CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP050064	Bradyrhizobium diazoefficiens strain 172S4 chromosome, complete genome	2 crisprs	csa3,RT,DEDDh,WYL,PD-DExK	0	2	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050064_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050064_1

770881-771015

Orphan

Consensus_repeat	Method
ATGGCGGCTGGGGCCATGGCGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP050064_1

>merge|NZ_CP050064|1|770881-771015|CRISPRCasFinder
ATGGCGGCGCTGACCGTCGCGGCGGTCGGGCTCTCGGCGCCGCAGGCGGCCCAGGCGGGCGGCGGTTTTGGACATGGCGGCTGGGGCCATGGCGGCGGCTGGGGCCACGGTGGTGGCGGCTGGGGCCATGGCGGT

>NZ_CP050064|1|1|770881-771015|CRISPRCasFinder
ATGGCGGCGCTGACCGTCGCGGC	GGTCGGGCTCTCGGCGCCGCAGGCGGCCCAGGCGG
GCGGCGGTTTTGGACATGGCGGC	TGGGGCCATGGCGGCGGCTGGGGCCACGGTG
GTGGCGGCTGGGGCCATGGCGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050064.1\|WP_028175408.1\|764796_766167_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028175401.1\|774722_776012_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270306
NZ_CP050064.1\|WP_039183842.1\|780245_781589_+\|IS1380-like-element-ISBdi2-family-transposase	unknown	unknown	gnl\|CDD\|379340
NZ_CP050064.1\|WP_007602550.1\|767392_767611_+\|DUF3126-family-protein	unknown	unknown	gnl\|CDD\|371468
NZ_CP050064.1\|WP_028175402.1\|773758_774718_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP050064.1\|WP_028175410.1\|762883_764020_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028175400.1\|776054_777041_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP050064.1\|WP_011088330.1\|769304_769634_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_165448165.1\|770253_770418_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028175398.1\|778643_779999_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP050064.1\|WP_028175406.1\|768374_769082_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028175399.1\|778036_778246_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_011088329.1\|769720_770251_+\|gamma-carbonic-anhydrase-family-protein	unknown	unknown	gnl\|CDD\|100051
NZ_CP050064.1\|WP_028175403.1\|772123_772855_-\|Asp/Glu/hydantoin-racemase	unknown	unknown	gnl\|CDD\|226611
NZ_CP050064.1\|WP_028175404.1\|771450_771945_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377333
NZ_CP050064.1\|WP_011088320.1\|777311_778019_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP050064.1\|WP_039184817.1\|770414_770645_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028175407.1\|766442_767267_+\|serine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|182987
NZ_CP050064.1\|WP_028175409.1\|764055_764811_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|184875
NZ_CP050064.1\|WP_011088324.1\|772876_773755_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224098

Protein	Function_ID	Function_description	E-value
NZ_CP050064.1\|WP_028175398.1\|778643_779999_+\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	2.61159e-124
NZ_CP050064.1\|WP_028175401.1\|774722_776012_-\|extracellular-solute-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.09871e-27
NZ_CP050064.1\|WP_039183842.1\|780245_781589_+\|IS1380-like-element-ISBdi2-family-transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	0
NZ_CP050064.1\|WP_007602550.1\|767392_767611_+\|DUF3126-family-protein	gnl\|CDD\|371468	pfam11324, DUF3126, Protein of unknown function (DUF3126). This family of proteins with unknown function appear to be restricted to Alphaproteobacteria.	7.99579e-31
NZ_CP050064.1\|WP_028175402.1\|773758_774718_-\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	5.58029e-68
NZ_CP050064.1\|WP_028175400.1\|776054_777041_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	4.87852e-136
NZ_CP050064.1\|WP_011088329.1\|769720_770251_+\|gamma-carbonic-anhydrase-family-protein	gnl\|CDD\|100051	cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.	2.29785e-81
NZ_CP050064.1\|WP_028175403.1\|772123_772855_-\|Asp/Glu/hydantoin-racemase	gnl\|CDD\|226611	COG4126, COG4126, Hydantoin racemase [Amino acid transport and metabolism].	3.68113e-73
NZ_CP050064.1\|WP_028175404.1\|771450_771945_-\|hypothetical-protein	gnl\|CDD\|377333	pfam04375, HemX, HemX, putative uroporphyrinogen-III C-methyltransferase. This is a family of bacterial putative uroporphyrinogen-III C-methyltransferase proteins. It forms one of the members of a complex of proteins involved in the biogenesis of the inner membrane in E.coli. Uroporphorphyrin-III C-methyltransferase (HemX) is a single spanning inner membrane protein that regulates the activity of NAD(P)H:glutamyl-tRNA reductase (HemA) in the tetrapyrrole biosynthesis pathway.	0.00515461
NZ_CP050064.1\|WP_011088320.1\|777311_778019_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.39946e-43
NZ_CP050064.1\|WP_028175407.1\|766442_767267_+\|serine-O-acetyltransferase	gnl\|CDD\|182987	PRK11132, cysE, serine acetyltransferase; Provisional.	5.34714e-120
NZ_CP050064.1\|WP_028175409.1\|764055_764811_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|184875	PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional.	9.91458e-24
NZ_CP050064.1\|WP_011088324.1\|772876_773755_-\|ABC-transporter-permease	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	9.52492e-52

>NZ_CP050064.1|WP_039184817.1|770414_770645_-|hypothetical-protein
MRKLIAFDEDTFDKLKQLGRDRMATFQELADEAFADLLKKHGIPIDLRDALRKSARLGAEPDKPAARPKSGNAKSR
>NZ_CP050064.1|WP_165448165.1|770253_770418_-|hypothetical-protein
MTDRDPFAEGERAARDNIPAEANPYSDGSDEHALWAAGHEKGAGAMEARESEGS
>NZ_CP050064.1|WP_011088329.1|769720_770251_+|gamma-carbonic-anhydrase-family-protein
MAIYELDGQAPDLPADGNYFIAETATVIGRVRLKPGASVWFGAVLRGDNEWIEIGEGANVQDGSTCHTDLGFPLVIGKNCTVGHNVILHGCTIEEGALIGMGSIVMNGAKIGRNSIVGAGSVITEGKEFPERSLIIGSPARVMRTLDDAQVQRMGSAAKFYVANGPRFTKGLKRIG
>NZ_CP050064.1|WP_011088330.1|769304_769634_+|hypothetical-protein
MTPEALNSFFSIGIGFALAGALVNGYQAVAQRPAGFGLLQDGVAPKTFAAVPFLVFAAPFIIMRNTLRGMRLESRRLEFVMMATVIAGFWSMMSGTFFLMTLRATGVLG
>NZ_CP050064.1|WP_028175406.1|768374_769082_-|hypothetical-protein
MTVFSAASPRSPRTRTRAHIVPIVLGGAAAVCAVALVAYLLWPTWGTSGANAPDKLPVSVGGTLFNLPTTAIRMKIQRHSGPQERIDLDFLYPSLEPPGTPKHVSADTVDASLLPIDRIFLSIAAHHDALSPEQRTATIYPRYLEPGATMPEDGLTMRMFRADTPYGSEDLYSAASPALTARCTRDAATPGMCLSERRVGGADLTFRFPRSWLSQWRDAAEAMEKLTAQLRGPKS
>NZ_CP050064.1|WP_007602550.1|767392_767611_+|DUF3126-family-protein
MDVKEVRKLDAYLKRVFGNPKIRVVPRPKKDDSAEVYIGEEFIGVLFVDDEDDDRSFQFQMAILEDDLVDQE
>NZ_CP050064.1|WP_028175407.1|766442_767267_+|serine-O-acetyltransferase
MAVHQVNPGGKLASLDPIWDRIRSEAEDIVHREPELATFIYSTVLHHSRLEDSVIHRLADRLDHSALSGDLVRQTYDEALRDDPDLGNAFRADLVAVYDRDPATSRFIDPLLYFKGFHAIQTHRLAHWLWLKGRKDFAYYLQSRASAVFQTDINPAARIGRGIFLDHATGFVCGETAVIEDDVSILHGVTLGGTGKENEDRHPKIRHGVLIGAGAKILGNIEIGHCARIAAGSVVVKPVPHNVTVAGVPAKIVGEAGCAEPSRTMDQMINAMGL
>NZ_CP050064.1|WP_028175408.1|764796_766167_-|hypothetical-protein
MTTTTDHLRARPAGSFWVRLAALALPLLMIAPAFWNGYPLLQWDTGGYLARWYEGYLVPSRSTVFGLYLHSGESFGFWINLAIQSLATLWLLQLSLRVLGLLQTFRFVAISLLLILSTALPWLASMLLTDIFAGLSVLSLFLLVVGAQRTSPHEKIALFVFTAFAAATHSATLGVLLGLCLAGWMARPFVGRRLPLAGLAQASMTIVAGGLMLVSANHALSGKWAWTPGGYGVAFGRMMQDGIVARYLNDHCPRESFKLCPYRNELPATADEFLWGKSVFNALGRFEGMNDEMSYIVVHSLADYPAWQAGAAMRAVGQQLLHVATGEGTSGWIPHTYGIIERYIPAQIAPMRAARQQQWDVNFDYVNWLHVPVALASMLALVGLLAHALARRRLDDLTLLAATVTLALLGNAFICAVISGPHDRYGARMVWVATFVVLMALARAFGDEEPKGSAAA
>NZ_CP050064.1|WP_028175409.1|764055_764811_+|alpha/beta-fold-hydrolase
MPSFHNGAVEIAYLDEGEGDPIILVHGFASSKNVNWVYPTWVSELRKNGRRVIALDNRGHGESAKLYEPAQYSIPTMAGDVLALMDHLAIPQADIMGYSMGGRMTAWLSLNEPQRLRSAILGGIGIGGLIEGTGPGENVAKALEAPALDDVSDPVGRTFRAFADQTRSDRRALAACLRGTRDLMTRGEAARIDVPVLIAVGSTDDVAGSASALGAIIPGSEVLDIPGRDHMRAVGDKAYKTGVLDFLSRRG
>NZ_CP050064.1|WP_028175410.1|762883_764020_+|hypothetical-protein
MKWLRISTALTGIAACSFMLAQVAPHAREAGAILAARDDPAALSELKLDAVLRQNDRLVQDNIEAALAAGDADLADSFVALARDRNIAVPDDLLARVSDAVKEENSTSHFARRFATGLVTGSADDVASLSGTVVGDLFVIGDVRDVVREGKHLAMGEDTDRLVLGLAAAGLAVTAATYVSIGGAAPVRAGLTLVKDARKVGRLGEGLAAWAGRSAREVVDTPVLQNAVASGSVLRPGQTVSAIKAAFRAEKAGALVRLGKDVTRVAEKTSTRGAMDSLRIAEGPKDVARAARLAEAQGSKTRAIMKLLGRGALLLVGGAFDLALWLFGAALTLFGLLSSIKATTERLTQAWCDRRRARRLRRAQVAAEAALASAAGPA
>NZ_CP050064.1|WP_028175404.1|771450_771945_-|hypothetical-protein
MIDLAQDTPSNPLLRLGAQPIALTAAALLLLIAGVTSIAIWRAYTGAAPEADRVVASRQLQARTAQASEQLVEKTKGLEATQQESIDQLQVVQDQLQTVKRLLAAQQADTKRLSEQVATLNESIDGLRQSFASARATEAETPSVTRRKPARHRVHASARKRSRG
>NZ_CP050064.1|WP_028175403.1|772123_772855_-|Asp/Glu/hydantoin-racemase
MRLHVVNPNTTASMTAKIAAAARSVALPGTEIDARQPTMGPVSIEGFYDEAFAVPGMLGCIRKADRDGADAHIIACFDDTGLDAARAVAKAPVIGIGEAGFHMASLIAARFAVVTTLGVSIVPIEHNLTKYGLAGRCARVRAAEVPVLALEERNADALAKISAEITAAIRDDRAEAVVLGCAGMADLAAELAATHGLPVVDGVAAAVTLAEALVRLGLKTSRLGPYAAPRLKTYSGPFSPFQP
>NZ_CP050064.1|WP_011088324.1|772876_773755_-|ABC-transporter-permease
MKEGRPRSFYVLAIFFAAYVLFLYGPMIAIYVLSFQGPQGGLTFPMNGVSTFWIAKLFQGTGIVDLGAAFRRSLLLGLIVMIVTVVLSVAAGMAFRRRFKAQSILFYSAIASLIVPSIITSLGISLEFRIIDDLIKAHWNENFETSMGLLTSGLGAHLTWTLPFGLLIMFAIFNRFDPRLEEAARDLGATPWQAFRHVVLPIILPSVIGIGLFGFTLSWDELARSSQAIGAVNTLPLDLQGLTTTVTNPDIYALGTVISAVSFTVITLALGTIHVLNKRQAAKGSDAGKGLV
>NZ_CP050064.1|WP_028175402.1|773758_774718_-|ABC-transporter-permease
MDTSEDILQQASPGLIPGSGTARAAKPTRLSPSFISWLQAGPMMLVFLAFFLIPLVFVVIVSFWDYNEYQLLPAFSGRGYTDTFEGCITQLPDLCTIGKTYLMTLKLCFLVWAITLFIGFWVAYFLAFHIKSKTWQMGLSLLCTIPFWTSNVIRMIAWIPLLGRNGLVNSGLVKTGLINQPLEWLLFSEFSVVLALVHLFTFFMVVPIFNSMVRIDKSLIEAAYDAGATGFQTLVNVVIPLAKPGIVIGSIFVITIVMGDFITIGVMGGQQIAAAGKIIETRVNALQFPAAAANAVILLAITFLIITMMSRIVDIKKEL
>NZ_CP050064.1|WP_028175401.1|774722_776012_-|extracellular-solute-binding-protein
MTETTRTKGVSRRTLLKGTAGLAGLAAGSGAITGFPYVKSADAKVLRYLGTAVNEGDDISKQCLKDTGIKIEYITATTDDVTKRVMTQPNSFDVLDTEYFSLKKLVPSGNILALDARKIKEFDNITPVFTKGQTPGGKKIGNQGTAPWKVLYLEGKDSKKFATSATEFVTLIPTVYNADTLGIRPDLIKRPISSWSELLNPEFKGKASILNIPSIGIMDAAMVVEATGKYKYADKGNMTKEEIDLTMKVMTEAKKAGQFRAFWKDFNESVNLMASGETVIQSMWSPAVTKVRSMGIPCTFQPLKEGYRSWASGFCVSKGVSGAKLEWAYEFVNWFLSGYAGAYLNRQGYYSAVLSTAKAHMEPYEWAYWMEGKPAEKDIKAPDGSLLEKAGAVRDGGSYEDRMGGVACWNAVMDENDYMVRKWNEFIAA
>NZ_CP050064.1|WP_028175400.1|776054_777041_-|ABC-transporter-ATP-binding-protein
MATPAALELVAVTKRYDTTLAVDDVNLKIPAGTYCCLLGPSGCGKTSTLRMIAGHEAVSEGDIILGAQNVTDLEPAKRGTAMMFQSYALFPHLTVLDNVAFALKMRGIDRATRHKRAGELLELVAMTPYAARLPAQLSGGQQQRVALARALITEPQILLLDEPLSALDPFLRVKMRGELKRLQRELGISFIQVTHGQEEAMALADHIVVMNHGKIEQQGTARDIFHHPRTEFVARFIGGHNVLSDAGKLIAVRADQLGIVPFADGAYGAPALLTQTEYQGSYIAVSLTLDDGTALFSHLPEAAFDVHPFRPGDRVLATWDPAKAQRLQ
>NZ_CP050064.1|WP_011088320.1|777311_778019_+|GntR-family-transcriptional-regulator
MAAKTRQKSDAPDASDRVSRIREGVTAAILEHRLLPGTKLGEDEIGEIYGASRTLVRTALQQLAHEGIVNIEKNRGAFVARPTPADAREVFEARRLIEPTIVDHACEAASPAWLERLGRHLTEEREAELRGDARASVRLSGEFHKLVAEMSGHSIYLGFLKELIARSSLIILLYRRHDTPACGTDHHAGIVAAIRKRDKQAARAQMLSHLNEIEAELFLKDPAADETRLADVLGT
>NZ_CP050064.1|WP_028175399.1|778036_778246_-|hypothetical-protein
MVTQTSDGHVLLVKKLGGLFAIIIGCLLTAVGVTFESSGTTFVGVLFLVLGAGLLVLKIVRRNEGSSLP
>NZ_CP050064.1|WP_028175398.1|778643_779999_+|amidohydrolase-family-protein
MRDLTTPAGLFRVAALLMSVGTSLCLSSQTRAQQDSAVLFRNVRIFDGKSGALSAASNVLVRNTKIEKISTANITADAQAIDGGGRVLMPGLIDAHWHAMLVRPTPAAALGDVGYNNLLAASEATATLMRGFTTVRDMGGPSFGLKRAIDEDLVAGPRIYPSGAIITITSGHGDFRQLSDLPRTIGGMLSRMEQVGGSMVADSPDEVRVRAREQLMQGASQVKLTAGGGVASPFSPLDVSTFTEPELRAAVEAADNWGTYVATHAYTPVAIQRSIAAGVRCIEHGHLMDEASAKLIAEKGIWLSTQPFLDMSMAAALGPAEQDKMRQVVTGTDRVYALAKKYGIKTAFGTDVLFSKALADRQGSMLAALTRWYTPAEALAMATSANAELLSLSGPRNPYPGKLGVVEEGALADLLLVDGNPLDNITLVEDPAKNFVVIMKGGKVYKNIVPR
>NZ_CP050064.1|WP_039183842.1|780245_781589_+|IS1380-like-element-ISBdi2-family-transposase
MTDDTIPPFSFPAIHAKKVTAAFDGGRLTSNGGVMLLAMAERRLGLADNLARVFPDRRDPTRVVHSLVDMFRARMFAICCGYEDADDLDHLRSDPAFKLACGRLPDTGRDLCSQPTLSRLENAPRLRDVIRLTYILVDAWMDSYPHEPASVTLDIDDTCDVVHGHQQLSLFNAHYDERCFLPIHVYDTEKSRPVAVVLRPGKTPGGVEVRAHLRRLVRHIRTRWHNTRITFRGDGHYARPEAMAWCETNGIDYIFGLSGTKPLARKVDEVADDIRTRRAIENLPVLRGYTETRHKAKSWDRERRTVARIEATMLGLDIRFVVTSLDVGSAEWIYDSLYCARGQAENLIKLHKTQLASDRTSCRSALANQVRLVLHTAAYWLMLTVRDAIPKARELATAEFATLRLRLLKLAARVVETTSRIRLAFAAACPEADLIRGLPGALLPLGP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050064_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050064_2

8642540-8642640

Orphan

Consensus_repeat	Method
CCGCCGCAGGGACCGGTGATGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050064_2

>merge|NZ_CP050064|2|8642540-8642640|CRISPRCasFinder
CCGCCGCAGGGACCGGTGATGTCACCGGATGATCCCCGTTATGGCCGTCCCGCCGGCGCTCCCGTCTACTCGGCTGCGCCGCCGCAGGGGCCGGTGATGTC

>NZ_CP050064|2|2|8642540-8642640|CRISPRCasFinder
CCGCCGCAGGGACCGGTGATGTC	ACCGGATGATCCCCGTTATGGCCGTCCCGCCGGCGCTCCCGTCTACTCGGCTGCG
CCGCCGCAGGGGCCGGTGATGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050064.1\|WP_028176314.1\|8650401_8650737_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_011089421.1\|8651336_8651609_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|381078
NZ_CP050064.1\|WP_028176315.1\|8648598_8649825_+\|lytic-murein-transglycosylase	unknown	unknown	gnl\|CDD\|274067
NZ_CP050064.1\|WP_028176313.1\|8650871_8651174_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227244
NZ_CP050064.1\|WP_028174595.1\|8640270_8641122_+\|3-mercaptopyruvate-sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP050064.1\|WP_028152332.1\|8637105_8637948_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP050064.1\|WP_028176316.1\|8646489_8646705_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_028174592.1\|8633837_8634431_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP050064.1\|WP_028174590.1\|8631769_8632603_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226231
NZ_CP050064.1\|WP_028176317.1\|8645395_8646358_-\|D-2-hydroxyacid-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|240646
NZ_CP050064.1\|WP_028174593.1\|8634445_8636092_+\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
NZ_CP050064.1\|WP_011089423.1\|8649908_8650190_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050064.1\|WP_039186101.1\|8641124_8641940_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236138
NZ_CP050064.1\|WP_011089420.1\|8651742_8652231_+\|bacterioferritin	unknown	unknown	gnl\|CDD\|153099
NZ_CP050064.1\|WP_028174594.1\|8638055_8638301_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
NZ_CP050064.1\|WP_028174591.1\|8632770_8633697_+\|SMP-30/gluconolactonase/LRE-family-protein	unknown	unknown	gnl\|CDD\|369882
NZ_CP050064.1\|WP_011089425.1\|8646941_8648591_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP050064.1\|WP_028144467.1\|8643938_8645315_+\|group-II-intron-reverse-transcriptase/maturase	RT	pfam00078_RT_CAS-I:CAS-III	gnl\|CDD\|275209
NZ_CP050064.1\|WP_018641027.1\|8639731_8640145_+\|rhodanese-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|238724
NZ_CP050064.1\|WP_011089432.1\|8638424_8639600_+\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226346

Protein	Function_ID	Function_description	E-value
NZ_CP050064.1\|WP_011089421.1\|8651336_8651609_+\|bacterioferritin	gnl\|CDD\|381078	cd19945, Fer2_BFD, bacterioferritin-associated ferredoxin (BFD) [2Fe-2S]-binding domain. This family includes Escherichia coli and Pseudomonas aeruginosa bacterioferritin-associated ferredoxin BFD which binds an [2Fe-2S] cluster and appears to interact with bacterioferritin (E. coli BFR/YheA and P. aeruginosa BfrB), a dynamic regulator of intracellular iron levels. It has been suggested that BFD and bacterioferritin form an electron transfer complex which may participate in the iron storage or iron immobilization functions of bacterioferritin. For Pseudomonas aeruginosa, it has been shown that mobilization of Fe3+ stored in BfrB requires interaction with BFD, which transfers electrons to reduce Fe3+ in the internal cavity of BfrB for subsequent release of Fe2+. The stability of BFD may be aided by an anion-binding site found within this domain. In addition to BFD, the BFD-like [2Fe-2S]-binding domain is found in a variety of proteins such as the large subunit of NADH-dependent nitrite reductase and the Cu+ chaperone CopZ. It comprises a helix-turn-helix fold, and binds an [2Fe-2S] cluster via 4 highly-conserved Cys residues, found in loops between the alpha-helices. For the class of proteins having a BFD-like [2Fe-2S]-binding domain, the Cys residues are organized in a unique C-X2-C-X31-35-C-X2-9-C-arrangement. [2Fe-2S] clusters are sulfide-linked diiron centers, a primary role for which is electron transport.	2.88076e-05
NZ_CP050064.1\|WP_028176315.1\|8648598_8649825_+\|lytic-murein-transglycosylase	gnl\|CDD\|274067	TIGR02283, Membrane-bound_lytic_murein_transglycosylase_B, lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	1.49725e-142
NZ_CP050064.1\|WP_028176313.1\|8650871_8651174_+\|hypothetical-protein	gnl\|CDD\|227244	COG4907, COG4907, Predicted membrane protein [Function unknown].	0.00023871
NZ_CP050064.1\|WP_028174595.1\|8640270_8641122_+\|3-mercaptopyruvate-sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	7.74486e-107
NZ_CP050064.1\|WP_028152332.1\|8637105_8637948_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	2.8811e-46
NZ_CP050064.1\|WP_028174592.1\|8633837_8634431_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	6.60111e-22
NZ_CP050064.1\|WP_028174590.1\|8631769_8632603_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|226231	COG3708, COG3708, Uncharacterized protein conserved in bacteria [Function unknown].	3.196e-49
NZ_CP050064.1\|WP_028176317.1\|8645395_8646358_-\|D-2-hydroxyacid-dehydrogenase-family-protein	gnl\|CDD\|240646	cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases. Phosphoglycerate dehydrogenases (PGDHs) catalyze the initial step in the biosynthesis of L-serine from D-3-phosphoglycerate. PGDHs come in 3 distinct structural forms, with this first group being related to 2-hydroxy acid dehydrogenases, sharing structural similarity to formate and glycerate dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily, which also include groups such as L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. Many, not all, members of this family are dimeric.	5.91884e-169
NZ_CP050064.1\|WP_028174593.1\|8634445_8636092_+\|choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
NZ_CP050064.1\|WP_039186101.1\|8641124_8641940_-\|hypothetical-protein	gnl\|CDD\|236138	PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated.	9.23613e-08
NZ_CP050064.1\|WP_011089420.1\|8651742_8652231_+\|bacterioferritin	gnl\|CDD\|153099	cd00907, Bacterioferritin, Bacterioferritin, ferritin-like diiron-binding domain. Bacterioferritins, also known as cytochrome b1, are members of a broad superfamily of ferritin-like diiron-carboxylate proteins. Similar to ferritin in architecture, Bfr forms an oligomer of 24 subunits that assembles to form a hollow sphere with 432 symmetry. Up to 12 heme cofactor groups (iron protoporphyrin IX or coproporphyrin III) are bound between dimer pairs. The role of the heme is unknown, although it may be involved in mediating iron-core reduction and iron release. Each subunit is composed of a four-helix bundle which carries a diiron ferroxidase center; it is here that initial oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of ferric-hydroxyphosphate at the core. Some bacterioferritins are composed of two subunit types, one conferring heme-binding ability (alpha) and the other (beta) bestowing ferroxidase activity.	1.63988e-75
NZ_CP050064.1\|WP_028174594.1\|8638055_8638301_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	9.16863e-10
NZ_CP050064.1\|WP_028174591.1\|8632770_8633697_+\|SMP-30/gluconolactonase/LRE-family-protein	gnl\|CDD\|369882	pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.	5.45337e-62
NZ_CP050064.1\|WP_011089425.1\|8646941_8648591_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0
NZ_CP050064.1\|WP_028144467.1\|8643938_8645315_+\|group-II-intron-reverse-transcriptase/maturase	gnl\|CDD\|275209	TIGR04416, hypothetical_protein, group II intron reverse transcriptase/maturase. Members of this protein family are multifunctional proteins encoded in most examples of bacterial group II introns. These group II introns are mobile selfish genetic elements, often with multiple highly identical copies per genome. Member proteins have an N-terminal reverse transcriptase (RNA-directed DNA polymerase) domain (pfam00078) followed by an RNA-binding maturase domain (pfam08388). Some members of this family may have an additional C-terminal DNA endonuclease domain that this model does not cover. A region of the group II intron ribozyme structure should be detectable nearby on the genome by Rfam model RF00029. [Mobile and extrachromosomal element functions, Other].	1.14804e-176
NZ_CP050064.1\|WP_018641027.1\|8639731_8640145_+\|rhodanese-like-domain-containing-protein	gnl\|CDD\|238724	cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain. This domain is believed to serve as a polysulfide binding and transferase domain in anaerobic gram-negative bacteria, functioning in oxidative phosphorylation with polysulfide-sulfur as a terminal electron acceptor. The active site contains the same conserved cysteine that is the catalytic residue in other Rhodanese Homology Domain proteins.	3.04149e-55
NZ_CP050064.1\|WP_011089432.1\|8638424_8639600_+\|VWA-domain-containing-protein	gnl\|CDD\|226346	COG3825, COG3825, Uncharacterized protein conserved in bacteria [Function unknown].	0

>NZ_CP050064.1|WP_039186101.1|8641124_8641940_-|hypothetical-protein
MGPGHLAAGAEIRNPSMLPGFRFLLAAILLSTSILVFGLGAAALLRASHEQYVSNPSWRNGPQEQMFAQASEPAQPVLAALRAEPEPAEPTAPSLRDQVPTIALPVSEPEQVAAVTSEADAEPQVATPSAEAPAAEPAKTETTTEATAPAPTDTLTPADTTASIPEAPPVPTAGAPAPADPSLALESSALDAASARMAALNDPATTAWKDPPAKAKADSSAPDSKATKPRAKAKKRHRVVRRPPPQQLQQSLDPFGQPQQTFATTTTRARQ
>NZ_CP050064.1|WP_028174595.1|8640270_8641122_+|3-mercaptopyruvate-sulfurtransferase
MTPDPLVSTEWLAAHINDANLKVLDASFKLPGVLPLPKDDYLAAHLPGAVFFDVDAVSDHSNPLPHMYPSAEQFGRDVGNLGIGNADTVVIYDAGGWVAAPRAWWMFLAFGHGNVRILNGGLKKWRAEGRPVESGEVKPKPATFKASYDSKRVRSMQQLIANVESNKEQVIDARAADRFEGRAPEPRAGIRSGHIPGARNVPYNLLFDAATGTMKPLDDLRAAFTGAGVKLDAPIVTSCGSGVSAGVLTLALYRLGITDTALYDGSWSEWGQAGGPPVATGPA
>NZ_CP050064.1|WP_018641027.1|8639731_8640145_+|rhodanese-like-domain-containing-protein
MPQTITRGIKALIDEANAEIETLTAKDAIEISKNGDVVIVDIRDPREIERDGRIPGAFACTRGMLEFWIDPQSPYAKPIFQEDKKFVFHCAGGLRSALAAKTAQDMGLKPVAHIAGGYAAWRDAGGPTEQWEPKKKG
>NZ_CP050064.1|WP_011089432.1|8638424_8639600_+|VWA-domain-containing-protein
MFLQFFTSLRDAQVPVTLREYLTLMEALDADLADYTVENFYYLSRASLVKDERNLDKFDRVFGTVFKGLESLLEAMDKAEIPEEWLKKLAEKYLTEEEKKQIEAMGWDKLMETLKKRLEEQKGRHQGGSKWIGTAGTSPFGAHGYNPEGVRIGQEKNRNNRAVKVWDKREFKDLDGNVELGIRNIKVALRRLRKFARTGAPDELDLDTTIRETANHGYLDVHMRPERRNAVKLLVFFDIGGSMDSHIEQVEELFSAAKSEFKHMEYFYFHNCLYEGVWKQNKRRFTDRTPTWDVLHKYPHDYKVVFVGDASMSPYEIMVPGGSVEHVNEEPGSVWLDRIIRTYPHTVWLNPVAQKHWDYSESTTIIKRIFTNRMFPITIEGLEGAMKELTH
>NZ_CP050064.1|WP_028174594.1|8638055_8638301_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MGILAALIIGAIAGWLAGKIVHGAGFGLIGNIVVGIIGALVAGWVLPQLHIQLASGTVGAIVDATIGAVIVLVILSLIKRV
>NZ_CP050064.1|WP_028152332.1|8637105_8637948_-|MoxR-family-ATPase
MKFTGTKDYVATDDLKVAVNASIVLERPLLIKGEPGTGKTVLAEEVAKALNAPLLTWHIKSTTKAQQGLYEYDAVSRLRDSQLGDARVSDIRNYIKRGKLWEAFTAEQRPVLLIDEIDKADIEFPNDLLLELDRMEFHVYETGETIKAKQRPIMMITSNNEKELPDAFLRRCFFHYIKFPDADTMGRIVDVHFPGIKKRLVEEALRIFFEVREVPGLKKKPSTSELLDWLKLLLNEDMSVEQLRERDPRKLIPPLHGALLKNEQDVHLFERLAFLSRREV
>NZ_CP050064.1|WP_028174593.1|8634445_8636092_+|choline-dehydrogenase
MDRFDYVIVGAGSAGCVLANRLSEDPNVSVCVLEAGPSDWHPYIHLPAGFIKTFHMKSINWAYQQEPGPYTGGRSIYAPRGKTLGGSSSINGHIYNRGQRMDFDTWAQMGNRGWGYADVLPYFKRLEKRVGEGEDTYRGRDGNLIVTTMDWRDPLCEAFMEGAVSLGIPRNPDYNGAKQEGVSYCQRTINNGLRVSGSTAFLKPAMKRPNVHVHTHAHATGIIFEGKRAVGVRYTKGGRGGTPVEVRANKEVILSGGTYNSPQLLQLSGVGSPDLLGAHGIAVRHALPVGEGLQDHYAPRTVARVKDIKTINELRRGFSLWIEALKWATARRGLLSLSPTMVYCFWHSGESAESSDLQLTFTPASYKEGVQGQLEDEPGMTVASWQQRPESRGYVRIRSADPFAPPIIQTNYLDAELDRRVIVGGMKLARRLLKSAPLSPYYAYEDFPGPNINTDDEFLAAATERGTTTFHPGCTCRMGPADSTWAVVDDQLRVHGLEGLRVIDASVMPRMISANLNASTMMIADRASDLIRGKVPMEAARIPDAAVA
>NZ_CP050064.1|WP_028174592.1|8633837_8634431_+|GNAT-family-N-acetyltransferase
MPWPDPITLRGQHARLEPLSHQHIEGLTEAVKDGELSKLWYTAIPLPENMGKEIDRRLALQAAGSMLPFTVFDAGGNIVGMTTYMNIDATNRRVEIGSTWYGKSAQRGPLNTQCKLLLLRHAFETLNCIAVEFRTHFFNHQSRRAIERLGAKQDGILRSHQVAPNGTLRDTVVYSITAAEWPTVQAHLEFQLNDKPR
>NZ_CP050064.1|WP_028174591.1|8632770_8633697_+|SMP-30/gluconolactonase/LRE-family-protein
MSDVRVLATDLEFPEGPVVMPDGSVVLVEIRGQRLTRVHPDGRKEIVAKVPGGPNGAALGPDGKIYICNNGGFSWIPTGQMIMPGPQPDNYLGGSIQRVDLQSGKVETVVTKCGEHELRGPNDLVFDRHGGLWFSDLGKRRAREMDVGGMYYLKPGMKEVVEVVHGVLPANGIGLSPDENTVYIAETPTARLWAYELSAPGTLRPREVIYRGERGKPICGLGGYQMFDSLAVEANGNVCVATLVSGCISVIAPDGTLVEQVPTGDRVTTNIAFGGPGLKTAYITLSGKGELIAMDWPRGGLPLNFLNK
>NZ_CP050064.1|WP_028174590.1|8631769_8632603_+|AraC-family-transcriptional-regulator
MNPAQRALWYIESHLAEPMTLDEIAAISGVSRFHIVRAFAAATGLPVMRYVRARRLTEAARSLANGAPDILSLALEADYGSHEAFTRAFRDQFGTTPEAVRVATCTGHLKLQEPILMDSTISDTLAPPRFETATAFLVAGISERISCDNGAIIPGMWQRFHQEVADIPARVGNVAYGVCCNGDDAGNFDYIAGVEVSDYSDLPRRFGRIRIPEQRYAVFAHTDHVASIRRTVNTIWNQWLPASGLKAADAPSFERYDEKFDPATGNGGFEIWVPVRG
>NZ_CP050064.1|WP_028144467.1|8643938_8645315_+|group-II-intron-reverse-transcriptase/maturase
MRQKNQVELNLSPGAEGEARSAGAREPEARAAEVCLERPAVAGPSMEDVVESENLKAALAQVKRNKGAAGVDGMTVGELSAHLKEHWPAIRAQLLDGTYKPQPVRRVEIPKASGGLRPLGIPTVLDRLIQQAVMQVLQADWDRTFAETSFGFRPGRSAHRAVERAQAYIAAGHSIVVDIDLEKFFDRVNHDILMGLVAKRVADKRILKLIRAFLNAGVLEGGLVSPTEEGTPQGGPLSPLLSNLMLDVLDKELEKRGHRFVRYADDCNIYVRSQRAGERVLAGVERFLEKRLKLKINKAKSAVAKPSVRKFLGFSFTGGQEPRRRIAPQALARFKAKVRELTRRTRGRCLVQIAKELSTYLIGWHGYFGFCQTPSVLRVLDQWIRRRLRAVAWKQWKYGPARFAELRRRGVGRDLAAQTAGSPRGPWRLANSPALTIALPNGFFASLGLASVAARRPA
>NZ_CP050064.1|WP_028176317.1|8645395_8646358_-|D-2-hydroxyacid-dehydrogenase-family-protein
MTRLRCAILDDYFNIALDVADWPKLSDRIDVTVFSHPFTSEQAAASALADFEIVCAMRERTAFPKSLFDGLPKLKLLLTSGMRNASIDMEAAKAKGVAIGGTQYSRDPTAPLTMGLILELTRGIGRENARMHAGEPWQTFAGVEIEGLTLGIVGLGKLGSKMAGIAKAFGMNVIAWSPNLTPEKCKAAGVGYATKEELFAKADIVTIHVVLSERSRGLVGAADLARMKPTAFLVNTARGPIVDEQALLEALQQRKIAGAGLDVFSVEPLPVDHPFRKLDNLVLTPHLGYATEDGLRIHYGQMVEAIDAWTRGGELPRKLA
>NZ_CP050064.1|WP_028176316.1|8646489_8646705_-|hypothetical-protein
MALTETNSFPVPAEAGSTSALVAEIKGFWKGFFATAFNPYRPELHYMRGPGPAWRAKHGMDAPVRLKPRDP
>NZ_CP050064.1|WP_011089425.1|8646941_8648591_+|energy-dependent-translational-throttle-protein-EttA
MARQFIYFMQGLTKSYPTRKVLDNIHLSFYPDAKIGVLGVNGSGKSTLLKIMAGLDKEYNGEAWVAQGARVGYLEQEPQLDAKLSVRENVMLGVAKQKAILDRYNELAMNYSEETADEMTKLQDEIEAQGLWDLDSKVDQAMDALRCPPDDADVTKLSGGERRRVALCRLLLDQPELLLLDEPTNHLDAESVSWLEGHLRNYPGAILIVTHDRYFLDNVTSWILELDRGKGIPYEGNYSSWLVQKQKRLEQEGREDAAHQKTIAREQEWVASSPKARQAKSKARYQRYEELLKQASEKQTQTAQIIIPVAERLGANVVDFEGLSKGYGDRLLIDDLTFKLPPGGIVGVIGANGAGKTTLFKMITKQETPDKGTITVGETVHLGYVDQSRDALDGNKNVWEEISGGNELILLGKKEVNSRGYCSSFNFKGADQQKKVGALSGGERNRVHLAKMLKSGANVLLLDEPTNDLDVDTLRALEEALEDFAGCAVIISHDRWFLDRIATHILAFEGDSHVEWFEGNFQDYEKDKMRRLGQDSIIPHRVKYKKLTR
>NZ_CP050064.1|WP_028176315.1|8648598_8649825_+|lytic-murein-transglycosylase
MMRRALIAAVIVVTCGWSSARAADAAFTQFIASLWPEAQAAGVSRATFEQETRGLEPDYKLPDLILPGRPATGAPSQAEFVQVPADYVRDASIARLAGEGQRLLQKYRPALTEIEKSSGVPATVMLAIWGRETDYGRYTLPYDLVRVLATQAYVGRRKDTYRNEFILSLKILGEGMVTRKDMRSSWAGATGLTQFLPSEYYKHGVDFDRDGRIDIWHSVPDALASAAQQLVNKGWQSGVRWAYEVQAPAKVDCTTGVPEVTKPISQWLREGFVPVRGQKLSAAEQAQPASLLQPEGIYGPSFLTTKNYFVIKEYNFSDLYVLFVGHLSDRMTSPLPFATPWSASKQLRTRDVETMQRGLTRVGLYKDKIDGKAGMQTRAALGAYQKSAGLKVDCWPSEEVLRSIEAAR
>NZ_CP050064.1|WP_011089423.1|8649908_8650190_-|hypothetical-protein
MKKTLVAALTVATVAGSLVTAAPSAKAHDGVGAGIAAGLIGGAIVGGAIASSRPAYGGPVYVAEPPPPAPCYWQRQRYWDGYGWVIRPVRVCY
>NZ_CP050064.1|WP_028176314.1|8650401_8650737_-|hypothetical-protein
MKKSLLAVAALTAVALTAGTPAHAQRGVAAGVAAGIIGGAIVGGALASPYYYGPGPGYAYGPGYGPGYYPPRYYAPGPGYVADDYYGGCVWQRQRFWDGYGWRVRRVRVCG
>NZ_CP050064.1|WP_028176313.1|8650871_8651174_+|hypothetical-protein
MMGNAMINALIAAGIVFAIGYGWITHLQNRGQRRSRAGAGSDGGGDSYSGTSDGFSLGSWFSSDSSGNSTDTGSCSSSDSGSSGGDCGGGGDGGGGGGGD
>NZ_CP050064.1|WP_011089421.1|8651336_8651609_+|bacterioferritin
MIVCSCNVLSDDDIRAAVAESDDAVRHAKQVYGCLGCSAECGRCARTIKTIIDEALGPCAKSCCSGCPHSHTVAANDETAESAQFALAAC
>NZ_CP050064.1|WP_011089420.1|8651742_8652231_+|bacterioferritin
MQGDAKVIDYLNKALRHELTAINQYWLHYRFLDNWGLLDMAKVWRKESIEEMEHADKLTARILFFDGFPNMQVLDPLRIGQNVKEIIECDLAAEMSARALYQEAATYCHGVKDYVTRDLFEKLMSDEEHHIDFLETQLDLIGRIGLELYTQKHVGGLEGEGH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	78661-78691	5	0.839
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	505686-505716	6	0.806
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NC_013852	Allochromatium vinosum DSM 180 plasmid pALVIN01, complete sequence	21518-21548	6	0.806
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	204183-204217	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1999543-1999577	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1646302-1646336	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1646302-1646336	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	447462-447496	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	583611-583645	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1042267-1042301	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	445924-445958	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	430264-430298	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	428775-428809	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	445920-445954	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	430266-430300	7	0.8
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	893359-893393	8	0.771
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	41729-41759	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1467783-1467813	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	345285-345315	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP017986	Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence	98230-98260	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018714	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence	204150-204180	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP026745	Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence	100326-100356	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018385	Burkholderia pseudomallei strain 2008724860 plasmid p1, complete sequence	158296-158326	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP020446	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed6, complete sequence	7629-7659	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018313	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence	44479-44509	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018687	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence	66372-66402	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NC_006362	Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence	163705-163735	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018720	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence	75883-75913	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018702	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence	56326-56356	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP024428	Paracoccus yeei strain TT13 plasmid pTT13-6, complete sequence	3678-3708	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	CP048299	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence	33633-33663	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	CP048303	Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence	171999-172029	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	194143-194173	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018696	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence	153463-153493	8	0.742
NZ_CP050064_1	1.2\|770962\|31\|NZ_CP050064\|CRISPRCasFinder	770962-770992	31	NZ_CP018708	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence	105981-106011	8	0.742
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	60772-60806	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	1019599-1019633	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	826331-826365	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	1019598-1019632	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	247304-247338	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	1058410-1058444	9	0.743
NZ_CP050064_1	1.1\|770904\|35\|NZ_CP050064\|CRISPRCasFinder	770904-770938	35	NZ_CP029362	Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence	48266-48300	10	0.714

1. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 5, identity: 0.839

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtcggccacggcggcggccggggccacggtg	Protospacer
   *****.*********.************

2. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 6, identity: 0.806

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gggctgcacggcggcggctggggccaaggtg	Protospacer
 **   **.***************** ****

3. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NC_013852 (Allochromatium vinosum DSM 180 plasmid pALVIN01, complete sequence) position: , mismatch: 6, identity: 0.806

tggggccatggcggcggctggggccacggtg-	CRISPR spacer
cgtgggcatgtcggcggctggggcca-gatgc	Protospacer
.* ** **** *************** *.**

4. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

5. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

6. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

7. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

8. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

9. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

10. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

11. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

12. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

13. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

14. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

15. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

16. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

17. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

18. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

19. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

20. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

21. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

22. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 7, identity: 0.8

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
cgccccggtctcggcccggcaggcggcccaggcgg	Protospacer
 *.*  * ******* * *****************

23. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 8, identity: 0.771

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gaccgcgacatcggcgacccaggcggcccaggcgg	Protospacer
*..** * . ****** * ****************

24. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
cagggccatggcggcgggtgcggccagccag	Protospacer
..*************** ** *****    *

25. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ccaggccatggcggcggccggggtcaccgcc	Protospacer
. .***************.****.*** *.

26. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ccaggccatggcggcggccggggtcaccgcc	Protospacer
. .***************.****.*** *.

27. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP017986 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

28. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018714 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

29. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP026745 (Nocardia cyriacigeorgica strain MDA3349 isolate MDA3349 ancestor plasmid p_unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtccgcgctggctgcggctggggcgacggtg	Protospacer
    **  **** *********** ******

30. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018385 (Burkholderia pseudomallei strain 2008724860 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
caaggcgatggcggcggctgaggccagtgcg	Protospacer
...*** *************.*****  *.*

31. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP020446 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed6, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ggcggccatggcggcggatgcggccagaaag	Protospacer
 * ************** ** ***** .. *

32. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018313 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

33. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018687 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

34. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NC_006362 (Nocardia farcinica IFM 10152 plasmid pNF1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gtccgcgctggctgcggctggggcgacggtg	Protospacer
    **  **** *********** ******

35. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018720 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

36. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018702 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

37. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP024428 (Paracoccus yeei strain TT13 plasmid pTT13-6, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
ggcggccatggcggcggatgcggccagaaag	Protospacer
 * ************** ** ***** .. *

38. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to CP048299 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL_SAL-A00527 plasmid pN1566-2, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

39. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to CP048303 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain WAPHL-SAL-A00375 plasmid p28945-2, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

40. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gccgagcagggcggcggcaggggccacggag	Protospacer
   *. ** ********* ********** *

41. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018696 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

42. spacer 1.2|770962|31|NZ_CP050064|CRISPRCasFinder matches to NZ_CP018708 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-1, complete sequence) position: , mismatch: 8, identity: 0.742

tggggccatggcggcggctggggccacggtg	CRISPR spacer
gcaggccatggcggcgtctggcgccaggatc	Protospacer
  .************* **** **** *.*

43. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 9, identity: 0.743

---ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
tgcgatca---cctcggcgctgcaggcggccaaggcga	Protospacer
   *.**.   .********.********** *****.

44. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

45. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

46. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

47. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

48. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 9, identity: 0.743

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
gacggcgacatcggcgacccaggcggcccaggcgg	Protospacer
*.. * * . ****** * ****************

49. spacer 1.1|770904|35|NZ_CP050064|CRISPRCasFinder matches to NZ_CP029362 (Streptomyces globisporus strain TFH56 plasmid pTFSG1, complete sequence) position: , mismatch: 10, identity: 0.714

ggtcgggctctcggcgccgcaggcggcccaggcgg	CRISPR spacer
ctccttgacctcggcgtcggaggcggcccaggcgc	Protospacer
  .*  * .*******.** **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1162649 : 1170078

uncultured_Mediterranean_phage(33.33%)

protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049832391.1\|1162649_1163765_-\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	2.9e-22	26.4
WP_011087990.1\|1163837_1164338_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
WP_011087989.1\|1164422_1164884_-	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	3.7e-24	39.4
WP_028171491.1\|1165399_1166326_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	4.6e-34	34.1
WP_028171492.1\|1166491_1166950_-	Hsp20 family protein	E3SM62	Prochlorococcus_phage	1.5e-17	37.1
WP_011087984.1\|1167542_1167890_-	hypothetical protein	NA	NA	NA	NA
WP_011087983.1\|1168092_1169715_-	chaperonin GroEL	A0A240F779	uncultured_virus	6.8e-174	59.2
WP_028171493.1\|1169763_1170078_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	4.7e-23	57.6

DBSCAN-SWA_2

1669918 : 1680106

uncultured_Mediterranean_phage(88.89%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028171840.1\|1669918_1670947_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	1.2e-22	42.0
WP_011087521.1\|1670943_1671783_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.1e-31	37.1
WP_028171841.1\|1671804_1672557_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	4.0e-44	49.7
WP_011087519.1\|1672723_1672957_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.4e-08	63.6
WP_011087518.1\|1673046_1673574_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_011087517.1\|1673570_1674383_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	4.2e-55	48.4
WP_028171842.1\|1674599_1675931_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.5e-97	47.9
WP_028171843.1\|1676025_1676388_+	hypothetical protein	NA	NA	NA	NA
WP_028171844.1\|1676576_1677344_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-36	37.6
WP_011087513.1\|1677347_1677719_-	response regulator	NA	NA	NA	NA
WP_038967258.1\|1677993_1678611_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-27	50.0
WP_028171845.1\|1678720_1680106_+	LysM peptidoglycan-binding domain-containing M23 family metallopeptidase	Q8SBN9	Clostridium_phage	4.8e-19	42.7

DBSCAN-SWA_3

1991035 : 2024835

Mycobacterium_phage(15.0%)

terminase,portal,capsid,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028174104.1\|1991035_1991638_+	DNA ligase	A0A1X9SH33	Bradyrhizobium_phage	3.4e-70	66.3
WP_028174105.1\|1991722_1991989_-	hypothetical protein	A0A068C9A1	Rhizobium_phage	1.9e-12	47.6
WP_049832505.1\|1992040_1992400_-	hypothetical protein	Q5GQH9	Synechococcus_phage	1.7e-08	35.6
WP_028174106.1\|1992396_1992762_-	DUF1515 family protein	NA	NA	NA	NA
WP_028174107.1\|1992821_1993112_-	hypothetical protein	NA	NA	NA	NA
WP_028174108.1\|1993108_1993525_-	hypothetical protein	NA	NA	NA	NA
WP_028174109.1\|1993534_1993888_-	hypothetical protein	NA	NA	NA	NA
WP_049832506.1\|1994076_1994850_-	amidase	Q9ZX49	Mycobacterium_phage	7.6e-30	43.4
WP_080668168.1\|1994918_1996043_+	acyltransferase	Q6QI96	Burkholderia_phage	2.9e-06	26.5
WP_028174111.1\|1996036_1998634_-\|tail	tail fiber protein	A0A076GD25	Sinorhizobium_phage	1.5e-13	46.5
WP_028174112.1\|1998669_2000118_-	hypothetical protein	NA	NA	NA	NA
WP_028174113.1\|2000128_2003884_-\|tail	tail fiber protein	M4T544	Rhodobacter_phage	5.7e-99	32.4
WP_039184482.1\|2003886_2004288_-\|tail	tail assembly protein	NA	NA	NA	NA
WP_028174115.1\|2004284_2004788_-	DUF1833 family protein	A0A1B0T6D7	Thiobacimonas_phage	3.2e-21	37.8
WP_028174116.1\|2004784_2005144_-	hypothetical protein	NA	NA	NA	NA
WP_028174117.1\|2005143_2007222_-\|tail	phage tail tape measure protein	D6PGB3	uncultured_phage	1.5e-11	32.2
WP_028174118.1\|2007218_2007512_-	hypothetical protein	A0A1X9IAV0	Xanthomonas_phage	4.9e-06	37.7
WP_028174119.1\|2007577_2008027_-	branched-chain amino acid ABC transporter	NA	NA	NA	NA
WP_028174120.1\|2008071_2009298_-	hypothetical protein	NA	NA	NA	NA
WP_028174121.1\|2009313_2009769_-	hypothetical protein	NA	NA	NA	NA
WP_028174122.1\|2009768_2010242_-	hypothetical protein	NA	NA	NA	NA
WP_028174123.1\|2010243_2010558_-	hypothetical protein	NA	NA	NA	NA
WP_028174124.1\|2010557_2010938_-	hypothetical protein	NA	NA	NA	NA
WP_131727847.1\|2010934_2011396_-	hypothetical protein	NA	NA	NA	NA
WP_028174126.1\|2011358_2011670_-	hypothetical protein	A0A0M4RBJ6	Mycobacterium_phage	2.3e-06	35.3
WP_028174127.1\|2011669_2012290_-	hypothetical protein	NA	NA	NA	NA
WP_039184476.1\|2012353_2012803_-	hypothetical protein	NA	NA	NA	NA
WP_039184473.1\|2012926_2014243_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_028174130.1\|2014344_2015205_-	S49 family peptidase	H6WYH0	Enterobacter_phage	2.0e-23	34.7
WP_028174131.1\|2015188_2016514_-\|portal	phage portal protein	Q6UAX8	Klebsiella_phage	9.9e-46	32.5
WP_028174132.1\|2016513_2018229_-\|terminase	terminase large subunit	I3ULZ6	Rhodobacter_phage	5.4e-113	41.1
WP_039184469.1\|2018229_2018724_-	hypothetical protein	I3ULZ5	Rhodobacter_phage	2.4e-21	42.1
WP_131234214.1\|2018804_2019137_-	hypothetical protein	A0A1J0GUW4	Halomonas_phage	2.1e-21	47.0
WP_028174135.1\|2019148_2019424_-	HNH endonuclease	A8B112	Xanthomonas_virus	8.6e-13	46.9
WP_074076965.1\|2019672_2020332_-	hypothetical protein	NA	NA	NA	NA
WP_131234215.1\|2020334_2021486_-	helix-turn-helix domain-containing protein	A0A291AUK7	Sinorhizobium_phage	5.4e-24	31.4
WP_028174138.1\|2021556_2021835_-	hypothetical protein	NA	NA	NA	NA
WP_049832507.1\|2021827_2022334_-	SANT/Myb domain-containing protein	NA	NA	NA	NA
WP_028174139.1\|2022330_2022543_-	hypothetical protein	NA	NA	NA	NA
WP_028174140.1\|2022539_2024123_-	DNA methyltransferase	A0A076G9A5	Mycobacterium_phage	1.3e-39	28.0
WP_039184466.1\|2024119_2024317_-	hypothetical protein	NA	NA	NA	NA
WP_028174141.1\|2024313_2024835_-	hypothetical protein	A0A291AUJ5	Sinorhizobium_phage	3.8e-17	50.0

DBSCAN-SWA_4

3687505 : 3697095

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039184072.1\|3687505_3689698_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-13	39.1
WP_028172386.1\|3689877_3691569_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-12	30.0
WP_028172387.1\|3691739_3693014_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.8e-73	42.0
WP_028172388.1\|3693010_3693793_-	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_028172389.1\|3693809_3694727_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.4e-67	48.6
WP_039184069.1\|3694833_3695514_+	aldolase	A0A077SK32	Escherichia_phage	4.6e-47	49.3
WP_028172391.1\|3695675_3696380_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	25.2
WP_011085709.1\|3696363_3697095_-	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	3.9e-12	28.6

DBSCAN-SWA_5

5840696 : 5878719

Acidithiobacillus_phage(25.0%)

transposase,integrase

attL 5831040:5831056|attR 5845293:5845309

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5831040:5831056	attL	NA	NA	NA	NA
WP_011090895.1\|5840696_5841938_+\|integrase	site-specific integrase	A0A248SL35	Klebsiella_phage	1.9e-160	66.8
WP_014498593.1\|5841934_5843278_+	DUF1016 domain-containing protein	Q9JMP5	Wolbachia_phage	6.2e-112	55.5
WP_011090897.1\|5843279_5844533_+	hypothetical protein	NA	NA	NA	NA
WP_011090898.1\|5844623_5847113_-	AAA family ATPase	NA	NA	NA	NA
5845293:5845309	attR	NA	NA	NA	NA
WP_014498594.1\|5847109_5847334_-	hypothetical protein	NA	NA	NA	NA
WP_014498595.1\|5847423_5848200_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_014498596.1\|5848386_5848941_+	hypothetical protein	NA	NA	NA	NA
WP_014498597.1\|5849059_5850847_+	ATP-binding protein	NA	NA	NA	NA
WP_011085265.1\|5850887_5851997_+\|transposase	IS630-like element ISBj5 family transposase	NA	NA	NA	NA
WP_011090918.1\|5852046_5852910_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	8.1e-33	37.2
WP_011090919.1\|5852909_5854409_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	7.8e-15	28.8
WP_011084668.1\|5854708_5855251_-	hypothetical protein	NA	NA	NA	NA
WP_014498652.1\|5856220_5856487_-	hypothetical protein	NA	NA	NA	NA
WP_011090921.1\|5856722_5857127_-	hypothetical protein	NA	NA	NA	NA
WP_014498651.1\|5857299_5857755_+\|transposase	transposase	NA	NA	NA	NA
WP_011090930.1\|5860805_5861939_-	FAD-dependent oxidoreductase	A0A2K9L3K5	Tupanvirus	3.1e-08	24.4
WP_011090936.1\|5864393_5865935_+\|transposase	IS21-like element ISFK1 family transposase	K4I413	Acidithiobacillus_phage	2.0e-127	44.3
WP_011090937.1\|5865953_5866715_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.3e-66	53.1
WP_162130962.1\|5867754_5868081_-	hypothetical protein	NA	NA	NA	NA
WP_011090941.1\|5868392_5868743_+	hypothetical protein	NA	NA	NA	NA
WP_011090946.1\|5870226_5871273_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_014498636.1\|5871263_5872127_-	hypothetical protein	NA	NA	NA	NA
WP_011090948.1\|5872123_5873875_-	gamma-glutamyltranspeptidase	NA	NA	NA	NA
WP_085967575.1\|5877590_5878719_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	2.0e-18	33.7

DBSCAN-SWA_6

5898925 : 5949671

Shigella_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085967575.1\|5898925_5900054_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	2.0e-18	33.7
WP_011090972.1\|5901821_5902058_+	hypothetical protein	NA	NA	NA	NA
WP_011090974.1\|5903819_5904101_-	hypothetical protein	NA	NA	NA	NA
WP_016847165.1\|5904863_5905094_-	hypothetical protein	NA	NA	NA	NA
WP_161170744.1\|5905541_5905892_-	hypothetical protein	NA	NA	NA	NA
WP_011090978.1\|5906399_5906801_+	hypothetical protein	NA	NA	NA	NA
WP_016848068.1\|5907160_5907730_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_049801880.1\|5907926_5909480_+	phosphomannomutase/phosphoglucomutase	NA	NA	NA	NA
WP_125459388.1\|5909521_5909740_+	hypothetical protein	NA	NA	NA	NA
WP_026312514.1\|5910627_5911545_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_161170741.1\|5913178_5913775_-	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_011090985.1\|5913783_5914725_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011090986.1\|5914847_5915072_-	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_039187468.1\|5915446_5916946_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-15	28.1
WP_039183785.1\|5916945_5917809_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-32	36.7
WP_011084703.1\|5919733_5921245_-\|transposase	ISNCY-like element ISBj12 family transposase	NA	NA	NA	NA
WP_011091022.1\|5923548_5923845_-	DUF3892 domain-containing protein	NA	NA	NA	NA
WP_014490241.1\|5928133_5928385_+	hypothetical protein	NA	NA	NA	NA
WP_011082837.1\|5931016_5931340_-	hypothetical protein	NA	NA	NA	NA
WP_026312719.1\|5931561_5932626_-	ribonucleotide-diphosphate reductase subunit beta	A0A0K1LM33	Caulobacter_phage	3.2e-103	55.9
WP_011082839.1\|5932625_5934797_-	ribonucleoside-diphosphate reductase subunit alpha	A0A0K1LMZ5	Caulobacter_phage	9.3e-227	66.3
WP_043900134.1\|5935551_5936193_-	GNAT family N-acetyltransferase	C5MKY6	Human_cytomegalovirus	1.1e-13	28.3
WP_014490250.1\|5938378_5938750_+	hypothetical protein	NA	NA	NA	NA
WP_011082845.1\|5938871_5939405_+\|transposase	transposase	NA	NA	NA	NA
WP_125459292.1\|5940655_5940952_-	hypothetical protein	NA	NA	NA	NA
WP_109866565.1\|5941328_5942457_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7
WP_011082852.1\|5943728_5944961_-	cytochrome P450	NA	NA	NA	NA
WP_011082853.1\|5945086_5947087_-	cytochrome c	NA	NA	NA	NA
WP_011082854.1\|5948114_5948405_+	hypothetical protein	NA	NA	NA	NA
WP_011082855.1\|5948561_5949671_+\|transposase	IS630-like element ISBj5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

7401661 : 7408751

Salmonella_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_028173594.1\|7401661_7402126_+	ribonuclease HI	J9Q745	Salmonella_phage	8.5e-45	58.3
WP_011084135.1\|7402245_7402731_-	peroxiredoxin	M1I839	Pelagibacter_phage	6.8e-21	45.8
WP_011084136.1\|7402839_7403394_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.7e-15	31.8
WP_011084137.1\|7403409_7405095_-	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	6.9e-44	26.9
WP_028173593.1\|7405288_7406752_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.3e-26	34.2
WP_028173592.1\|7406942_7408751_-	glucan ABC transporter ATP-binding protein/ permease	W8CYL7	Bacillus_phage	3.8e-32	25.0

DBSCAN-SWA_8

7762176 : 7906775

111

Acidithiobacillus_phage(17.65%)

transposase,integrase

attL 7744622:7744637|attR 7771139:7771154

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
7744622:7744637	attL	NA	NA	NA	NA
WP_011084450.1\|7762176_7762587_+\|integrase	tyrosine-type recombinase/integrase	A0A1X9SGU9	Bradyrhizobium_phage	1.1e-06	36.6
WP_011084451.1\|7762604_7762922_-	hypothetical protein	NA	NA	NA	NA
WP_074077662.1\|7763486_7763675_+	plasmid maintenance system killer protein	A0A2L1IV28	Escherichia_phage	1.6e-05	36.7
WP_018647863.1\|7764621_7764837_+	hypothetical protein	NA	NA	NA	NA
WP_026312792.1\|7766494_7766983_+	hypothetical protein	NA	NA	NA	NA
WP_038952402.1\|7767723_7768428_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.5e-61	53.6
WP_011084458.1\|7769941_7770748_-	hypothetical protein	A0A023NHS3	Nitrincola_phage	1.0e-05	30.1
WP_018642721.1\|7771022_7771775_+	EAL domain-containing protein	NA	NA	NA	NA
7771139:7771154	attR	NA	NA	NA	NA
WP_014498042.1\|7772111_7772303_-	hypothetical protein	NA	NA	NA	NA
WP_011084718.1\|7773880_7775356_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-27	35.5
WP_038951335.1\|7775454_7776804_-\|transposase	IS701-like element ISBj6 family transposase	NA	NA	NA	NA
WP_014498039.1\|7777703_7779242_+	DUF1521 domain-containing protein	NA	NA	NA	NA
WP_011084467.1\|7779956_7780160_-	hypothetical protein	NA	NA	NA	NA
WP_014498036.1\|7780788_7781088_-	hypothetical protein	A0A291AUP1	Sinorhizobium_phage	4.1e-08	34.7
WP_011084471.1\|7782524_7783331_+	hypothetical protein	NA	NA	NA	NA
WP_011084472.1\|7783654_7784650_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_035668701.1\|7785035_7785236_+	hypothetical protein	NA	NA	NA	NA
WP_018648883.1\|7785295_7785493_-	hypothetical protein	NA	NA	NA	NA
WP_028176059.1\|7785755_7786421_+	hypothetical protein	NA	NA	NA	NA
WP_020608182.1\|7786420_7787173_+	hypothetical protein	NA	NA	NA	NA
WP_018648886.1\|7787574_7788021_-	hypothetical protein	NA	NA	NA	NA
WP_011084477.1\|7789158_7789986_+	hypothetical protein	NA	NA	NA	NA
WP_026312801.1\|7789909_7790575_+	hypothetical protein	NA	NA	NA	NA
WP_011084479.1\|7790564_7791206_+	DUF4194 domain-containing protein	NA	NA	NA	NA
WP_018647893.1\|7791202_7794703_+	AAA family ATPase	NA	NA	NA	NA
WP_028176041.1\|7794699_7795905_+	hypothetical protein	NA	NA	NA	NA
WP_011084482.1\|7795891_7796767_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_035668232.1\|7796769_7797087_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011084484.1\|7797240_7798377_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_011084485.1\|7798363_7799845_+	hypothetical protein	NA	NA	NA	NA
WP_011084486.1\|7799857_7800619_+	hypothetical protein	NA	NA	NA	NA
WP_018647899.1\|7800615_7801794_+	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_162131541.1\|7802677_7802839_+	hypothetical protein	NA	NA	NA	NA
WP_011084490.1\|7803957_7805820_+	hypothetical protein	NA	NA	NA	NA
WP_028176066.1\|7806478_7806994_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_011084494.1\|7806990_7807653_+	amino acid ABC transporter permease	NA	NA	NA	NA
WP_011084496.1\|7809047_7809338_+	DUF2274 domain-containing protein	NA	NA	NA	NA
WP_011084497.1\|7809334_7809649_-	hypothetical protein	NA	NA	NA	NA
WP_014498007.1\|7810584_7810773_+	hypothetical protein	NA	NA	NA	NA
WP_035668747.1\|7811098_7812478_+	aspartate aminotransferase family protein	NA	NA	NA	NA
WP_011084500.1\|7813202_7813706_-	type II toxin-antitoxin system YhaV family toxin	NA	NA	NA	NA
WP_026312989.1\|7813702_7814044_-	type II toxin-antitoxin system PrlF family antitoxin	NA	NA	NA	NA
WP_011084704.1\|7816127_7817666_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_011084519.1\|7817626_7818472_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	1.1e-34	35.0
WP_011084703.1\|7818622_7820134_+\|transposase	ISNCY-like element ISBj12 family transposase	NA	NA	NA	NA
WP_038952402.1\|7820582_7821287_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.5e-61	53.6
WP_011084521.1\|7821317_7821896_-	hypothetical protein	NA	NA	NA	NA
WP_074076598.1\|7822353_7826571_-	hypothetical protein	NA	NA	NA	NA
WP_011084516.1\|7826843_7829096_-	hypothetical protein	NA	NA	NA	NA
WP_011084515.1\|7829515_7831312_+	recombinase family protein	NA	NA	NA	NA
WP_011084514.1\|7831359_7832424_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_026311979.1\|7832397_7833696_+	type IV secretory system conjugative DNA transfer family protein	NA	NA	NA	NA
WP_039156384.1\|7833909_7835457_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.1e-83	38.6
WP_011090953.1\|7835510_7835867_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_166466045.1\|7835863_7836142_-\|transposase	transposase	NA	NA	NA	NA
WP_011084509.1\|7836418_7836763_+	hypothetical protein	NA	NA	NA	NA
WP_014497999.1\|7837287_7837509_-	hypothetical protein	NA	NA	NA	NA
WP_011084508.1\|7838078_7838336_+	WGR domain-containing protein	NA	NA	NA	NA
WP_166466028.1\|7839070_7844206_-	hypothetical protein	NA	NA	NA	NA
WP_038952402.1\|7844407_7845112_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.5e-61	53.6
WP_038968105.1\|7846452_7847721_+\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	5.5e-94	46.2
WP_018648887.1\|7848518_7848905_-	response regulator	NA	NA	NA	NA
WP_011084526.1\|7848989_7849673_-	response regulator transcription factor	NA	NA	NA	NA
WP_011084527.1\|7849669_7852339_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	1.9e-08	25.0
WP_011084514.1\|7853218_7854283_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_085971921.1\|7854358_7855118_+\|transposase	IS5-like element ISBj2 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.6e-08	35.5
WP_011084529.1\|7855241_7856558_-	C4-dicarboxylate transporter DctA	NA	NA	NA	NA
WP_011084531.1\|7858922_7860014_+	hydrogenase small subunit	NA	NA	NA	NA
WP_011084536.1\|7861220_7861511_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011084538.1\|7862388_7862940_+	hydrogenase expression/formation protein	NA	NA	NA	NA
WP_011084541.1\|7864120_7864462_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_109866565.1\|7865310_7866439_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7
WP_011084544.1\|7866723_7868469_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_026312945.1\|7868465_7869608_+	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_026312944.1\|7869604_7870651_+	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_011084547.1\|7871035_7872148_+	alanine dehydrogenase	NA	NA	NA	NA
WP_011084548.1\|7872686_7872881_+	4Fe-4S binding protein	NA	NA	NA	NA
WP_039183858.1\|7873024_7874089_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_018648292.1\|7875900_7877403_+	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_011084553.1\|7877468_7879025_+	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_011084554.1\|7879117_7880761_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_011084555.1\|7880770_7882180_+	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_011084556.1\|7882176_7882572_+	nitrogen fixation protein NifX	NA	NA	NA	NA
WP_026312876.1\|7883060_7883255_+	hypothetical protein	NA	NA	NA	NA
WP_011084559.1\|7883265_7883559_+	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_018647464.1\|7884551_7885286_+	hypothetical protein	NA	NA	NA	NA
WP_018647465.1\|7885884_7886268_+	Rieske (2Fe-2S) protein	NA	NA	NA	NA
WP_014497969.1\|7886289_7886880_-	hypothetical protein	NA	NA	NA	NA
WP_011084564.1\|7887139_7887460_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_131234256.1\|7887493_7887787_+	hypothetical protein	NA	NA	NA	NA
WP_011084565.1\|7887783_7888965_+	cysteine desulfurase NifS	H7BUW1	unidentified_phage	1.1e-35	37.9
WP_011084566.1\|7888961_7889186_+	putative nitrogen fixation protein NifT	NA	NA	NA	NA
WP_041960893.1\|7889873_7891433_+	nitrogenase cofactor biosynthesis protein NifB	NA	NA	NA	NA
WP_011084569.1\|7891443_7891668_+	ferredoxin-like protein in nif region	A0A1B1IWY9	uncultured_Mediterranean_phage	2.0e-07	47.7
WP_026312710.1\|7891918_7892233_+	nitrogen fixation protein NifZ	NA	NA	NA	NA
WP_014497965.1\|7892229_7892547_+	hypothetical protein	NA	NA	NA	NA
WP_018647468.1\|7892485_7892845_+	DUF3024 domain-containing protein	NA	NA	NA	NA
WP_011084572.1\|7892878_7893223_+	hypothetical protein	NA	NA	NA	NA
WP_011084574.1\|7893942_7894290_+	(2Fe-2S) ferredoxin domain-containing protein	NA	NA	NA	NA
WP_018647470.1\|7894695_7895439_-	OmpW family protein	NA	NA	NA	NA
WP_011084576.1\|7895648_7896074_-	hypothetical protein	NA	NA	NA	NA
WP_161170736.1\|7896148_7896460_+	hypothetical protein	NA	NA	NA	NA
WP_011084578.1\|7896641_7897526_+	nitrogenase iron protein	NA	NA	NA	NA
WP_049813250.1\|7897671_7898448_+	nitrogen fixation protein NifQ	NA	NA	NA	NA
WP_011084580.1\|7899101_7899443_+	nitrogenase stabilizing/protective protein NifW	NA	NA	NA	NA
WP_014497958.1\|7900393_7901503_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_011084583.1\|7901514_7902822_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011084584.1\|7902860_7903157_+	ferredoxin family protein	NA	NA	NA	NA
WP_011084585.1\|7903368_7903917_-	alkyl hydroperoxide reductase AhpD	NA	NA	NA	NA
WP_011084586.1\|7903923_7904478_-	peroxiredoxin	NA	NA	NA	NA
WP_166466029.1\|7905506_7906775_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	3.5e-93	45.9

DBSCAN-SWA_9

7927611 : 7993842

Paenibacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084514.1\|7927611_7928676_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084616.1\|7929246_7929450_-	hypothetical protein	NA	NA	NA	NA
WP_161966260.1\|7929866_7930043_+	hypothetical protein	NA	NA	NA	NA
WP_039183842.1\|7930534_7931878_+\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_035668374.1\|7932225_7932846_-	nodulation protein NolW	NA	NA	NA	NA
WP_026312858.1\|7933100_7933601_+	hypothetical protein	NA	NA	NA	NA
WP_011084621.1\|7933609_7934473_+	type III secretion inner membrane ring lipoprotein SctJ	NA	NA	NA	NA
WP_011084622.1\|7934484_7935123_+	nodulation protein	NA	NA	NA	NA
WP_011084623.1\|7935119_7935740_+	type III secretion system stator protein SctL	NA	NA	NA	NA
WP_011084624.1\|7935736_7937092_+	type III secretion system ATPase SctN	NA	NA	NA	NA
WP_011084625.1\|7937067_7937604_+	hypothetical protein	NA	NA	NA	NA
WP_011084626.1\|7937600_7938722_+	type III secretion system cytoplasmic ring protein SctQ	NA	NA	NA	NA
WP_011084627.1\|7938714_7939380_+	type III secretion system export apparatus protein SctR	NA	NA	NA	NA
WP_011084628.1\|7939382_7939658_+	translocation protein	NA	NA	NA	NA
WP_011084629.1\|7939668_7940490_+	type III secretion system export apparatus protein SctT	NA	NA	NA	NA
WP_011084630.1\|7940486_7941524_+	EscU/YscU/HrcU family type III secretion system export apparatus switch protein	NA	NA	NA	NA
WP_144038027.1\|7941533_7942294_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.2e-08	35.5
WP_011084514.1\|7945865_7946930_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_011084637.1\|7947933_7948335_+	hypothetical protein	NA	NA	NA	NA
WP_011084638.1\|7949169_7949376_+	hypothetical protein	NA	NA	NA	NA
WP_041960889.1\|7949505_7950840_-\|transposase	IS5-like element ISBj2_B family transposase	K4ICS3	Acidithiobacillus_phage	2.1e-40	41.6
WP_038952402.1\|7952850_7953555_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	1.5e-61	53.6
WP_018647880.1\|7956649_7958965_-	hypothetical protein	NA	NA	NA	NA
WP_011084647.1\|7959160_7959823_-	hypothetical protein	NA	NA	NA	NA
WP_018647881.1\|7959833_7961288_-	type II and III secretion system protein family protein	NA	NA	NA	NA
WP_011084649.1\|7961314_7962004_-	response regulator transcription factor	NA	NA	NA	NA
WP_011084652.1\|7964017_7965085_-	hypothetical protein	NA	NA	NA	NA
WP_011084653.1\|7965683_7966118_+	VirK protein	NA	NA	NA	NA
WP_014497924.1\|7966580_7967489_-	hypothetical protein	NA	NA	NA	NA
WP_011084657.1\|7968895_7970377_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
WP_028176031.1\|7970561_7971443_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_011084659.1\|7971993_7973235_+	cytochrome P450	NA	NA	NA	NA
WP_018648290.1\|7973661_7975905_+	hypothetical protein	NA	NA	NA	NA
WP_011084661.1\|7976235_7977246_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	1.1e-126	64.8
WP_011084662.1\|7977388_7977682_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_011084664.1\|7978265_7978649_-	hypothetical protein	NA	NA	NA	NA
WP_011084665.1\|7978756_7979302_+	hypothetical protein	NA	NA	NA	NA
WP_109866565.1\|7979531_7980660_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7
WP_011084668.1\|7981808_7982351_-	hypothetical protein	NA	NA	NA	NA
WP_011084669.1\|7982904_7983111_+	hypothetical protein	NA	NA	NA	NA
WP_018642727.1\|7983500_7984892_-	MFS transporter	NA	NA	NA	NA
WP_018648617.1\|7988159_7988735_+	hypothetical protein	NA	NA	NA	NA
WP_011084678.1\|7990891_7992700_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_144038027.1\|7993082_7993842_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	1.2e-08	35.5

DBSCAN-SWA_10

8034672 : 8074216

Pseudomonas_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_018645230.1\|8034672_8035692_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_018645229.1\|8035820_8037377_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_011084718.1\|8039035_8040511_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-27	35.5
WP_018642936.1\|8040634_8041993_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_152104176.1\|8042036_8042797_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.7e-08	35.5
WP_011084703.1\|8047613_8049125_+\|transposase	ISNCY-like element ISBj12 family transposase	NA	NA	NA	NA
WP_018648284.1\|8050060_8050294_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_039183803.1\|8052788_8054546_+	E3 ubiquitin--protein ligase	NA	NA	NA	NA
WP_018648285.1\|8054602_8054773_+	hypothetical protein	NA	NA	NA	NA
WP_011084710.1\|8055477_8055930_-	GNAT family N-acetyltransferase	C5MKY6	Human_cytomegalovirus	6.6e-10	26.9
WP_011084715.1\|8060368_8061205_+	hypothetical protein	NA	NA	NA	NA
WP_011084718.1\|8062769_8064245_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.0e-27	35.5
WP_080668322.1\|8066135_8066468_+	hypothetical protein	NA	NA	NA	NA
WP_011084720.1\|8066605_8067310_-	hypothetical protein	NA	NA	NA	NA
WP_018648597.1\|8067421_8067853_-	hypothetical protein	NA	NA	NA	NA
WP_018648595.1\|8068453_8072239_-	AAA family ATPase	NA	NA	NA	NA
WP_109866565.1\|8073087_8074216_+\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	1.1e-18	33.7

DBSCAN-SWA_11

8206213 : 8272733

uncultured_virus(15.38%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011084854.1\|8206213_8207110_+\|protease	YopT-type cysteine protease domain-containing protein	NA	NA	NA	NA
WP_014497791.1\|8208349_8209990_-	chaperonin GroEL	A0A219YK78	uncultured_virus	6.0e-170	58.9
WP_014497790.1\|8210074_8210389_-	co-chaperone GroES	A0A221S4G8	uncultured_virus	5.6e-24	61.7
WP_011084858.1\|8211339_8211987_+	FkbM family methyltransferase	Q58M88	Prochlorococcus_phage	5.9e-12	26.9
WP_011084859.1\|8212809_8214006_-	flavin-dependent monooxygenase	NA	NA	NA	NA
WP_011084861.1\|8215872_8216628_-	carbonic anhydrase	NA	NA	NA	NA
WP_011084862.1\|8216624_8217413_-	thermonuclease family protein	NA	NA	NA	NA
WP_039183842.1\|8217713_8219057_-\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_018646917.1\|8220098_8220926_-	hypothetical protein	NA	NA	NA	NA
WP_131234261.1\|8221169_8221460_-	hypothetical protein	NA	NA	NA	NA
WP_011084864.1\|8222114_8224460_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
WP_026312600.1\|8226489_8226696_+	hypothetical protein	NA	NA	NA	NA
WP_014497780.1\|8230432_8230618_+	hypothetical protein	A0A1X9SH55	Bradyrhizobium_phage	9.2e-11	63.8
WP_039187468.1\|8230775_8232275_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	6.0e-15	28.1
WP_039183785.1\|8232274_8233138_+	ATP-binding protein	A0A059NT77	Lactococcus_phage	1.1e-32	36.7
WP_122975537.1\|8236330_8236513_+	hypothetical protein	NA	NA	NA	NA
WP_011084884.1\|8236509_8236983_+	hypothetical protein	NA	NA	NA	NA
WP_018646910.1\|8237653_8238250_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	4.9e-45	44.0
WP_026312597.1\|8238246_8239641_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.9e-45	33.9
WP_018646908.1\|8239794_8240112_-	Dabb family protein	NA	NA	NA	NA
WP_039183842.1\|8240293_8241637_-\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_018646907.1\|8241874_8242510_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_018646906.1\|8242624_8243620_+	biotin synthase BioB	NA	NA	NA	NA
WP_018646905.1\|8243670_8244024_+	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_018646904.1\|8244099_8245254_+	8-amino-7-oxononanoate synthase	G9E4Q1	Emiliania_huxleyi_virus	1.9e-21	28.2
WP_011084893.1\|8245250_8245886_+	ATP-dependent dethiobiotin synthetase BioD	NA	NA	NA	NA
WP_018646903.1\|8245882_8247148_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	4.9e-10	28.6
WP_028176029.1\|8248394_8249273_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.5e-46	36.9
WP_011084897.1\|8249276_8250128_+	pantoate--beta-alanine ligase	NA	NA	NA	NA
WP_011084898.1\|8250140_8250500_+	hypothetical protein	NA	NA	NA	NA
WP_014497761.1\|8251168_8251369_+	hypothetical protein	NA	NA	NA	NA
WP_014497760.1\|8251714_8251918_-	hypothetical protein	NA	NA	NA	NA
WP_018648581.1\|8252314_8252593_+	hypothetical protein	NA	NA	NA	NA
WP_162185877.1\|8253837_8254386_-	hypothetical protein	NA	NA	NA	NA
WP_157789304.1\|8263248_8263671_+	hypothetical protein	NA	NA	NA	NA
WP_026312933.1\|8265294_8265978_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_018648598.1\|8266515_8266782_+	DUF3551 domain-containing protein	NA	NA	NA	NA
WP_011084907.1\|8267229_8267460_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_039183842.1\|8267823_8269167_-\|transposase	IS1380-like element ISBdi2 family transposase	NA	NA	NA	NA
WP_035668596.1\|8269510_8269885_+	hypothetical protein	NA	NA	NA	NA
WP_011084909.1\|8269881_8270202_+	XRE family transcriptional regulator	NA	NA	NA	NA
WP_011084910.1\|8270214_8271339_+	DUF3800 domain-containing protein	U5N3F3	Enterobacteria_phage	2.0e-71	39.7
WP_085967575.1\|8271603_8272733_-\|transposase	IS3-like element ISRj2 family transposase	U5P429	Shigella_phage	2.0e-18	33.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050064

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection