSENFLAAYRRVGPQPFKTALYGSAAEAA
>NZ_CP050108.1|WP_011651871.1|1095646_1095961_-|DUF2849-domain-containing-protein
MGDKVLTANRLTDGIAVWLDANGKWSTSLQEALVARHAEAVAALEAIGKKSYADNEVVDVAVVDVQETNGILWPLRLRERIRAQGPTMEYAPGYAPADPEFIAV
>NZ_CP050108.1|WP_112906557.1|1095963_1097400_-|uroporphyrinogen-III-C-methyltransferase
MPPKTEQLSVFPAFFRVEGQKTAVFGNGDEAFAKVRLLLNTKARIVAYADRPEADYHAFLIANRIETVRAAFSAEQVEGSALVFAATGNEADDRSIVDAARAARIPANAVDQPDYCDFFTPALVNRAPVAVAIGTEGAGPVLAQMIRAQIDQLLSPSLGRLAGLATSYRKAVDQLIPRGVSRRVFWRRFFSGAVADAVANGNLPQARHAADRLLHAMDKVAGHVWLVGAGPGAEDLLTLRAQRVMMEADVIVYDALVPQAIVDMGRRDAERLSVGKRKGCHSKSQEEINDLLVDLGRQGKRVVRLKSGDPLVYGRAGEEMAALRAAGITYEVVPGITSAFAAAADFELPLTLRGVASSLVFTTGHDLTGDVLPDWASLAVSGATIAVYMGRTVAASVAERLMQAGIPAETTVAVIENASRADRRLLHGTLADLPDLQHRDELTGPVMVIIGDAVAGANFELSEPLVRANARLEELARS
>NZ_CP050108.1|WP_130652330.1|1097668_1098256_+|nucleoside-deaminase
MPDKTIASRLLSVMEDDILPLTERGVSLGNKVFGAAILRKSDLSLVVAETNNELENPLWHGEVHTLKRFYELGDKPPTKDLIFLSTHEPCTMCVSAITWAGFDNFYYFFSHEDSRDAFAIPHDLKILKEVFGLEPGGYRRQNAFWNSFAVADLVETEEAPLKTALKTQTARIKARYDALSTSYQSSKSANDIPLN
>NZ_CP050108.1|WP_130652329.1|1098276_1099122_+|nucleoside-triphosphate-pyrophosphohydrolase
MQPSKDISRLIEIMAALRHPETGCPWDIVQNFETIKPYTIEEAYEVSDAIERGDMDDLCDELGDLLLQVVFHARMAEEAGEFSFGDVVNAITAKMIRRHPHVFARSAADTPDAVKIQWDEIKQAEKRERAERRSRRGITEDVNSGFLGSVQRSFPALTEALKLQERAAKVGFDWSAPEPILDKIEEEIGELRAALREGDQAKVSDELGDLIFAVVNIGRHVKADPEQAVRGTNTKFRRRFSHIEQVLEAEGETLKDATLERMEEIWQAAKAIERAVTSGAE
>NZ_CP050108.1|WP_130652328.1|1099153_1100479_-|GTPase-HflX
MRATVVVPVLKSRSRGGQSESASTRTPESRLEEATGLAQAIDLDVVNGQIVPVNDPRPATLLGTGKIEEIKALLDERDSGLVIVDHPLTPVQQRNLEKEWNAKVIDRTGLILEIFGRRASTKEGTLQVDLAHLNYQKGRLVRSWTHLERQRGGGGFMGGPGETQIEADRRMLQDRIIKLERELEQVVRTRQLHRAKRRKVPHPIVALVGYTNAGKSTLFNRITGAGVLAEDMLFATLDPTLRRMKLPHGRTVILSDTVGFISDLPTHLVAAFRATLEEVLEADLILHVRDMSDADNQAQSSDVMRILNDLGIDEAEAEKRLIEVWNKIDRLEPEVHDAMVQKSAGASNVVAVSAVSGEGVDTLMEEISRRLSGVMTVATIRLPVDKLALLPWLYDHAIVDGREDNEDGTITLDLRLSETEATELERRIGIGPKSSKEDWER
>NZ_CP050108.1|WP_003539403.1|1100556_1100799_-|RNA-chaperone-Hfq
MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHAISTIMPGQPMQMFESEEAAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050108_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050108_2

2254079-2254158

Orphan

Consensus_repeat	Method
AAAACCGCTCACACTTTCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050108_2

>merge|NZ_CP050108|2|2254079-2254158|CRISPRCasFinder
AAAACCGCTCACACTTTCCGGCACCATGCTTTAATAGTGGGAGCATGATGTTGCCCGAAAACCGCTCACACTTTTCGGCA

>NZ_CP050108|2|2|2254079-2254158|CRISPRCasFinder
AAAACCGCTCACACTTTCCGGCA	CCATGCTTTAATAGTGGGAGCATGATGTTGCCCG
AAAACCGCTCACACTTTTCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050108.1\|WP_130651829.1\|2252138_2252906_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP050108.1\|WP_130651826.1\|2258455_2259454_-\|DUF4424-domain-containing-protein	unknown	unknown	gnl\|CDD\|373054
NZ_CP050108.1\|WP_033181432.1\|2250860_2251796_+\|histone-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|212541
NZ_CP050108.1\|WP_003545921.1\|2251798_2252050_+\|exodeoxyribonuclease-VII-small-subunit	unknown	unknown	gnl\|CDD\|179195
NZ_CP050108.1\|WP_130651831.1\|2245839_2247384_-\|methionine--tRNA-ligase	unknown	unknown	gnl\|CDD\|237012
NZ_CP050108.1\|WP_130651827.1\|2254261_2256178_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|224076
NZ_CP050108.1\|WP_130651833.1\|2244184_2245324_+\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP050108.1\|WP_113541714.1\|2266514_2267000_-\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573
NZ_CP050108.1\|WP_003556974.1\|2265425_2266421_+\|transporter	unknown	unknown	gnl\|CDD\|213368
NZ_CP050108.1\|WP_018245058.1\|2250175_2250577_-\|thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP050108.1\|WP_130651824.1\|2260329_2261580_+\|class-I-SAM-dependent-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|225174
NZ_CP050108.1\|WP_131631091.1\|2263438_2265217_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
NZ_CP050108.1\|WP_018449333.1\|2262673_2263429_-\|crotonase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|168351
NZ_CP050108.1\|WP_028734891.1\|2256298_2258236_-\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP050108.1\|WP_130651825.1\|2259586_2260333_+\|TlyA-family-RNA-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP050108.1\|WP_047622012.1\|2243396_2244185_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP050108.1\|WP_130651830.1\|2249526_2250138_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379265
NZ_CP050108.1\|WP_130651832.1\|2245450_2245672_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|215598
NZ_CP050108.1\|WP_130651828.1\|2253115_2254039_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_CP050108.1\|WP_130651823.1\|2261582_2262593_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|293841

Protein	Function_ID	Function_description	E-value
NZ_CP050108.1\|WP_130651829.1\|2252138_2252906_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.85445e-69
NZ_CP050108.1\|WP_130651826.1\|2258455_2259454_-\|DUF4424-domain-containing-protein	gnl\|CDD\|373054	pfam14415, DUF4424, Domain of unknown function (DUF4424). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 310 and 361 amino acids in length.	1.01362e-129
NZ_CP050108.1\|WP_033181432.1\|2250860_2251796_+\|histone-deacetylase-family-protein	gnl\|CDD\|212541	cd11599, HDAC_classII_2, Histone deacetylases and histone-like deacetylases, classII. This subfamily includes eukaryotic as well as bacterial Class II histone deacetylase (HDAC) and related proteins. Deacetylases of class II are Zn-dependent enzymes that catalyze hydrolysis of N(6)-acetyl-lysine residues of histones (EC 3.5.1.98) and possibly other proteins to yield deacetylated histones/other proteins. In D. discoideum, where four homologs (HdaA, HdaB, HdaC, HdaD) have been identified, HDAC activity is important for regulating the timing of gene expression during development. Also, inhibition of HDAC activity by trichostatin A is shown to cause hyperacetylation of the histone and a delay in cell aggregation and differentiation.	2.02215e-156
NZ_CP050108.1\|WP_003545921.1\|2251798_2252050_+\|exodeoxyribonuclease-VII-small-subunit	gnl\|CDD\|179195	PRK00977, PRK00977, exodeoxyribonuclease VII small subunit; Provisional.	6.83197e-24
NZ_CP050108.1\|WP_130651831.1\|2245839_2247384_-\|methionine--tRNA-ligase	gnl\|CDD\|237012	PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed.	2.69791e-176
NZ_CP050108.1\|WP_130651827.1\|2254261_2256178_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|224076	COG1154, Dxs, Deoxyxylulose-5-phosphate synthase [Coenzyme metabolism / Lipid metabolism].	0
NZ_CP050108.1\|WP_130651833.1\|2244184_2245324_+\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	6.21834e-42
NZ_CP050108.1\|WP_113541714.1\|2266514_2267000_-\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	1.62858e-10
NZ_CP050108.1\|WP_003556974.1\|2265425_2266421_+\|transporter	gnl\|CDD\|213368	cd12834, ZntB_u1, Uncharacterized bacterial subgroup of the Salmonella typhimurium Zn2+ transporter ZntB-like subfamily. The MIT superfamily of essential membrane proteins is involved in transporting divalent cations (uptake or efflux) across membranes. The ZntB-like subfamily includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	1.40768e-112
NZ_CP050108.1\|WP_018245058.1\|2250175_2250577_-\|thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	1.95552e-13
NZ_CP050108.1\|WP_130651824.1\|2260329_2261580_+\|class-I-SAM-dependent-RNA-methyltransferase	gnl\|CDD\|225174	COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis].	4.46846e-121
NZ_CP050108.1\|WP_131631091.1\|2263438_2265217_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	3.56108e-148
NZ_CP050108.1\|WP_018449333.1\|2262673_2263429_-\|crotonase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|168351	PRK06023, PRK06023, crotonase/enoyl-CoA hydratase family protein.	4.40649e-161
NZ_CP050108.1\|WP_028734891.1\|2256298_2258236_-\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	1.48835e-68
NZ_CP050108.1\|WP_130651825.1\|2259586_2260333_+\|TlyA-family-RNA-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	6.05777e-116
NZ_CP050108.1\|WP_047622012.1\|2243396_2244185_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.64361e-34
NZ_CP050108.1\|WP_130651830.1\|2249526_2250138_+\|hypothetical-protein	gnl\|CDD\|379265	pfam13563, 2_5_RNA_ligase2, 2'-5' RNA ligase superfamily. This family contains proteins related to pfam02834. These proteins are likely to be enzymes, but they may not share the RNA ligase activity.	0.000314041
NZ_CP050108.1\|WP_130651832.1\|2245450_2245672_-\|hypothetical-protein	gnl\|CDD\|215598	PLN03138, PLN03138, Protein TOC75; Provisional.	0.00235937
NZ_CP050108.1\|WP_130651828.1\|2253115_2254039_+\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	3.47928e-104
NZ_CP050108.1\|WP_130651823.1\|2261582_2262593_+\|hypothetical-protein	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.81841e-75

>NZ_CP050108.1|WP_130651828.1|2253115_2254039_+|pirin-family-protein
MSFFPGKDPLPGDAFACDAIENLIIPRTSDIGGFQVRRALPSRQRRLVGPFIFFDRMGPAILKPDEALDVKPHPHIGLSTVTYLFDGEIRHRDSLGTEKVIRPGDINLMTAGRGIVHSERTPDNLRGHPLLMSGLQTWLALPDDKEEIDPSFAHTEKSAMPLIETAGVRGRVVIGSFEGMTSPVGVFSDTLYVDLDLQPGAKFPFGAGHEERAVYVLSGEVVISGDRFAADQLLVFRPGDAITLEAGRDGCHLMLIGGAALNSKRYIWWNFVSSSKERIEQAKEEWRTGRFDIVPGDEEEFVPLPEG
>NZ_CP050108.1|WP_130651829.1|2252138_2252906_+|SDR-family-oxidoreductase
MTGRLKGKVAIISGGATGMGGAASKLFAAEGARVAIIDRNGDAAAETVQAIRDAGGEAEYWTADVSDEAAVIAAVAGVEERYGAVTVLFNHAGTIVIKPFLETTLQEWDWLHAVNVRSMFLMTKAVLPKMIASGGGSIVCTSSISAVAATPMEVLYDTTKGAVHMFARAIAVEFRDRNIRCNAVCPGFIRTPHGLREVADLQALGVDVSDAAIAAQQGRIGEPEDVARAALYLASDESSFVNGAHLFVDNGFTAI
>NZ_CP050108.1|WP_003545921.1|2251798_2252050_+|exodeoxyribonuclease-VII-small-subunit
MTDSAKPEVSGLSFEKAVAELESIVARLERGDVALDESIEIYERGEALKKHCETLLSAAENRIEKIRLDRAGKPQGVEPLDGA
>NZ_CP050108.1|WP_033181432.1|2250860_2251796_+|histone-deacetylase-family-protein
MSTRLYEHPIFLEHVTPAGHPERSDRIRAINVALEHPNFERLERRQAPQANEDAVLLAHPEEHLIAVMREIPEEEGEINQIEADTYASSKSLQAALTGIGGAMAAVDDVFTGRADNVFVAARPPGHHAEKMTAMGFCFFNNAAIAARHAQKTHGAERIAIVDWDVHHGNGTQDIFWDDASVLFCSTHQMPLYPGTGAKDEKGTHNTIVNAPLSPNVGSDHFREAFKSRVLPALDDFRPDLIIISAGFDAHHRDPLAQINLTGEDFDWATGRVLELADRYAKNRVVSLLEGGYDLEGLAESAGMHILRMMKG
>NZ_CP050108.1|WP_018245058.1|2250175_2250577_-|thioesterase
MSQSKRPDVAEIRVPFRDVDMTGQMFLASYISYAESVLASFWSSRPDVDDEPVYSPSKVSCMLHRPLHYDELATFTATVDKIGMHSIGLLVAIDTGEERAAEVEIIWQARTREDQSPASLPEETRDWLYRFLD
>NZ_CP050108.1|WP_130651830.1|2249526_2250138_+|hypothetical-protein
MIRTKVDTLWFKQCCAFHLQFFPDGEALSKLCNLQDRIERDSDAPLSRVPAKSLHMTVVTLVNAAAQFSIPNDEVWKLNGERWKEIVERLVEETPPFELHFHEVAASEAAVFVKAEEPAELRRLRSAISHAICFEQWRPTPPRIAHITLFRFFAEDRLPAVNFDAGLLPTGVKVGSLKLLEERVYPSVEINILSEPLLRGKST
>NZ_CP050108.1|WP_130651831.1|2245839_2247384_-|methionine--tRNA-ligase
MNKIYITTSIPYVNAAPHVGFALELIQADAYARHFRLLGHDVRFQCGTDDNSLKNVRSAEAAGQEVRDFVNANADRFERLGGLLDISNEEFVRTSRDPRHIACVHALWRACAENGDLYRKAYEGLYCVGCEQFYEPSELDDGRCPEHGIALETIREENWFFRLSRYGDRLLELVETGELRIVPAHRRNEVLALLRRGLSDISVSRSAERARGWGVPVPDGDEVVYVWFDALANYLTGLSHGSDPTLLQHYWNGGQRIHVVGKGISKFHAIYWPAILLSAGLPPPSSILVHGYVTVDGRKIGKSAGNGIDPERIIQSYETPDALRYYLLRHIRSGDDGDFSAERLEAAWSGELAGQLGNLANRVLALLSTSFNGIVPPVPDSELVEAAARLPEKVARAFAAYELHVGLADIFEFIGAANRRFAQRAPWADAKALLADLTPDDRKATATRLGTSLAEQVHGLAIIARCLLPFLPSSAAKLHSRLGIPSPRLYRDPLIVAGVKAAPQAVLFPQRAAA
>NZ_CP050108.1|WP_130651832.1|2245450_2245672_-|hypothetical-protein
METFLVVTVLVGGFALIFALIARAERGATTQTTANTKRRWGNSEGSGDGGGGWFDASGDGGCDGGGGDGGGGD
>NZ_CP050108.1|WP_130651833.1|2244184_2245324_+|PAS-domain-containing-sensor-histidine-kinase
MSGPDTQISMPAEDLEDLYENAPCGYLSLQPDGRIAKVNKTLSTWIGIPAEQLLGKRLHDLLNTSGRIFYETHFAPLLRMQGFFNEVALDLMAADGRKLPVLANAMERRAEDGALLFTRVTMFQAAERRRYERELVEARAAADTAGAIVKSQLDFEQQTAELREQFIAILGHDLRNPLASIAAAGRMLRKEEQTDRSTKVLDLMQGSVVRMSGLIDNVLDFARARLGGGIVLDRRAEEVEPILRQVIEELRYSHLDRRIEVSIELDGPISCDSSRIGQLVSNLLGNALTHGTPDEPVRLSAATVDGRLELWIANGGAPISSDAMTRLFQPFFKGEAGTSQRGLGLGLYIASEIARAHGGAITVSSGDNETRFTFVMPLD
>NZ_CP050108.1|WP_047622012.1|2243396_2244185_+|alpha/beta-hydrolase
MTVIDRNHVQVRGDGQRAMIFSHGFGCDQNMWRFVAPAFEGDFKTVLFDHVGAGRSDLTAYDAGKYSSLSGYADDLVEICRALGLTQTVFVGHSVSAMIGVIASLKAPDLFESLILVGPSPRYTNDDDYIGGFSATEIDELLTSLDDNHLGWSAAMAPAIMGNPDRPELSEELTNSFCRTDPEIAKAFARVTFTSDNRRDLPRVTARTLILQCRDDIIASEEVGEYVHQQVPNSQLVVLNASGHCPNLSAPDEVISAIRRFV
>NZ_CP050108.1|WP_130651827.1|2254261_2256178_+|1-deoxy-D-xylulose-5-phosphate-synthase
MTQLPKTPLLDQVIYPADLRKLEDRDLPQLAREVRDEMIDAVSRTGGHLGAGLGVVELTIAIHSVFDTPDDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAIAADLDKSDRRVIAVIGDGAMSAGMAYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKNIDRAITRAVEHARGYVTGGTMFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNGRGPVLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQARVKPNAPSYTSVFAEALVQEAALDDKIVGITAAMPNGTGLDKLAEAFPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYSTFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTAFLTTLPGFVVMAAADEAELKHMVRTAVAYDGGPISFRYPRGEGVGVDIPARGEILQIGKGRIVKEGTKVALLSFGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHDLIRQLARHHEMVITVEEGSIGGFGSHVMHFLATEGLLDNGLKLRSLVMPDIWMEQAKPEAMNAHAGLDRAGIVSTVFRALGRGVAVGVAG
>NZ_CP050108.1|WP_028734891.1|2256298_2258236_-|methyl-accepting-chemotaxis-protein
MSAKNISLNGKLAATFAALILIFVAISAFVYSKATASAAASAEQEKSELLVNQIDDALQAMLEQAVNLRGFILFRSDSTYGDVFANRERMLKAIAAAKQTATGEPQLVEMIDGMQKAADLYFHELAEPQTKARKETDMPIEEVVKIGVNATKGQLDGFRQASAKIKATAREKSNALAAIRADANSDLKTTLLAGGILASLAAAVLAWLMSRTIVRPVVGMTAAMDRLAGGQNDIEVPAVERGDEIGRMAQSVLVFKQAAIEKLRLAGETDRMRDDAERQRRAGDEQKAREEGEIRYAIDALAGGLAELANGDMAGRIQTPFASQYDSLRNDFNHAVEKLQAALQSVGRNASAINAGAGEIRSAADDLAHRTEQQAAAVEQTAAALEEVTTTVRDSAKRAEDVGNLVERTRLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALITTSGEQVVAGVGLVGETGKALEVIVSEVQEINHHVNAIVTATREQSIGLQEINTAVNNMDQGTQQNAAMVEEQTAASHALAQEANALDELLRQFKLGQAAPAPRAAVAGTSSRPVASPAHALTRTVAKAFGGRQAAATATVQEEWTEF
>NZ_CP050108.1|WP_130651826.1|2258455_2259454_-|DUF4424-domain-containing-protein
MLKLFTLIVAAVIASPALANDTMAEVKTGGLIFAQSDDVSMAEEDLFISASEVRVDYIFENSSDKDVESLVAFPMPDITGQVDNNSAISDYDSNNFLHFSTVQDGKPITAKLQQRVVSLGIDVTDEFAKLGIPVLPYSQKTTEALAKLPETVRKDWISRGLVYPMGAGDAAGVDLVPLWTLRSTYWWRTTFPAKKKVSVEHRYKPAVGGTVAISFLEGGEPKGDRFEEYSRKYCLDGDFVRVAQQRAREAEAGGANYTENWISYVLSTGANWAGPIKRFQLTIDKGKPGSLISFCGSNVQKIGPTTFRMTSEDFDPTRDFDILILNPPETAQ
>NZ_CP050108.1|WP_130651825.1|2259586_2260333_+|TlyA-family-RNA-methyltransferase
MSDQNTQRLDQLLVSLGLFASRSRARDAVQRGTVRIGGQVVTKAGALFNADAAIEIDDPAQDYVSRAALKLAAALDHFRLDPAGHHCLDVGASTGGFTEVLLLRGAQHVTAIDVGHGQMHPRISGDPRVTNREGLNARNLTAEDIGHPATFIVSDVSFITLKLALAPALEIAEPGAVAILLVKPQFEAGREAIGKGGMLKDPSSAPAVAAELERWFIEDMGWKSLGLIPSPISGGDGNQEFLLAGLKP
>NZ_CP050108.1|WP_130651824.1|2260329_2261580_+|class-I-SAM-dependent-RNA-methyltransferase
MSTETVTIEKLGAQGDGIASSAGGPVYVPFSLPGETVAIARVKSQGTIMSITTPSPDRQEPRCRHFGPDGVNGTCGGCTLQHLADAPYRAFKRQLVIDALKSKGLTPEVGEIVPARPGERRRVVFAARKTEKDMLVGFNQAESHHIVAIEECPISSAGIIARLPAIRAIAASLATSAEPFRVAVLETLSGLDISVDEVKKLSDPQRRKAIETALGLRGIARVSLNGEILVEPSKPMVEFGGVQVSPPPGSFTQATKPAEEAMAELVIAHAGKAKRIADLFAGSGTFSLRLARIGRVHAVEAEAKALAALDHAARNTQGLKPVTVEKRDLFRRPLMTQEFKPYDAVVFDPPRAGAEFQCQELARSAVKKIVAVSCNPLTLARDLAILVEGGYRITQVTPIDQFLWTSHVEVVATLEK
>NZ_CP050108.1|WP_130651823.1|2261582_2262593_+|hypothetical-protein
MPVGKTKRRNPYYHGPVSDHFDGTYFFNPDGIEPLGFRDLLRWQFGGGRERWPQSVPSPYPAAKPDPCVDGEDLRVTMVGHATMLVQVAGLNILTDPVWSERVSPFAFAGPKRVVQPGIAFDDLPPIDLVLVSHNHYDHLDIATLRRLGAKHQPRVVTPLGNDTIIRRAVPDIQTTSMDWGERISHAGISIDAEPAHHWSARGTADRRMALWASFVLSTPAGKIYHVGDTGFHNGINYKAAQQKHGGFRLAILPFGAYEPRWFMKGQHQNPQEAVIGMKLANAAYVAGHHFATFQLTNEAVDAPARALQDAMSEHDIPPERFRPLRAGEIFNVPAV
>NZ_CP050108.1|WP_018449333.1|2262673_2263429_-|crotonase/enoyl-CoA-hydratase-family-protein
MTDYIIVEQPSAYPGVQSIRFNRPEKKNAITRAMYRIMADALNAANTSPDIRATAFLGTEGCFSAGNDLNDFLAAAMGGRGLEQEILDFLYALVNAEKPVVSGVDGLAVGIGTTIHLHCDLTIASSRSQFRTPFVDLALVPEAGSSLVAPRLMGHQRAFAMLAAGEAFSAAEAKEAGLVWKVVESGEVDSLTLGLAAKLAAKPPEALRIARDLIRGDRGEIIARIDEEARHFSARLKSAEARAAFEAFMRR
>NZ_CP050108.1|WP_131631091.1|2263438_2265217_-|acyl-CoA-dehydrogenase
MYKAPVEEITFTLKHVAGMGEAMSKGLLGDLGEDLVDAILAEAGRFATEEVAPLAEIGDRQGARLIDGEVRLPDGWRDLYRHWIAGGWNGLTAPEAFGGQALPHMLNVAALEMWNSGSMAFALAPTLTMGAIEAVSAHGSVALKDKYLEKMVSGEWTGTMNLTEPHAGSDLGVLKARAERRDDGSYRLFGQKIFITWGEHDAADNIIHLVLARLPDAPAGTRGISLFLVPKFLVNDDGSLGPRNDLFCHSLEHKLGIHGSPTCTMIYGDGKFGGEKGAVGWLVGEENKGLACMFTMMNNARLAVGMQGVAIAEAATQKALAYARERTQGRAPGASGAGMSPIVEHPDVARMLLTMKTLTQGARAISYACAHAIDMSHRAGDASRQWQERAALLTPIAKSFSTDAGVDVASLGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLPLSGGDQVKGFIAELREIADGVRRSNLDGFGETAARLDAAIADLEQATAWLMKTLAENRTAEALSGATPYQRLFGLVLTGCYLAKGGLAESADGAAENRIALCRFAAENLLAETAALRDRVVSGAASLAAARILLA
>NZ_CP050108.1|WP_003556974.1|2265425_2266421_+|transporter
MDTLPVNIPGFVWAYRFSPEEKTAVRLNNSATVAELTADNCFYWLHLNLVDARVPALLDTLDGLTEDAKSALTTRDTHAAITVDEQMLYGTLVDCQRDFAQDTNNLGWLHFAMSDRFLITTRLQPLRSVERARALIEKNPGKFSRPVDLFELLVIEFQRTLIAIVIELTEELNQIEDIVYDSAQRDERRRLAPVRRTVVRLHRHLRTVLALMRRAAAADDDEMPFGFDDVARRLTSRLETVDHDIYALQDRARLLHEEIDSKQSSETNRHLYLLSIMTAFLLPPTLVTGFFGMNTANLPFAVGDYGTEYAVALIVASIAFAWWLLRRVDIL
>NZ_CP050108.1|WP_113541714.1|2266514_2267000_-|BA14K-family-protein
MIGLRNKIATAVLAAVVVLTGFAPSQAIQMPTAPQVEKSSAVENVQYRRYYRPGYRPGAYYRPGYRPGAYYRPGYYGGYRGYSYYRPGYRHYNGYWYPLAAFGAGAVIGGAIVAQPRYVDPAPRMGSSHVAWCANRYRSYRAYDNTFQPYNGPRQQCYSPY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050108_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050108_3

2315465-2315547

Orphan

Consensus_repeat	Method
CACACTTCCGGGCGACATGCATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050108_3

>merge|NZ_CP050108|3|2315465-2315547|CRISPRCasFinder
CACACTTCCGGGCGACATGCATTAATCCCGTCATGCATGTCGTTATCCCGGAACCGCTGCACACTTCCGGGCGACATGCATTA

>NZ_CP050108|3|3|2315465-2315547|CRISPRCasFinder
CACACTTCCGGGCGACATGCATTA	ATCCCGTCATGCATGTCGTTATCCCGGAACCGCTG
CACACTTCCGGGCGACATGCATTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050108.1\|WP_166465888.1\|2319240_2320005_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP050108.1\|WP_130751017.1\|2307979_2308471_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169691
NZ_CP050108.1\|WP_130751007.1\|2317342_2318077_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|132580
NZ_CP050108.1\|WP_166465741.1\|2310889_2312101_-\|cell-wall-hydrolase	unknown	unknown	gnl\|CDD\|226296
NZ_CP050108.1\|WP_166465742.1\|2320004_2320922_+\|2-dehydro-3-deoxygalactonokinase	unknown	unknown	gnl\|CDD\|377446
NZ_CP050108.1\|WP_130751015.1\|2309470_2310223_-\|F0F1-ATP-synthase-subunit-A	unknown	unknown	gnl\|CDD\|235617
NZ_CP050108.1\|WP_165420486.1\|2316798_2317197_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_112906032.1\|2324844_2326566_-\|response-regulator	unknown	unknown	gnl\|CDD\|381099
NZ_CP050108.1\|WP_018245008.1\|2308474_2309098_-\|F0F1-ATP-synthase-subunit-B	unknown	unknown	gnl\|CDD\|169692
NZ_CP050108.1\|WP_018449360.1\|2312253_2314152_-\|potassium-transporter-Kup	unknown	unknown	gnl\|CDD\|225700
NZ_CP050108.1\|WP_131704194.1\|2307197_2307887_+\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|234574
NZ_CP050108.1\|WP_130651799.1\|2321573_2322461_+\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|225921
NZ_CP050108.1\|WP_018244997.1\|2320935_2321577_+\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	unknown	unknown	gnl\|CDD\|181670
NZ_CP050108.1\|WP_003545854.1\|2309175_2309403_-\|F0F1-ATP-synthase-subunit-C	unknown	unknown	gnl\|CDD\|181027
NZ_CP050108.1\|WP_113543168.1\|2315187_2315424_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050108.1\|WP_018245000.1\|2318331_2319129_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP050108.1\|WP_018244994.1\|2323353_2324718_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|227334
NZ_CP050108.1\|WP_130751013.1\|2310285_2310618_-\|F0F1-ATP-synthase-assembly-protein	unknown	unknown	gnl\|CDD\|227641
NZ_CP050108.1\|WP_018449361.1\|2314170_2315148_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213371
NZ_CP050108.1\|WP_113542667.1\|2322694_2323300_+\|PRC-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|368352

Protein	Function_ID	Function_description	E-value
NZ_CP050108.1\|WP_166465888.1\|2319240_2320005_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	9.35679e-63
NZ_CP050108.1\|WP_130751017.1\|2307979_2308471_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169691	PRK09173, PRK09173, F0F1 ATP synthase subunit B; Validated.	1.43226e-71
NZ_CP050108.1\|WP_018449361.1\|2314170_2315148_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	3.988e-155
NZ_CP050108.1\|WP_166465741.1\|2310889_2312101_-\|cell-wall-hydrolase	gnl\|CDD\|226296	COG3773, SleB, Cell wall hydrolyses involved in spore germination [Cell envelope biogenesis, outer membrane].	2.73568e-85
NZ_CP050108.1\|WP_166465742.1\|2320004_2320922_+\|2-dehydro-3-deoxygalactonokinase	gnl\|CDD\|377446	pfam05035, DGOK, 2-keto-3-deoxy-galactonokinase. 2-keto-3-deoxy-galactonokinase EC:2.7.1.58 catalyzes the second step in D-galactonate degradation.	1.18552e-118
NZ_CP050108.1\|WP_130751015.1\|2309470_2310223_-\|F0F1-ATP-synthase-subunit-A	gnl\|CDD\|235617	PRK05815, PRK05815, F0F1 ATP synthase subunit A; Validated.	6.04036e-65
NZ_CP050108.1\|WP_112906032.1\|2324844_2326566_-\|response-regulator	gnl\|CDD\|381099	cd17546, REC_hyHK_CKI1_RcsC-like, phosphoacceptor receiver (REC) domain of hybrid sensor histidine kinases/response regulators similar to Arabidopsis thaliana CKI1 and Escherichia coli RcsC. This family is composed of hybrid sensor histidine kinases/response regulators that are sensor histidine kinases (HKs) fused with a REC domain, similar to the sensor histidine kinase CKI1 from Arabidopsis thaliana, which is involved in multi-step phosphorelay (MSP) signaling that mediates responses to a variety of important stimuli in plants. MSP involves a signal being transferred from HKs via histidine phosphotransfer proteins (AHP1-AHP5) to nuclear response regulators. The CKI1 REC domain specifically interacts with the downstream signaling protein AHP2, AHP3 and AHP5. The plant MSP system has evolved from the prokaryotic two-component system (TCS), which allows organisms to sense and respond to changes in environmental conditions. This family also includes bacterial hybrid sensor HKs such as Escherichia coli RcsC, which is a component of the Rcs signalling pathway that controls a variety of physiological functions like capsule synthesis, cell division, and motility. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	4.51052e-36
NZ_CP050108.1\|WP_018245008.1\|2308474_2309098_-\|F0F1-ATP-synthase-subunit-B	gnl\|CDD\|169692	PRK09174, PRK09174, F0F1 ATP synthase subunit B.	4.41887e-88
NZ_CP050108.1\|WP_018449360.1\|2312253_2314152_-\|potassium-transporter-Kup	gnl\|CDD\|225700	COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism].	0
NZ_CP050108.1\|WP_131704194.1\|2307197_2307887_+\|ribonuclease-HII	gnl\|CDD\|234574	PRK00015, rnhB, ribonuclease HII; Validated.	1.67586e-103
NZ_CP050108.1\|WP_130651799.1\|2321573_2322461_+\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|225921	COG3386, COG3386, Gluconolactonase [Carbohydrate transport and metabolism].	4.96909e-86
NZ_CP050108.1\|WP_018244997.1\|2320935_2321577_+\|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase	gnl\|CDD\|181670	PRK09140, PRK09140, 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed.	4.93245e-115
NZ_CP050108.1\|WP_003545854.1\|2309175_2309403_-\|F0F1-ATP-synthase-subunit-C	gnl\|CDD\|181027	PRK07558, PRK07558, F0F1 ATP synthase subunit C; Validated.	7.89276e-27
NZ_CP050108.1\|WP_018245000.1\|2318331_2319129_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.21209e-66
NZ_CP050108.1\|WP_018244994.1\|2323353_2324718_-\|EAL-domain-containing-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	3.16789e-112
NZ_CP050108.1\|WP_130751013.1\|2310285_2310618_-\|F0F1-ATP-synthase-assembly-protein	gnl\|CDD\|227641	COG5336, COG5336, Uncharacterized protein conserved in bacteria [Function unknown].	4.85313e-39
NZ_CP050108.1\|WP_130751007.1\|2317342_2318077_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|132580	TIGR03541, reg_near_HchA, LuxR family transcriptional regulatory, chaperone HchA-associated. Members of this protein family belong to the LuxR transcriptional regulator family, and contain both autoinducer binding (pfam03472) and transcriptional regulator (pfam00196) domains. Members, however, occur only in a few members of the Gammaproteobacteria that have the chaperone/aminopeptidase HchA, and are always encoded by the adjacent gene.	9.42955e-22
NZ_CP050108.1\|WP_113542667.1\|2322694_2323300_+\|PRC-barrel-domain-containing-protein	gnl\|CDD\|368352	pfam05239, PRC, PRC-barrel domain. The PRC-barrel is an all beta barrel domain found in photosystem reaction centre subunit H of the purple bacteria and RNA metabolism proteins of the RimM group. PRC-barrels are approximately 80 residues long, and found widely represented in bacteria, archaea and plants. This domain is also present at the carboxyl terminus of the pan-bacterial protein RimM, which is involved in ribosomal maturation and processing of 16S rRNA. A family of small proteins conserved in all known euryarchaea are composed entirely of a single stand-alone copy of the domain.	1.74373e-10

>NZ_CP050108.1|WP_113543168.1|2315187_2315424_+|hypothetical-protein
MRIVLNRIAVPNPSIDKTTPNLQAGRLFETKTTVIEHLQQNAIMAPRHMKQSREIIKTSSVKRGFSPRFPHNLGYPSR
>NZ_CP050108.1|WP_018449361.1|2314170_2315148_-|magnesium-transporter-CorA-family-protein
MITAYCSNCKSVEIRDLSHAASFPEDVVWIDMIEPTRDEELYVEKILGIEVPTRDDLKDIEPSARLYVENDAVFMTASLLWKADTDVPTLTDVAFILAGNRLVTIRYAHPKSFALFIAALHRLPENWRSGAALLAKLLETIVDRTAEILEISVSRLDILSTHVFGDRARKVRKPSNYLEEKLRDIAGHHRMISKVRDSLGSLARLLTFFHTIPAIQQDREAKELCRTVSRDIQSLSEHASFVAANITFLLDASLGLINIEQNSIIKIFSIASVVFLPPTLVASIYGMNFQIMPELTWVAGYPYSLALMVISAVIPFFFFRWKGWL
>NZ_CP050108.1|WP_018449360.1|2312253_2314152_-|potassium-transporter-Kup
MSEESHPNERHMTPRKLFYLGLGSVGVVYGDIGTSPLYAFREALKPVAHDGVTRFEVISLISLMIWALTIIVTIKYVLFLLRADNDGEGGTLSLLALLMKTANGHTAILMLLGLMGAALFLGDAMITPALSVLSAVEGLKLVTPSLAEYIVPISVVILALLFVVQSRGTGAVAKFFGPITAVWFLVMAAAGISHISDDYGILAAFNPYYAVSFLLHEGFYGVVVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFLLVFPALTLNYLGQGALVLGNPMTMSDPFYLMYPKWALLPVVILATAATIIASQAVITGAFSMVRQGINLGFLPRMEILFTSETNTGQIFVPSVNAVLFIGVIFLVLSFKTSDALATAYGISVTGAMVVTSIMAFEFVRARWNWSLPVAVIALAPLVVLEMIFLGANLLKIHDGGYIPIMIATAFTVVMWTWRRGTAILMEKTRHTDIPLASFVSSIERKSEHSPAQVPGTAIFLTSDPESAPAALLHNLKHNHVLHDRNVILTIRTINKPRVPSHDRYKVEQISERFSRVELLFGFMESQNVSQALATLRKTGLKFDIMSTSFYLGRRKLVPDAKSGMPYWQDRLYIALANAAANPSDYFRLPANRVVELGSHVII
>NZ_CP050108.1|WP_166465741.1|2310889_2312101_-|cell-wall-hydrolase
MECSRVPCPESVLRRKSPSRSKLRLIPENWVSPVIFGLAGWLIFPSVASHADLAAMLAGLDHEGENWRMVLTNSPAGSIHQAELTFAEPMVTGSISAGAGMVLPDGRKVAFTAKDKGHEDTPDEDRVNRGTKKGRVVAVETMQPPKDFSAGSILERTKMLFTPSFDLKDRSAFVKPKIQGKEIQIATSFYKTQPVVTDNGVPAMLASLVTSNKADVLATAYAPAAPDYARQSPFDSILAEPDSGRFVPEIGPRDHAWAASVLAPSVFSAREQQCLASGIYFEARGESVKGQAAVAQVILNRVRNPSYPKTICGVVYQNEDWRNRCQFSFACDSIKDRVNSEYHWRVARDVAMAVTAGKIWLPQVGSATHYHAVCVRPKWAKTMEKVGRIGLHVFYRTYGGGWS
>NZ_CP050108.1|WP_130751013.1|2310285_2310618_-|F0F1-ATP-synthase-assembly-protein
MADDREESLEKRRARLGAELATKRVEAGVNESSEARAEVSRKGYAQAMKLSSEFIAAIVVGAVLGYVLDRFVGTAPWGLIVLLLLGFCAGVLNVLRSAGVVAHPLDDDKK
>NZ_CP050108.1|WP_130751015.1|2309470_2310223_-|F0F1-ATP-synthase-subunit-A
MSNDPTHQFLIQKIVPIEIGGIDFSFTNASLFMAASAAVAAGFLYFATSNRAIVPGRSQSVAEMSYEFIANMLKEGAGKQGMKFFPLVFSLFMFVLTANLLGMFPYFFTVTSQIIVTFALALLVIGTVLVYGFYKHGFHFLNIFVPSGVPGLLLPLVIAIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVASLGTLGALGVGGAVLPLIMTVALTGLEFLVAFLQAYVFAVLTCMYLNDAIHPGGH
>NZ_CP050108.1|WP_003545854.1|2309175_2309403_-|F0F1-ATP-synthase-subunit-C
MEAEAAKYIGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAADSQFGRLVFGFAVTEALGIFSLLVALLLLFAV
>NZ_CP050108.1|WP_018245008.1|2308474_2309098_-|F0F1-ATP-synthase-subunit-B
MFFVTPAYAEEAPAAATGTDAHAAPAAGEVHTETGVAEGEHARGPFPPFDSTTFASQLLWLVITFGVFYLLMQKVIAPRIGAILDQRHTRISQDLEEAARLKAEADAAVRTYEGELAAARAKSNAIGAAARDAAKAKAEEDRRAVEASLSEKIKAAELRIGEIKAKAFADVGTIAEETAAAVVDQLIGGTVAKADVAAAVAAAKKEA
>NZ_CP050108.1|WP_130751017.1|2307979_2308471_-|F0F1-ATP-synthase-subunit-B
MEFAFDATFFAFVGLVLFLALVVYLKVPGMMARSLDDRADQIRNELAEAKRLREEAQHLLAEYQRKRKEAEAEAAHIVAAAEREAQMLTAEAKKKTEEFVINRTALSEQKIKQAEAEAMKAVRSAAVDLAIAAAETVLAKQADAKVQSELFGNAVGQVKTRLN
>NZ_CP050108.1|WP_131704194.1|2307197_2307887_+|ribonuclease-HII
MKPRTSPDSPLLFDAVPLVPDFRLELKARKAGHWPVAGADEAGRGPLAGPVVAAAVILDPRRIPEGLNDSKQLSAQRREELFVQILATATVSIASSSSTRIDETDIRKASLDAMRRAICSLAIPASYVLTDGLDVPPGLDCPGQAVVKGDARSVSIAAASIVAKVTRDRMMARAHNVFPDYGFAAHVGYGTAQHRAGIERHGPCSLHRMSFRPLRKVENGPETDELLSE
>NZ_CP050108.1|WP_165420486.1|2316798_2317197_-|hypothetical-protein
MRPAPGNGAADTPLPDADAAFSRPFGVGGGCCVLAPLLSQLFAISSFRFTFHWPFARLALVRPGLRRFSGRPLRPSGRKPGGLDGRNGLPIPRRSFGTPSNRFFLPMILFGEGFRLHYLYCMISALIDFDQG
>NZ_CP050108.1|WP_130751007.1|2317342_2318077_-|LuxR-family-transcriptional-regulator
MAPLSQTSTEEDDYIKEIAGLKTQFDIFRFMKRVTEAYRSRAFMVLNLPPITSFDLQGSTVITSWPAELLALYDQEGLMVNSPVLRRLRTSARPFFYDMSRQNWSRDDGKSILVASLFERFKMMRGAYFPTHEPSGLRGAVSFAGDREPFGPAEMRELCYIAIHVFDRLAEIRNLDTRITDTLTDREIDCLNWTAAGKTSAEIAEILTLSEHTVNHYLNRATKKLDTVNRTQAVAKALRIGLIK
>NZ_CP050108.1|WP_018245000.1|2318331_2319129_-|IclR-family-transcriptional-regulator
MDSNGGGAAQARETGTLGKLMVLLDLVTHADAPLRFTDVLALAGQPRGTLHRQLSHLVEEGLLELDGDGRYAPGLRLLDFAARSWARNEFRMIAEPHLADLQRATGETVHLGVLRGQSIIYLDKVEGRQPVRMYSQIGNASPCYCTGVGKAALSLLPAESLVDLVAGLSFTSFTASTHVSAETLLAEIREIADQGYAFDREEHEAGIRCVAAPVWSEDRTFMGGISITGPAYRLSMELLHQWAVPVQLAAARIMEGMRVRLGPRR
>NZ_CP050108.1|WP_166465888.1|2319240_2320005_+|SDR-family-oxidoreductase
MPAAQFPEFKGRAVLVTGGGSGIGAAIVEGFARQGAKVSFIDIAEAAGRELADRLSRETAHPVSFHHADLRDIEAIRRTVDSVIASSGPIRVLVNNAAWDDRHEFDAVTEAYWDNNQAVNLKHVFFTSQAVVPSMRVAGGGAIINMSSIAFKLNMGGFPAYAAAKAAVVGLTKSLAGRLGPENIRVNCILPGMVVTERQMQHWLTEESIARSVEDQCLKVALKPDAIVGPCLFLASDCAAGMTAQSLIVDGGVL
>NZ_CP050108.1|WP_166465742.1|2320004_2320922_+|2-dehydro-3-deoxygalactonokinase
MANPAYVAVDWGTSSFRLWLMGRDGTVLAERRSGEGMTSAAKTGFSAVLTGHLTAIEAPENLPVIICGMAGARQGWVEAGYIDVPMPLASILTGAVSVPGESRDIRILPGLAQRDMATPDVMRGEETQLLGALGRASSGAQAVCMPGTHSKWVHVTDANVTGFSTFMTGELFDVISKHTILSHAVAGAAEQPADAAAFEAAVSAAFARPALASNLLFTARSGQLLHGISAAAAQARLSGTLIGLEIAGALQDAANGTDITLVASGRLQALYEQAFKTLSLAFTAIDADAAVRRGLSAAAEAIWPN
>NZ_CP050108.1|WP_018244997.1|2320935_2321577_+|2-dehydro-3-deoxy-6-phosphogalactonate-aldolase
MNRIPFPDMKRPLIAILRGIRPDETESVVGALIENGLTAIEIPLNSPEPFKSIEIAAKMAPADVLIGAGTVLTVEAVDSLHAAGGKLLVTPNVEPEVIIRARDYGMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELMIAAVGGVSDKNFGDYTKAGIFAFGLGTSIYKPGMTASEVAERAKATIYAYDAAIGSVNV
>NZ_CP050108.1|WP_130651799.1|2321573_2322461_+|SMP-30/gluconolactonase/LRE-family-protein
MTDIYEFEGKTLCNTNSVLGEGPTYDPDSNTVWWFNILGKELHELNLSTGTKKVHPLPVMASVLARIDAGRQLIATEEGLFVRDVASGNLTFYAALENDRPENRSNDGRTHPSGALWIGTMSKRAENQAGAIYHVASGKVTKIFNGISIPNSICFSPDGTIGYYTDSRINRLMRVMVDPLTGLPSGEPIVLVDSMDDPGDIDGSVVDADGYLWNARWGAGVVDRYSPDGLRISRYKVPAVQPSCPAFIGVNADRLAVTTAWEGLDEDARSAQPSAGALLELGIEVKGVFDPVYVI
>NZ_CP050108.1|WP_113542667.1|2322694_2323300_+|PRC-barrel-domain-containing-protein
MTRKLLTTVAAGALFATAFVPAAFSQTAPQPADPAAPTQAAPADPAAPKPMTPDVTKPAGDAAQAPAAAPTADTAQAGYLTEQSPDQVSANTYIGQSVYNGNNESIGSVNDLILKKDGGFVAAIVGVGGFLGIGEKNVAVPMEKITVAQNTQDGSVKLTTSETAESLKAAPEFKTLAMLAAEKAPAATGTDTTATGSTTPK
>NZ_CP050108.1|WP_018244994.1|2323353_2324718_-|EAL-domain-containing-protein
MMKSAEIAFLTVGQNELQAMAYTDPLTGLGNRNRMREKVLQISSERASDPAPFTIGIVNLDSFKPINDLFGSTAGDEILCQVAHRLRACIPDGALVTRHDGDEFAFVLPLIFERASAEKFGQMIREVLSAPYDLGDRNVRLSASLGFSIYPFAGEDCEELLKSAETALYRSKRRGRGQITVYSREIAQEMKRATQLEQALRNAIISDAIDVHFQPIVSLSNNQVVGFEALARWNDPDLGFVSPGVFVPLAEERGFIDALSEALLRKAAEAALSWPRELFLSFNLSSAQMMDPGTSSSVLSILGRVGFDPHRLELEITETAVMSSADTAHRIIADLRAAGVRISLDDFGTGQSSLGRLRDFIFDKIKIDRAFVSRINSDRASEHIIKAILTMCEGLELEVVAEGIEDYAEAVKLRTLGCGMGQGYHFGRPADGIATLRFLHENYYDPTVMERVSA
>NZ_CP050108.1|WP_112906032.1|2324844_2326566_-|response-regulator
MSAGFEKADTSSEIDGSPAEADLQTALFDVVCDSLSAAFIIYDKNDHLIFASRQTLEFFPLPAEMLKPGTRLRDFLGAMYDTGIRQQYDVRQGGSLSREDWLSQKIASHWRERFDAVERHGADSWVRFVKRRLPGGYGVTIISDISENKKREEQWRSDLERVQLTEDILDNLPFPLFVKDRNLTYVAVNLAFCEKYQTSADEVLGRKSGDLFSEEIAKRFEESDRHVLETGEMSVSRQRQISRDGIERDIVSRKHRIGKPGRYFLVSTMQDLPRDGADLDEFGQASAITASSNQSYRRAYVPVPTGVERREPAAMEAIVPENFSGRKVLVVTADLAAETAALRTLTKYGFESCSVRGEDEEERFLEIATSSGISLDLLIIDNQMGMRCLELAEQYGIPALVMDGFQIANELTFQIARHFNRNSRSAAGSDTDWEISISDDVVGLQVLVAEDNDINQIVFSQILEGLGYRHMLAATGDEAVRLWAEHRPQIVLMDISLPGFNGFEAARLIRQMEETGGGTRTPIIGVLTQAFERDRAECVKSGMDDVIMKPVSPDMLETVFQKYLMDEPMRARN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	NC_019526	Enterobacteria phage vB_KleM-RaK2, complete genome	206969-206993	3	0.88
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	MT708547	Klebsiella phage Muenster, complete genome	328861-328885	3	0.88
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	AB897757	Klebsiella phage K64-1 DNA, complete genome	205606-205630	3	0.88
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	317877-317901	4	0.84
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	262286-262310	4	0.84
NZ_CP050108_1	1.1\|1091093\|25\|NZ_CP050108\|CRISPRCasFinder	1091093-1091117	25	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	10785-10809	4	0.84
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	1123372-1123406	4	0.886
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	124883-124917	4	0.886
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	1148791-1148825	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	132186-132220	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	657329-657363	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	438047-438081	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	384831-384865	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	336378-336412	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	207471-207505	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	207471-207505	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	205912-205946	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	210159-210193	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	204277-204311	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013512	Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence	97135-97169	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	207471-207505	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013553	Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence	132366-132400	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP020911	Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence	869536-869570	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013586	Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence	137731-137765	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013564	Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence	132366-132400	6	0.829
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	99451-99485	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	281489-281523	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	667850-667884	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	619424-619458	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	570407-570441	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	95674-95708	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	212757-212791	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	291127-291161	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	303891-303925	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	293884-293918	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	126588-126622	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	336441-336475	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	291068-291102	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	310524-310558	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	297314-297348	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	305488-305522	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	303891-303925	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	310524-310558	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	291068-291102	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	290616-290650	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	116756-116790	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	151266-151300	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013635	Rhizobium sp. N324 plasmid pRspN324e, complete sequence	385516-385550	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	610453-610487	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP021025	Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence	95577-95611	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	2094575-2094609	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	372850-372884	7	0.8
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	1215016-1215050	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	457573-457607	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_011366	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence	114741-114775	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	96361-96395	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	450840-450874	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	423635-423669	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	630457-630491	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	102359-102393	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013538	Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence	126257-126291	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	102034-102068	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	224405-224439	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	383036-383070	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	102028-102062	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	147137-147171	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	519945-519979	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	168710-168744	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	606742-606776	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013539	Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence	9676-9710	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP021127	Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence	167124-167158	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	556774-556808	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	CP007644	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence	168753-168787	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	615190-615224	8	0.771
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	87758-87792	8	0.771
NZ_CP050108_2	2.1\|2254102\|34\|NZ_CP050108\|CRISPRCasFinder	2254102-2254135	34	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	179879-179912	9	0.735
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	445062-445096	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	460591-460625	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	488680-488714	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	445038-445072	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	459459-459493	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	460591-460625	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	445038-445072	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	1129906-1129940	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013577	Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence	14452-14486	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013549	Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence	14452-14486	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013534	Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence	14452-14486	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013545	Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence	14452-14486	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013571	Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence	14452-14486	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013632	Rhizobium sp. N324 plasmid pRspN324b, complete sequence	350817-350851	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	293094-293128	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	272059-272093	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	27876-27910	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	399668-399702	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	179923-179957	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	352540-352574	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	174680-174714	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013631	Rhizobium sp. N324 plasmid pRspN324a, complete sequence	119253-119287	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1698044-1698078	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1528430-1528464	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	348772-348806	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	38279-38313	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	169629-169663	9	0.743
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP035001	Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence	78852-78886	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	447873-447907	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	474981-475015	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	461780-461814	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	474981-475015	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	444552-444586	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	456535-456569	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	151271-151305	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	2176406-2176440	10	0.714
NZ_CP050108_3	3.1\|2315489\|35\|NZ_CP050108\|CRISPRCasFinder	2315489-2315523	35	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	76585-76619	10	0.714

1. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to NC_019526 (Enterobacteria phage vB_KleM-RaK2, complete genome) position: , mismatch: 3, identity: 0.88

gtttcgctggaattgctcttgtttc	CRISPR spacer
gattcgctggaattgctattgtttt	Protospacer
* *************** ******.

2. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to MT708547 (Klebsiella phage Muenster, complete genome) position: , mismatch: 3, identity: 0.88

gtttcgctggaattgctcttgtttc	CRISPR spacer
gattcgctggaattgctattgtttt	Protospacer
* *************** ******.

3. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 3, identity: 0.88

gtttcgctggaattgctcttgtttc	CRISPR spacer
gattcgctggaattgctattgtttt	Protospacer
* *************** ******.

4. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 4, identity: 0.84

gtttcgctggaattgctcttgtttc	CRISPR spacer
acttcgttggaattgttcttgtttc	Protospacer
..****.********.*********

5. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 4, identity: 0.84

gtttcgctggaattgctcttgtttc	CRISPR spacer
acttcgttggaattgttcttgtttc	Protospacer
..****.********.*********

6. spacer 1.1|1091093|25|NZ_CP050108|CRISPRCasFinder matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 4, identity: 0.84

gtttcgctggaattgctcttgtttc	CRISPR spacer
acttcgttggaattgttcttgtttc	Protospacer
..****.********.*********

7. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 4, identity: 0.886

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttcgtgttatgcatgtcgttatcccggaaccgctg	Protospacer
 ** .**.***************************

8. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 4, identity: 0.886

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttcgtgttatgcatgtcgttatcccggaaccgctg	Protospacer
 ** .**.***************************

9. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttcatgcatgtcgttatcccggaaccgcgg	Protospacer
 * .. *************************** *

10. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttatcccggaaccgctg	Protospacer
 * .. * ***************************

11. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttatcccggaaccgctg	Protospacer
 * .. * ***************************

12. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
attgattcatgcatgtcgttatcccgaaaccgctt	Protospacer
**.   ********************.*******

13. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
attgattcatgcatgtcgttatcccgaaaccgctt	Protospacer
**.   ********************.*******

14. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
attgattcatgcatgtcgttatcccgaaaccgctt	Protospacer
**.   ********************.*******

15. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

16. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

17. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

18. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

19. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

20. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013512 (Rhizobium sp. N1314 plasmid pRspN1314a, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

21. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtcgttaccccggaaccgctg	Protospacer
 * *. .**************.*************

22. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013553 (Rhizobium phaseoli strain N931 plasmid pRphaN931a, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgctttatgcatgtcgttctcccggaaccgctg	Protospacer
 *. * *.************ **************

23. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP020911 (Rhizobium etli strain NXC12 plasmid pRetNXC12e, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtccttatgcatgtcgttgtcccggaaccgctg	Protospacer
 * .* *.************.**************

24. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013586 (Rhizobium phaseoli strain N161 plasmid pRphaN161a, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgctttatgcatgtcgttctcccggaaccgctg	Protospacer
 *. * *.************ **************

25. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013564 (Rhizobium phaseoli strain N831 plasmid pRphaN831a, complete sequence) position: , mismatch: 6, identity: 0.829

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgctttatgcatgtcgttctcccggaaccgctg	Protospacer
 *. * *.************ **************

26. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttattccggaaccgctg	Protospacer
 * .. *.**************.************

27. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttgtcccggaaccgctg	Protospacer
 * .. * ************.**************

28. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
cttgttttatgcatgtcgttaacccggaaccgctg	Protospacer
 *. . *.************* *************

29. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ctttttttatgcatgtcgttaacccggaaccgctg	Protospacer
 *... *.************* *************

30. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
cttgttttatgcatgtcgttaacccggaaccgctg	Protospacer
 *. . *.************* *************

31. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.************.**************

32. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttatcccggaaccgcgg	Protospacer
 * .. *.************************* *

33. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

34. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

35. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

36. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.************.**************

37. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

38. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

39. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

40. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

41. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

42. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

43. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

44. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

45. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

46. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

47. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.************.**************

48. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013635 (Rhizobium sp. N324 plasmid pRspN324e, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgttttatgcatgtcgttatccgggaaccgctg	Protospacer
 *. . *.**************** **********

49. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttctcccggaaccgctg	Protospacer
 * .. *.************ **************

50. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP021025 (Rhizobium sp. TAL182 plasmid pRetTAL182a, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgcttccatgcatgtccttaccccggaaccgctg	Protospacer
 * *. .********** ***.*************

51. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtc---atgcatgtcgttatcccggaaccgctg	CRISPR spacer
---ctgtttggatgcatgtcgttatcccaaaaccgctg	Protospacer
   *.**.   *****************..********

52. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 7, identity: 0.8

atcccgtc---atgcatgtcgttatcccggaaccgctg	CRISPR spacer
---ctgtctggatgcatgtcgttatccccaaaccgcgg	Protospacer
   *.***   ***************** .****** *

53. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttgtcccggaaccgcgg	Protospacer
 * .. * ************.************ *

54. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgccgttatcccggaacggctg	Protospacer
 * .. *.*******.************** ****

55. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_011366 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG202, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttccatgcatgtcgttgtcccggaaccgcta	Protospacer
 * .. .*************.*************.

56. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

57. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

58. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

59. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

60. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

61. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

62. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcacgtcgttctcccggaaccgctg	Protospacer
 * .. *.*****.****** **************

63. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcacgtcgttctcccggaaccgctg	Protospacer
 * .. *.*****.****** **************

64. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgttttttgcatgtcgttctcccggaaccgctg	Protospacer
 *. . *. *********** **************

65. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

66. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013538 (Rhizobium phaseoli strain R630 plasmid pRphaR630a, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgttttatgcatgtcgttctccgggaaccgctg	Protospacer
 *. . *.************ *** **********

67. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

68. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgccccggaaccgctg	Protospacer
 * .. *.************..*************

69. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgccccggaaccgctg	Protospacer
 * .. *.************..*************

70. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgtagtcccggaaccgctg	Protospacer
 * .. *.*********** .**************

71. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttggcccggaaccgctg	Protospacer
 * .. *.************. *************

72. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttgtccaggaaccgctg	Protospacer
 * .. * ************.*** **********

73. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttatgcatgtcgttgtcccggaaccactg	Protospacer
 * .. *.************.**********.***

74. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttcttatgtatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.***.********.**************

75. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013539 (Rhizobium phaseoli strain R630 plasmid pRphaR630b, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttgtcccgcaaccgctg	Protospacer
 * .. * ************.***** ********

76. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP021127 (Rhizobium sp. Kim5 plasmid pRetKim5c, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ctttgtttatgcatgtcgttgtcccggaaccgccg	Protospacer
 *..  *.************.************.*

77. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttcttatgtatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.***.********.**************

78. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to CP007644 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803c, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ctttgtttatgcatgtcgttgtcccggaaccgccg	Protospacer
 *..  *.************.************.*

79. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttcttatgtatgtcgttgtcccggaaccgctg	Protospacer
 * .. *.***.********.**************

80. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.771

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcatgtcgttgtcccgaaaccgctg	Protospacer
 * .. * ************.*****.********

81. spacer 2.1|2254102|34|NZ_CP050108|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 9, identity: 0.735

ccatgctttaatagtgggagcatgatgttgcccg	CRISPR spacer
tctaaattatatagttggagcatgatgttgtccg	Protospacer
.*  . **  ***** **************.***

82. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

83. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

84. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

85. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

86. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

87. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

88. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

89. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctg	Protospacer
 ....  .************.**************

90. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013577 (Rhizobium phaseoli strain N671 plasmid pRphaN671c, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcttttttctgcatgtcgttgtcccggaaccgctg	Protospacer
 .... *. ***********.**************

91. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013549 (Rhizobium phaseoli strain R611 plasmid pRetR611b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcttttttctgcatgtcgttgtcccggaaccgctg	Protospacer
 .... *. ***********.**************

92. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013534 (Rhizobium phaseoli strain R650 plasmid pRphaR650b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcttttttctgcatgtcgttgtcccggaaccgctg	Protospacer
 .... *. ***********.**************

93. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013545 (Rhizobium phaseoli strain R620 plasmid pRphaR620c, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcttttttctgcatgtcgttgtcccggaaccgctg	Protospacer
 .... *. ***********.**************

94. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013571 (Rhizobium phaseoli strain N771 plasmid pRphaN771c, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcttttttctgcatgtcgttgtcccggaaccgctg	Protospacer
 .... *. ***********.**************

95. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013632 (Rhizobium sp. N324 plasmid pRspN324b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgatgcacgtcgttatcccggaaccgcgc	Protospacer
 * .. * *****.*******************

96. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
acggtttgacgcatgtcgttatcccaaaaccgctg	Protospacer
*.  . * *.***************..********

97. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttatttgacgcatgtcgttatcccaaaaccgctg	Protospacer
 *. . * *.***************..********

98. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgtttgacgcatgtcgttatcccaaaaccgctg	Protospacer
 *. . * *.***************..********

99. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttatttttgtgcatgtcgttatccgagaaccgctg	Protospacer
 * .. *..*************** .*********

100. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttgtgcatgtcgttatcccaaaaccgctg	Protospacer
 * .. *..****************..********

101. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttttgttgcatgtcgtcatcccgaaaccgctg	Protospacer
 * .. *  **********.******.********

102. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgttcttatgcatgtcgctatcccgcaaccgcta	Protospacer
 * .. *.**********.******* *******.

103. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013631 (Rhizobium sp. N324 plasmid pRspN324a, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgttttatgcatgtcgttacccgggaaccgccg	Protospacer
 *. . *.*************.** ********.*

104. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttgtgcatgtcgttatcccaaaaccgctg	Protospacer
 * .. *..****************..********

105. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttgtgcatgtcgtcatcccagaaccgctg	Protospacer
 * .. *..**********.*****.*********

106. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttgtttttgtgcatgtcgttatcccaaaaccgctg	Protospacer
 * .. *..****************..********

107. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tttgtttgacgcatgtcgttatcccaaaaccgctg	Protospacer
 *. . * *.***************..********

108. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 9, identity: 0.743

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ctttgtttatgcatgtcgtagtcccggaaccgccg	Protospacer
 *..  *.*********** .************.*

109. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP035001 (Rhizobium acidisoli strain FH23 plasmid pRapFH23c, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ttttttccgtgcatgtcgttgtcccagaaccgcta	Protospacer
 *... .*.***********.****.********.

110. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctt	Protospacer
 ....  .************.*************

111. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctt	Protospacer
 ....  .************.*************

112. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctt	Protospacer
 ....  .************.*************

113. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctt	Protospacer
 ....  .************.*************

114. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcgtgtcgttgtcccggaaccgctg	Protospacer
 ....  .****.*******.**************

115. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
ccttttgtatgcatgtcgttgtcccggaaccgctt	Protospacer
 ....  .************.*************

116. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
gcttttgtttgcatgtcgttgtcccggaaccgctg	Protospacer
.....  . ***********.**************

117. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tcgtttttgtgcatgtcgttatcccaaaaccgctg	Protospacer
 . .. *..****************..********

118. spacer 3.1|2315489|35|NZ_CP050108|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 10, identity: 0.714

atcccgtcatgcatgtcgttatcccggaaccgctg	CRISPR spacer
tgtttttgttgcatgtcgtcatcccgaaaccgctg	Protospacer
  ... *  **********.******.********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

976427 : 986691

uncultured_Mediterranean_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003559389.1\|976427_976937_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.2e-45	59.4
WP_130652385.1\|976966_977539_-	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.4e-41	51.5
WP_130652384.1\|977597_978092_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.7e-24	35.9
WP_047621835.1\|978228_978504_+	hypothetical protein	NA	NA	NA	NA
WP_003539654.1\|978646_978802_+	hypothetical protein	NA	NA	NA	NA
WP_130652383.1\|979151_981992_-	DNA gyrase subunit A	A0A1B1IVS2	uncultured_Mediterranean_phage	4.4e-75	42.2
WP_018242015.1\|982228_982876_+	MarC family protein	NA	NA	NA	NA
WP_130652382.1\|982976_983486_-	single-stranded DNA-binding protein	R9TP78	Rhizobium_phage	9.3e-45	56.2
WP_018242012.1\|983769_986691_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	62.1

DBSCAN-SWA_2

1233796 : 1247184

uncultured_Mediterranean_phage(90.91%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130652280.1\|1233796_1236337_-	protein translocase subunit SecDF	A0A1B1IVP7	uncultured_Mediterranean_phage	8.2e-57	48.2
WP_003558894.1\|1236382_1236730_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.4e-12	39.1
WP_130652279.1\|1236936_1237809_+	ATP-binding protein	NA	NA	NA	NA
WP_130652278.1\|1237957_1239562_-	peptidoglycan DD-metalloendopeptidase family protein	I3PV24	Clostridium_phage	5.1e-12	29.2
WP_018241800.1\|1239807_1240461_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.5e-15	34.1
WP_018241799.1\|1240457_1241231_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.4e-23	30.2
WP_130652277.1\|1241235_1242519_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.4e-97	45.3
WP_018241797.1\|1242719_1243547_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	5.2e-53	46.5
WP_130652276.1\|1243543_1244155_-	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_003538990.1\|1244206_1244398_-	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.9e-09	72.1
WP_130652275.1\|1244581_1245298_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-40	47.0
WP_130652274.1\|1245294_1246152_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.6e-34	38.5
WP_130652273.1\|1246170_1247184_-	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	2.1e-24	42.6

DBSCAN-SWA_3

1505814 : 1516523

Synechococcus_phage(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166465711.1\|1505814_1508013_-	esterase-like activity of phytase family protein	E3SJA5	Synechococcus_phage	2.7e-80	40.7
WP_166465712.1\|1508108_1509008_-	DMT family transporter	NA	NA	NA	NA
WP_003558438.1\|1509380_1509656_-	HU family DNA-binding protein	A0A172Q061	Acinetobacter_phage	7.1e-07	34.1
WP_017959927.1\|1509862_1512280_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.5e-204	49.4
WP_017963839.1\|1512682_1513960_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-132	58.4
WP_003547334.1\|1514263_1514893_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	9.4e-63	59.2
WP_032980139.1\|1515269_1516523_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.0e-12	34.1

DBSCAN-SWA_4

2425844 : 2431486

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_113542201.1\|2425844_2426927_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	8.7e-141	71.9
WP_113542202.1\|2426931_2427852_+	GDP-L-fucose synthase	M1I5W5	Acanthocystis_turfacea_Chlorella_virus	4.8e-100	56.4
WP_113542203.1\|2428095_2428662_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.8e-34	41.0
WP_113542204.1\|2428675_2429731_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.4e-97	51.5
WP_113542205.1\|2429732_2430626_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.8e-34	38.9
WP_113542206.1\|2430622_2431486_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.7e-94	60.0

DBSCAN-SWA_5

3835044 : 3844972

Mycobacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_130759678.1\|3835044_3837312_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.7e-125	40.9
WP_018243700.1\|3837965_3838187_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.9e-17	52.1
WP_130759677.1\|3838201_3838606_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.1e-16	43.1
WP_130759676.1\|3838584_3840789_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	4.3e-211	51.4
WP_047623038.1\|3840876_3841851_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	2.8e-138	75.1
WP_047623012.1\|3841955_3843176_+	adenylate/guanylate cyclase domain-containing protein	M1HLN3	Pelagibacter_phage	5.4e-14	29.7
WP_130717984.1\|3843180_3843909_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	4.4e-40	37.6
WP_018446446.1\|3843905_3844262_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
WP_047623009.1\|3844261_3844972_-	7-cyano-7-deazaguanine synthase QueC	A0A2P1JXV3	Rhodococcus_phage	5.1e-49	48.2

DBSCAN-SWA_6

4713763 : 4727568

Vibrio_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_026230698.1\|4713763_4714969_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.1e-40	33.2
WP_130652814.1\|4715242_4715695_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.8e-15	38.7
WP_130652813.1\|4715701_4716592_-	hypothetical protein	NA	NA	NA	NA
WP_130652812.1\|4717262_4719272_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-88	41.9
WP_130652811.1\|4719271_4721152_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	1.5e-71	34.6
WP_112904278.1\|4721200_4721929_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.4e-49	42.0
WP_130652810.1\|4722093_4723281_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	4.4e-37	28.3
WP_130717301.1\|4723543_4724581_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	9.2e-15	66.7
WP_130652808.1\|4724591_4724939_+	GFA family protein	NA	NA	NA	NA
WP_018074040.1\|4725510_4727568_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.7e-36	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050111

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP050110

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP050108

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection