CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP050807	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence	0 crisprs	NA	0	0	0	0
NZ_CP050809	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP443, complete sequence	0 crisprs	NA	0	0	4	1
NZ_CP050806	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence	0 crisprs	NA	0	0	1	0
NZ_CP050805	Lactobacillus plantarum strain SPC-SNU 72-2 chromosome, complete genome	2 crisprs	cas3,DinG,csa3,WYL,DEDDh	9	1	211	0
NZ_CP050808	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP458, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1702 : 55506

Streptococcus_phage(23.53%)

transposase,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006293514.1\|1702_1807_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_071665474.1\|2404_2668_+	hypothetical protein	NA	NA	NA	NA
WP_167803157.1\|3112_4063_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.6e-21	72.2
WP_071665442.1\|6317_6755_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003561273.1\|7349_7853_+	type 1 glutamine amidotransferase	NA	NA	NA	NA
WP_128537168.1\|8596_9517_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	2.3e-49	36.8
WP_056971947.1\|9891_10086_-	hypothetical protein	NA	NA	NA	NA
WP_021356718.1\|10105_11875_-	oleate hydratase	NA	NA	NA	NA
WP_020090529.1\|12123_12300_-	hypothetical protein	NA	NA	NA	NA
WP_010579558.1\|12299_12518_-	hypothetical protein	NA	NA	NA	NA
WP_077727077.1\|13805_14981_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.4e-19	36.2
WP_060599249.1\|15165_16332_-	MFS transporter	NA	NA	NA	NA
WP_128537165.1\|16431_17448_-	general stress protein	NA	NA	NA	NA
WP_128537164.1\|17469_18840_-	sugar porter family MFS transporter	NA	NA	NA	NA
WP_128537163.1\|19006_19255_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_167803158.1\|19599_19797_+	hypothetical protein	NA	NA	NA	NA
WP_167803159.1\|19774_20248_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_153629983.1\|21041_22781_-	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.6e-32	26.4
WP_153629982.1\|22887_23817_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW47	unidentified_phage	8.8e-25	34.1
WP_153629981.1\|23901_25140_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.5e-37	28.9
WP_046872410.1\|26400_27519_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	6.6e-168	76.9
WP_122551639.1\|27721_28723_-	hypothetical protein	NA	NA	NA	NA
WP_153629980.1\|28879_29722_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.1e-156	98.9
WP_002816285.1\|29775_30027_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_122551637.1\|30662_31541_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	5.1e-75	56.4
WP_167803160.1\|31700_32600_-	DUF2382 domain-containing protein	NA	NA	NA	NA
WP_153629979.1\|33073_35791_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_122551634.1\|35809_36481_+	beta-phosphoglucomutase	A0A1D8KNV9	Synechococcus_phage	4.6e-07	22.7
WP_122551633.1\|36598_37369_-	Cof-type HAD-IIB family hydrolase	Q0GXW5	Lactococcus_phage	3.8e-05	25.2
WP_016526703.1\|37442_37742_-	hypothetical protein	NA	NA	NA	NA
WP_013356270.1\|37743_38604_-	ParA family protein	F0PIG8	Enterococcus_phage	1.7e-43	40.2
WP_063493464.1\|39551_39884_+	hypothetical protein	NA	NA	NA	NA
WP_161048344.1\|40170_40512_+	replication protein	NA	NA	NA	NA
WP_014564139.1\|40773_41055_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_161048341.1\|41044_41551_+	hypothetical protein	NA	NA	NA	NA
WP_153629977.1\|41540_41819_-	hypothetical protein	NA	NA	NA	NA
WP_153629976.1\|41864_42068_-	hypothetical protein	NA	NA	NA	NA
WP_153629975.1\|42319_44383_+	MobA/MobL family protein	NA	NA	NA	NA
WP_153629974.1\|44479_46615_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	4.3e-107	46.2
WP_167803161.1\|47641_48538_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	1.3e-25	34.3
WP_016526894.1\|48592_49768_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.8e-27	29.2
WP_056987167.1\|51495_52908_+	MATE family efflux transporter	NA	NA	NA	NA
WP_056953201.1\|53841_54138_+	hypothetical protein	NA	NA	NA	NA
WP_153629989.1\|54582_55506_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.9e-33	31.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP050809

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9452

Lactobacillus_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526595.1\|61_727_+	sugar transferase	NA	NA	NA	NA
WP_167803206.1\|1300_2071_+	polysaccharide biosynthesis protein	NA	NA	NA	NA
WP_104796136.1\|2082_2802_+	CpsD/CapB family tyrosine-protein kinase	NA	NA	NA	NA
WP_167803229.1\|2788_3562_+	tyrosine protein phosphatase	NA	NA	NA	NA
WP_167803207.1\|3616_4285_+	sugar transferase	NA	NA	NA	NA
WP_041153669.1\|4345_5524_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_167803208.1\|5523_6684_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_002816285.1\|6936_7188_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_167803209.1\|7241_8084_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	9.7e-156	98.6
WP_063489447.1\|8894_9452_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	2.0e-32	44.6

DBSCAN-SWA_2

13376 : 14150

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_056988831.1\|13376_14150_-	ParA family protein	F0PIG8	Enterococcus_phage	3.3e-33	36.6

DBSCAN-SWA_3

23622 : 36238

Lactobacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803216.1\|23622_24075_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	4.1e-20	40.7
WP_167803217.1\|24079_25273_-	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
WP_167803218.1\|25321_26341_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_080488545.1\|26569_27412_-\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	3.3e-156	98.9
WP_002816285.1\|27465_27717_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_167803219.1\|28129_29365_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	7.4e-88	48.5
WP_016511843.1\|29504_30425_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	5.1e-49	36.8
WP_024002463.1\|30553_31981_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_167803220.1\|32034_32994_-	hypothetical protein	A0A1W5ZN14	Cucumis_melo_alphaendornavirus	1.8e-12	30.8
WP_167803221.1\|32990_34220_-	hypothetical protein	NA	NA	NA	NA
WP_167803222.1\|34230_35226_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.3e-10	33.6
WP_167803223.1\|35251_36238_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	7.2e-09	29.9

DBSCAN-SWA_4

39719 : 43534

Enterobacteria_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803226.1\|39719_40895_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.2e-24	27.5
WP_041153676.1\|41041_41911_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	8.6e-99	59.4
WP_003644155.1\|41914_42496_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.3e-38	45.1
WP_167803227.1\|42505_43534_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.0e-71	44.8

Anti-CRISPR protein detection

Acr_ID: NZ_CP050809.1|WP_063489447.1|8894_9452_+|recombinase-family-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP050809.1|WP_063489447.1|8894_9452_+|recombinase-family-protein

8894_9452_+

185 aa aa

0-9452

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP050805_1	Orphan	1.4\|790495\|18\|NZ_CP050805\|CRT	790495-790512	18	8994-8977	2
NZ_CP050805_1	Orphan	1.6\|790567\|18\|NZ_CP050805\|CRT	790567-790584	18	8994-8977	2

1. spacer 1.4|790495|18|NZ_CP050805|CRT matches to NZ_CP050809 position: 8994-8977, mismatch: 2

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

2. spacer 1.6|790567|18|NZ_CP050805|CRT matches to NZ_CP050809 position: 8994-8977, mismatch: 2

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

3. NZ_CP050805

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050805_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050805_1

790369-790794

Orphan

Consensus_repeat	Method
CTTNTNNGACTTNNNNTG	CRT

11 spacers

The CRISPR arrays of NZ_CP050805_1

>merge|NZ_CP050805|1|790369-790794|CRT
CTTACTGGATTTACCATGCTTCTTGGAAGATTTCTTCTTATTGGACTTGCCGTGCTTCTTGGAAGATTTCTTCTTGTGCGACTTGCCATGTTTCTTGGAAGACTTCTTCTTACTGGACTTGCCATGTTTCTTGGAAGACTTTTTCTTATTGGACTTGCCGTGCTTCTTAGAAGACTTCTTCTTGTGCGACTTGCCGTGTTTCTTGGAAGACTTTTTCTTATTGGACTTGCCGTGCTTCTTCGAAGATTTTTTCTTGTGCGACTTGCCATGCTTCTTAGAAGACTTCTTCTTGTGCGGCTTCTTATGTTTCCTGGCCGCTTTCTTCTTGTGCGACTTCTTATGTTTCTTGGCCGCTTTCTTCTTGTGTGACTTCTTGTGCGACTTCTTATGTTTCTTAGCGGCCTTCTTCTTATGCGCCTTTTTATG

>NZ_CP050805|1|1|790369-790794|CRT
CTTACTGGATTTACCATG	CTTCTTGGAAGATTTCTT
CTTATTGGACTTGCCGTG	CTTCTTGGAAGATTTCTT
CTTGTGCGACTTGCCATG	TTTCTTGGAAGACTTCTT
CTTACTGGACTTGCCATG	TTTCTTGGAAGACTTTTT
CTTATTGGACTTGCCGTG	CTTCTTAGAAGACTTCTT
CTTGTGCGACTTGCCGTG	TTTCTTGGAAGACTTTTT
CTTATTGGACTTGCCGTG	CTTCTTCGAAGATTTTTT
CTTGTGCGACTTGCCATG	CTTCTTAGAAGACTTCTT
CTTGTGCGGCTTCTTATG	TTTCCTGGCCGCTTTCTT
CTTGTGCGACTTCTTATG	TTTCTTGGCCGCTTTCTTCTTGTGTGACTT
CTTGTGCGACTTCTTATG	TTTCTTAGCGGCCTTCTT
CTTATGCGCCTTTTTATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050805.1\|WP_167803073.1\|798175_799507_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224169
NZ_CP050805.1\|WP_016526891.1\|791068_793417_-\|MucBP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377660
NZ_CP050805.1\|WP_021731937.1\|793611_794331_-\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
NZ_CP050805.1\|WP_016526894.1\|784866_786042_-\|IS256-family-transposase	unknown	unknown	gnl\|CDD\|307151
NZ_CP050805.1\|WP_016526893.1\|787277_787451_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_015639936.1\|788995_789202_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379738
NZ_CP050805.1\|WP_003646471.1\|781718_781883_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_003641941.1\|799584_800556_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP050805.1\|WP_003646443.1\|800556_802083_-\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NZ_CP050805.1\|WP_003646450.1\|786189_786732_-\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP050805.1\|WP_003646441.1\|804704_805625_+\|ribonucleoside-hydrolase-RihC	unknown	unknown	gnl\|CDD\|182713
NZ_CP050805.1\|WP_003643773.1\|796192_797710_-\|glycerol-kinase-GlpK	unknown	unknown	gnl\|CDD\|234594
NZ_CP050805.1\|WP_108725669.1\|788498_788615_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_003643768.1\|803656_804568_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|180448
NZ_CP050805.1\|WP_003646470.1\|782164_782938_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP050805.1\|WP_016526896.1\|783238_783982_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381088
NZ_CP050805.1\|WP_003646449.1\|787457_788375_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_003646442.1\|802320_802767_+\|ribonuclease-H	unknown	unknown	gnl\|CDD\|178927
NZ_CP050805.1\|WP_003643774.1\|794348_796178_-\|type-1-glycerol-3-phosphate-oxidase	unknown	unknown	gnl\|CDD\|380303
NZ_CP050805.1\|WP_003643811.1\|781907_782066_+\|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP050805.1\|WP_167803073.1\|798175_799507_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224169	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion].	4.96704e-122
NZ_CP050805.1\|WP_016526891.1\|791068_793417_-\|MucBP-domain-containing-protein	gnl\|CDD\|377660	pfam06458, MucBP, MucBP domain. The MucBP (MUCin-Binding Protein) domain is found in a wide variety of bacterial proteins, in several repeats. The domain is found in bacterial peptidoglycan bound proteins and is often found in conjunction with pfam00746 and pfam00560.	6.56753e-10
NZ_CP050805.1\|WP_021731937.1\|793611_794331_-\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	8.71336e-82
NZ_CP050805.1\|WP_016526894.1\|784866_786042_-\|IS256-family-transposase	gnl\|CDD\|307151	pfam00872, Transposase_mut, Transposase, Mutator family.	6.12313e-110
NZ_CP050805.1\|WP_003641941.1\|799584_800556_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	1.46616e-132
NZ_CP050805.1\|WP_015639936.1\|788995_789202_-\|hypothetical-protein	gnl\|CDD\|379738	pfam15603, Imm74, Immunity protein 74. A predicted immunity protein with an alpha+beta fold. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene, which usually contains toxin domains of the Tox-ARC family. This domain is also found in heterogeneous poly-immunity loci.	3.89713e-09
NZ_CP050805.1\|WP_003646443.1\|800556_802083_-\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.08905e-155
NZ_CP050805.1\|WP_003646450.1\|786189_786732_-\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	6.04348e-09
NZ_CP050805.1\|WP_003646441.1\|804704_805625_+\|ribonucleoside-hydrolase-RihC	gnl\|CDD\|182713	PRK10768, PRK10768, ribonucleoside hydrolase RihC; Provisional.	0
NZ_CP050805.1\|WP_003643773.1\|796192_797710_-\|glycerol-kinase-GlpK	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
NZ_CP050805.1\|WP_003643768.1\|803656_804568_-\|oxidoreductase	gnl\|CDD\|180448	PRK06182, PRK06182, short chain dehydrogenase; Validated.	4.43747e-163
NZ_CP050805.1\|WP_003646470.1\|782164_782938_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	8.33506e-10
NZ_CP050805.1\|WP_016526896.1\|783238_783982_-\|response-regulator-transcription-factor	gnl\|CDD\|381088	cd17533, REC_LytTR_AgrA-like, phosphoacceptor receiver (REC) domain of LytTR/AlgR family response regulators similar to AgrA. Members of the LytTR/AlgR family of response regulators contain a REC domain and a unique LytTR DNA-binding output domain that lacks the helix-turn-helix motif and consists mostly of beta-strands. Transcriptional regulators with the LytTR-type output domains are involved in biosynthesis of extracellular polysaccharides, fimbriation, expression of exoproteins, including toxins, and quorum sensing. Included in this AgrA-like group of LytTR/AlgR family response regulators are Staphylococcus aureus accessory gene regulator protein A (AgrA) and Streptococcus pneumoniae response regulator ComE, which are members of two-component regulatory systems. AgrA is a global regulator that controls the synthesis of virulence factors and other exoproteins. ComE is part of the ComD-ComE system that is part of a quorum-sensing signaling pathway that controls the development of competence, a physiological state required for genetic transformation. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	9.44046e-41
NZ_CP050805.1\|WP_003646442.1\|802320_802767_+\|ribonuclease-H	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	0.00017599
NZ_CP050805.1\|WP_003643774.1\|794348_796178_-\|type-1-glycerol-3-phosphate-oxidase	gnl\|CDD\|380303	NF033461, glycerol3P_ox_1, type 1 glycerol-3-phosphate oxidase. Glycerol-3-phosphate oxidase, also called alpha-glycerophosphate oxidase (GlpO), is an FAD-dependent enzyme related to the glycerol-3-phosphate dehydrogenase GlpD. Notably, GlpO releases hydrogen peroxide, which can contribute to virulence.	0

>NZ_CP050805.1|WP_015639936.1|788995_789202_-|hypothetical-protein
MKFDLENEYAVKAEGEMLVGGQFVVFKDSMKNWEPPHEDEKLSEAEVQEIIQQVKQNTNENTVQISFE
>NZ_CP050805.1|WP_108725669.1|788498_788615_-|hypothetical-protein
MNQGIISCLTDLVRYNDIYTMITGKDAATGYNLVTGTR
>NZ_CP050805.1|WP_003646449.1|787457_788375_-|hypothetical-protein
MTKRLSEQESYFSMSEFLESYYWASRDDDLGSLLGSVTLWSDDGELFDQAIAEDWHAFFSDVSNENHTVFESFQAVKQFVNEYLPDIAATTPVSGSLTYNIRIICEMTESQRNQEPVWQNWVAAVNWITNPNVVPVNESPFLKTGQSLPNPKEKGFRQNQFPIAKVLPAPRPEIPMGPSLEKVDLTQSYYAFVKFLQHYYQVSDDSELGNFLQQNRAISENNEEYRYWKGKFSRCSGNKKLLDILKAFLMVRDYFEIEFPDNALHTHPVRKLSCNLWKAAYLPHSQRIQTEVWQNWLTAVHQVIE
>NZ_CP050805.1|WP_016526893.1|787277_787451_-|hypothetical-protein
MSFDNQLSSQFKDQEDSYNAIILLYDYSYDKEQVVRKIATGENYRINYIGTVIYEDE
>NZ_CP050805.1|WP_003646450.1|786189_786732_-|ankyrin-repeat-domain-containing-protein
MKILNVFDAVRDGTFQDFKNFYEGNINVISGNLDLNLLCMAVTNDKNPEEKLQIIKFLFAEGIDVNYATQKEKRNALHLFYFCVLRPTIEYEMEITNLFIKHGMNVNATDKYNAIPLKYAITINNLPTSDNKEMYQLLLNKGSDYNLKDGFGKSCLDYAKEYSWRNDFLDIVKEYENSKN
>NZ_CP050805.1|WP_016526894.1|784866_786042_-|IS256-family-transposase
MNELTTEIIAALAQKQDLDEVFRHHLEIAINQLLQTELAEFLGYERYSYAGINTGNNRNGSYERSFDTKYGQLNLTIPRDRNGRFENHTLPAYGRHSDNLETTVIQLYTKGITTAEIAELIEKMYGAHYSKATVSNMTKAVNEQVQAFQQRRLASQYAAIFLDATYLPLKRDTVQKEAVHIAIGIRPDGTKEVLNYQVAPTESTGIWTELLGTLIKQGVKDVLLFVADGLVGLDEGLNRHFPKAKRQRCLVHVGRNLMNKVRVKDRKAVISDFKQVHRAANREAAELKLNEFANNWHQTYPKLIKDLLKMPNLLTFMDFPPAIRQSLYSTNLIENFNKHLKRTTHHKEQFPTEDSLDRFLVSQFNVYNEKSLKRIHRGFKGLQGTLEASFI
>NZ_CP050805.1|WP_016526896.1|783238_783982_-|response-regulator-transcription-factor
MFPIYLYEDNAEQRDNYCKTVNNTMMINEFAMELRVATDDQKIILADLNQQQDGLFFLDMEIGEDKQTGLELASRIRATIPLAKIVFITTHDELSFVTLERRIAPLDYILKDQSADLITQRIIKDINVVQNELKKTNSQRKDVFNYKLGTRYFSLALDDVILLSTSKLRPGSVQLHAINKVAEFPGNLNALEEKYPQFFRCDKSSLVNLNHLRSFDYKEKELLLDGEIRCKASFRKSRELNKLLRDN
>NZ_CP050805.1|WP_003646470.1|782164_782938_+|CPBP-family-intramembrane-metalloprotease
MPLIKVIITAIYYLIVLFLMNPLTDIMGIKDGPFQFILTESIILIAIIILNRRYVKQPIHWLPVNIMSILKKNSLPLSLAIIFLLIFFRNHMYQFLISLLLSLIVAITEEYAFRGMIFRTLLALNLKKFATLQATIASMMTASLIFAAMHLVNLLSQPVWSVLCQVLYVIGLGILLAAIYLKTGSLLAAISVHWLIDFSSFYSQGIDPTQSPINGPMEALLKGLFLNILFIGIATFILSSKHWKLLSILNIEDKIDE
>NZ_CP050805.1|WP_003643811.1|781907_782066_+|two-peptide-bacteriocin-plantaricin-EF-subunit-PlnF
MKKFLVLRDRELNAISGGVFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG
>NZ_CP050805.1|WP_003646471.1|781718_781883_+|hypothetical-protein
MLQFEKLQYSRLPQKSLPKYLVVLIGAVITLVKVFDIDEIGSVAGIRGILKSIR
>NZ_CP050805.1|WP_016526891.1|791068_793417_-|MucBP-domain-containing-protein
MTDSTDKVAPDETVKVGYGKAYDVTKQVKTITGYKRNATLDEHTRGTASKTTKEAVMYYDPLPYNIHVNYLLTDGQKLDELDVTGLYGDTYTTEATDFEDLYTVDTDRLPTNAQGTVTEKPTTVNYYYQPTTGQWVDVGNQSSVLVRQDTKHNVRSVSQIYANDSGFTVKYNQDAAQVAIAASDTNGTQDNSLVFDYNSKYTFELSKNETVTFKVDDQGQVTATRVLGAEQTVTTFDKSGQLKTVTTVTNANGTKSQQTNTVDGLKSMVTGEQYDLGLLNGLKVTAQKEINPSQAATTESKTTTDTSQSGSNQSTSTTATDQTETNESTAGSSTNATNASSSVDASSANSQGDTEATSQSGTSASADSKTDSSAASSTSQTTDGETTNTDDTTTGTTTDSGLGFKSPFTEDQNTSSALGSAQTSSSLNSDTSAAVQALIAEPNSTPVVLGEDASFEEGVPVNDPVFSNGEGVSPNNNPSSAATPLAQATNTRARLTQNGKLLYEGTLQADQGEQNLYVSPDTTVEVDGGADGDGFYLDTYDGDKGMAYTLGSGYAWAAENNDVTAAPASSATTSSESAASESSTNSSDSSRTASSAADHSTSSASISDASQSSHSTSSSENSRSESSSSSSTTGDSADADKQAAARSSQTQSNSVNGSSQAVGSSTVTSQSSVPTKANTKQASSTPTTKANRATVVAATSSTAPRQSRATTASASVPSVTSASAAAASRAKQRSAFKKQHPILNQILPKTNSAVATWLVWLGVGLLILTVAITMVIKKRGRD
>NZ_CP050805.1|WP_021731937.1|793611_794331_-|aquaporin-family-protein
MKDPLALQLLGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLNPAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATGPGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAGLNPIVVGILIIAIGLSLGGTTGYAINPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNVLP
>NZ_CP050805.1|WP_003643774.1|794348_796178_-|type-1-glycerol-3-phosphate-oxidase
MAFSATTRQQNIERLQNETLDLLVIGGGITGAGVAIQSTAMNMKTGLIDMQDFAEGTSSRSTKLVHGGIRYLKTFDVGVVADTVKERAVVQGIAPHIPKPDPMLLPIYDETGATFDLFSVKVAMDLYDKLAEVKDPKFTNYTLSREEVLQREPQLNPKHLVGGGVYLDFRNNDARLVIENIKKAHENGGIMASHVKATGLLHDDDGRINGITAEDLLTGASFEIHARIVINTTGPWSDTIRKMDHTEKYQSQMRPTKGVHLVVDAEKLPVPQPTYFDSGDQDGRMIFVVPRENKTYFGTTDTDYHGDLKHPTVTQEDVDYLLEIVNRRFPTAKITLDDIEASWAGLRPLIAANGSSDYNGGNSGKISDKSFKEVIKVVDQFESQEASREDVESVLNDLETSLAEDKLSPSAVSRGSSLTSSPDGLLTLAGGKITDYRKMAAGAMALIAKILADKYDAHFNEINSKNLPVSGGDIDPHNVDATIAFYAKQGTDNGLTNDEALRIANMYGSNAARVFSLIGKVEPTHGLSLAETISLRYALDEEMTLTPVDYLLRRTNHLLFMRDTLDGLKDGVIATMADYLGWDAATVKAQTELLNQTIAESDLTALKQG
>NZ_CP050805.1|WP_003643773.1|796192_797710_-|glycerol-kinase-GlpK
MTDKYIMAIDEGTTSTRAIIFDHAGHKVADSQREFPQYFPQPGWVEHNANEIWNAVLSTIANAFIESGIKPAQISGIGITNQRETTIVWDKQTGLPIYNAIVWQSRQTAPIAEKLVKDGYGDLIHQHTGLVTDAYFSATKIRWILDHVKGAQERAEKGELLFGTIDTWLLWKLTGGATHVTDYSNASRTMLFNIHDLKWDDQILQLLNIPAAMLPEVRTNSEVYGKTKDYHFFGSEVPISGMAGDQQAALFGQLAFEPGTVKNTYGTGAFIVMNTGEKPQLSDNNLLTTIGYGINGKVYYALEGSIFVAGSAIQWLRDGIRLVESAPDSERAARESHNENEVYVVPAFTGLGAPYWDSEARGSVFGLTRGTTREDFIKATLQALAYQTRDVVETMKKDSGIEIPVLKVDGGAARNDWLMQFQADILDTQIMRAANLETTALGAAFLAGLSVGYWQDLEELKASYKPGTSFDPEMGPAERTNLYEGWQAAVKATQVFKHTPYHAGK
>NZ_CP050805.1|WP_167803073.1|798175_799507_-|NAD(P)/FAD-dependent-oxidoreductase
MAEQYDVVVIGGGPAGNAMASGLKAQGKIVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWPALMAHKRGYTDGINDGTLNGLTGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLDLDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQLTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVGELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAVATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATLLSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY
>NZ_CP050805.1|WP_003641941.1|799584_800556_-|ABC-transporter-ATP-binding-protein
MTTAIEFQHVQKDFNGQTVIPDLNLTIDQGELFVLVGTSGSGKTTSLKMINCLEPLTAGKILVNGTDTTTIPVRSLRWQMGYVLQQIALFPTMTVAQNIAVIPEMKGTAKKEINQTIDELLAEVGLDPKEYRDRMPSELSGGEQQRIGILRAIAAQPDIVLMDEPFSALDPISRQQLQDLVLRLHARYHNTIVFVTHDMNEALKLGDRIGVMQHGQLIQVDTPAALAQHPVNDFVRNFFGASRAKNVYDVYVGRVGLIQGYLTEEPSVASGRIQSLDVQATLRTAFTALTDHDYVAVTEENRVVGYLDRQRIVAYLSQHEEVS
>NZ_CP050805.1|WP_003646443.1|800556_802083_-|ABC-transporter-permease/substrate-binding-protein
MQTLIQTFMDRRGDLLTALWQHLGISLASLVIAMVIAIPLAIWVVRRPRWAEGLLQLTSVLQTIPSLALLGLLIPLVGIGTVPAVIALVIYALLPIFQNTYLGISEIDASIEEAADAFGMSRMRKLFKVELPIALPQIIAGIRTALVLIIGTATLAALIGAGGLGTFIMLGIDRNDTSLLLIGAISSALLAILLSALVRWFQTAKPRHALIVFVGILALLGGGGAYSVYANRVETITIAGKLGSEPEILINMYKQLIEAEDEHVHVTLKPNFGKTTFLFSALKNNQVDIYPEFTGSVLETLVKGNNPAGQTANQTYQLAKQRLAKQEQMTYLKPMQYNNTYALAVTKKFQQEHHLKTISDLTQVESILKPGMTLEFIDRNDGLKGIKKTYGLDVTAKSMEPALRYEAISKGKINLVDAYATDSELRQYHLALLKDNKHFFPTYQGAPLMKTNFANKHPKVVKALNKLAGKISETDMQEMNYEVNVKKQSASTVAHRYLVKHGLLKEGR
>NZ_CP050805.1|WP_003646442.1|802320_802767_+|ribonuclease-H
MATIHLYLASTNHQSTNITATTPAAWVVILRYADHQKALNDGGYGHTETSLALSALTTALATLKRHDLPVHVHTTTEQVAAVISEQRYLSWRQNNWDVPEADQPDLPQWQTLIPIIEEFPNLTITYHPVDDPAMTTATTTLTAVMTKL
>NZ_CP050805.1|WP_003643768.1|803656_804568_-|oxidoreductase
MSQPRVILITGASSGIGKATALKLQAQGNIVYGAARRIEKMTDLAAAGVHVLKVDVTDEATLIAAVKTIQVEQGRIDVLINNAGYGSYGSLEDVPVAEGEYQFKVNVFGVMRLTQLVLPLMRAQHRGRIINVSSIGGKIYQPLSAWYMGTKHAIEGMSDSLRMEVAPFGIDVVIVEPGGIKTEWAGIAEKKLLAVSGETAYHEQAVKVGAMLSLFDQFASNPGVIAKLMVRAVNDVKPKTRYHAGMGAGVSLTARQWLSDRQFDRMMNSAVNGAAKLSKVTRRKDRRTGSRHYRHGKIPADNN
>NZ_CP050805.1|WP_003646441.1|804704_805625_+|ribonucleoside-hydrolase-RihC
MSTKIIMDTDPGIDDAAAITFALNHPDLDLQLITTVAGNVTVDKTTLNALKLTRFFNSDVPVAGGAAQPLIKPFEDAVRIHGVSGMPGYDFPTDLAEPLPETAVEALRDYIMAAEQPITLVPTGAYTNIALLFKTYPEVMPHIKEIVAMGGALGKGNMTSAAEFNVFTDPHAAEIMYQSGVPITMVGLDVTMKALLTRESIEQLPTLGKTGEMLHALFGHYNDRNQTGVAMHDVNTLFYLLHPEAFTTEKMWIDVQTEGPANGETVGDIRGAYHDGKTNATVCVDIDAAAFNKWFLETVAAIDQPK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050805_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050805_2

1569010-1569095

Orphan

Consensus_repeat	Method
AATAAGATACTTTAAGTTTCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050805_2

>merge|NZ_CP050805|2|1569010-1569095|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTATTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCGAATAAGACACTTTAAGTTTCTTA

>NZ_CP050805|2|1|1569010-1569095|CRISPRCasFinder
AATAAGATACTTTAAGTTTCTTA	TTGACTTTTTCTTTATATAGCGTATTATACCAGTTATGCG
AATAAGACACTTTAAGTTTCTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050805.1\|WP_003642356.1\|1561184_1561640_+\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
NZ_CP050805.1\|WP_003643397.1\|1569109_1570588_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP050805.1\|WP_003645365.1\|1570919_1571159_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_033609876.1\|1567330_1568272_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP050805.1\|WP_003645369.1\|1575157_1575724_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP050805.1\|WP_003642340.1\|1577392_1577677_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
NZ_CP050805.1\|WP_016511877.1\|1559647_1560028_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP050805.1\|WP_003643398.1\|1568392_1568992_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP050805.1\|WP_016527331.1\|1566311_1567106_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP050805.1\|WP_016511874.1\|1564326_1565322_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP050805.1\|WP_016527335.1\|1553418_1559550_+\|KxYKxGKxW-signal-peptide-domain-containing-protein	unknown	unknown	gnl\|CDD\|375451
NZ_CP050805.1\|WP_003645367.1\|1572106_1573060_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
NZ_CP050805.1\|WP_167803103.1\|1575882_1576611_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP050805.1\|WP_003645366.1\|1571405_1571597_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050805.1\|WP_003643392.1\|1576743_1577109_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP050805.1\|WP_015640979.1\|1573278_1573845_+\|DUF1211-domain-containing-protein	unknown	unknown	gnl\|CDD\|226078
NZ_CP050805.1\|WP_003642344.1\|1573993_1575031_-\|aldehyde-reductase	unknown	unknown	gnl\|CDD\|187538
NZ_CP050805.1\|WP_167803102.1\|1562696_1563590_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187572
NZ_CP050805.1\|WP_003642355.1\|1561656_1562403_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|226674
NZ_CP050805.1\|WP_003643401.1\|1563570_1564083_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100

Protein	Function_ID	Function_description	E-value
NZ_CP050805.1\|WP_003642356.1\|1561184_1561640_+\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	9.94104e-53
NZ_CP050805.1\|WP_003643397.1\|1569109_1570588_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	3.12844e-72
NZ_CP050805.1\|WP_003645369.1\|1575157_1575724_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.749e-05
NZ_CP050805.1\|WP_033609876.1\|1567330_1568272_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	4.39721e-56
NZ_CP050805.1\|WP_003642340.1\|1577392_1577677_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
NZ_CP050805.1\|WP_016511877.1\|1559647_1560028_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.28343e-18
NZ_CP050805.1\|WP_003643398.1\|1568392_1568992_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
NZ_CP050805.1\|WP_016527331.1\|1566311_1567106_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.35948e-113
NZ_CP050805.1\|WP_016511874.1\|1564326_1565322_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	3.00121e-78
NZ_CP050805.1\|WP_016527335.1\|1553418_1559550_+\|KxYKxGKxW-signal-peptide-domain-containing-protein	gnl\|CDD\|375451	pfam17966, Mub_B2, Mub B2-like domain. This entry corresponds to the Mub B2 domain. This domain is related to the Mub B1 domain pfam17965. This domain may be involved in mucin binding. This domain is often found associated with the related pfam17965 in bacterial cell surface proteins.	2.06076e-13
NZ_CP050805.1\|WP_003645367.1\|1572106_1573060_+\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	1.45542e-130
NZ_CP050805.1\|WP_167803103.1\|1575882_1576611_-\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.66295e-90
NZ_CP050805.1\|WP_003642344.1\|1573993_1575031_-\|aldehyde-reductase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
NZ_CP050805.1\|WP_003643392.1\|1576743_1577109_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.44304e-30
NZ_CP050805.1\|WP_015640979.1\|1573278_1573845_+\|DUF1211-domain-containing-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	6.30859e-29
NZ_CP050805.1\|WP_167803102.1\|1562696_1563590_+\|SDR-family-oxidoreductase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.58821e-129
NZ_CP050805.1\|WP_003642355.1\|1561656_1562403_+\|SDR-family-oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
NZ_CP050805.1\|WP_003643401.1\|1563570_1564083_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08

>NZ_CP050805.1|WP_003643398.1|1568392_1568992_-|TetR/AcrR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>NZ_CP050805.1|WP_033609876.1|1567330_1568272_+|ABC-transporter-substrate-binding-protein
METVVTKRWQIVKLGLVLGLMGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILIGTSSAVANGKYAQYNKIAPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDEQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>NZ_CP050805.1|WP_016527331.1|1566311_1567106_-|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLNGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKKIFNIDATLVDYHGTPLILTYNGCQEVAPA
>NZ_CP050805.1|WP_016511874.1|1564326_1565322_-|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTSRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISMAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>NZ_CP050805.1|WP_003643401.1|1563570_1564083_-|TetR/AcrR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>NZ_CP050805.1|WP_167803102.1|1562696_1563590_+|SDR-family-oxidoreductase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGMTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVIRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>NZ_CP050805.1|WP_003642355.1|1561656_1562403_+|SDR-family-oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>NZ_CP050805.1|WP_003642356.1|1561184_1561640_+|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRVFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>NZ_CP050805.1|WP_016511877.1|1559647_1560028_-|MerR-family-transcriptional-regulator
MLTFKIPEQQHYFTTKEVTTITGMTKDALRYYEHLGILPDVQRNQYNYRQYSHKNLETLQLIKIFRDLDLDLSLLTPAHLALDGQAKVVAFKQYQQVIRDRIRHLEAIDQLLATKIDYFEHQSIDT
>NZ_CP050805.1|WP_016527335.1|1553418_1559550_+|KxYKxGKxW-signal-peptide-domain-containing-protein
MQKRRLQRARLTEKRAYKMYKKGRLWLVAGLSTFTLETGLVQLQAMADTTSTPVSQVEKTTDHANSSATLTTKVATNTNDTANADTKSSNSSSVHATTNNSSGAATASDDRAKTSVAEHTLSSATDGTKTTDSSTTDLTDSTTSHSSSVATANVSATSAAQTARTVNGTTNSAVSPNKVTASAAATEIESDSVKTKEITKTTGTAKAVSLAVTDTSMSQIKLRSARAAVATVATISSTTKMYDGVAGTPDRYTVTLADGIKAPTDWAVTKDPNVYTDIDLSDFDKNQFGRGIGTYPIAFSEFGLSKLAEANDSLDITAANVVTGTLTIEQAPVHSAAITIGSTSIDYGDSKPSSYQITVTNGYFDKYNAPSTWTLVDSTSSGVIKTTYTIASDSGDIAVPTATEAGTYVLALSAQGLAALQQANPNYEFTADSIVNGQLVIAAHDIITMGATTVLVNKTTSTVQVAVNSRAVSVPGDWEVYYNDKLTDSIVYKVPVSYTTYSTAVDTSTVGKYTITLTDAAMATLAQLNSSTVFNNTNVDDGVVLVKESNAVTISPSNYGAKASVNNNVTAASIQNARDKGINLLYGQGLYLVLPLLNVAQSEMTVDNLTEYVIIPAGFKVATTGNGDTVQVATDPVGALTAAIETMMTKNNVTYQGLAVTQLTDYNGRQTFKVHLDQTAAYSNGLFETMVYTLLPTIAVQSSGVTSGLIGNQVSSPDSAVIYVTDDPNENNGSYSLKDQNYPNIDKVAKALGVADAVTISSSFTDYLYTYTLKAAEADDIYMLQAPDGSSLGIIVVSGNVGTTYVPSRELQTITSSGNDYYYLNPDSIPRTRTYDSPDQRTYTLTYQRYVTTTTDTAAKITIAPASKVYDNNVTTDPSRYTVYLPTEYTVPSDWTADSAATAVDGTTAYQVSTDYLNTTAIDQNVGTYAVTLNSAGMAALAAANPDFLIAGDVNVGGTLTITQRPVTITLPDTILWANGQEQNITPVITGVVAGQSLDYTLTSGLTDPDTTTITATLTNATANSNYKLTNSPSGQLTVGAVAVVYQYGYRDKAGTLHVVTTANGTATHGTDVTAKGYLSYTTSDTTAAHAKTGYTLQPESTGYQADGTLADIGGQVVYTYLANTEKIAVVYVDQDKNSVILYQVPLSGSFGTHTNYTTAQDIAAYEKLGYVLASDEVPAQLEFDQDTEQTYYVYLKHGTITATVDQPGNVAVSDLMKTSQRTIHYVYADNTPTDLADVLQTVTYTRTATVDAVDRTVLSYGNWTTTVNSYPAIESPTITGYTADQTTIAAAVPASMGEATEATVRYSANLETIRVQFVDGTTDNQVLGYIDLNGKYGDAADYTVTADIAKYSKLGYEPVSSDLPDQLIYNQNAQVYTVTLAHRHVTVSVVHPGQPGQAIDADYPAGPKYPAGTGRDSLQQTVVRTITYQYASGESAAETVNQSVTFNRTATFDMATGKQLTYGDWTVAPGQSALLAAVTSPTITGYQASIAEVEATSVTSHDKSCSIAITYTAKSQTATVAFVDVTSGKTLPTMVVTGAYGTTNSYSPVSQIAAYEQLGYRLVSNNVPTTGITFDQNDVIKSYTVKLAHQMTTVTPTKPGQPGQPVDSAHPEGPKYPAGTGLKDLTTSVQRVITYVYNDGQTAASTVTQTVSFERKAAFDQVTKVVTYTDWRTPESALTGVYAVVESPIIAGYTPNATRVADVTVSAGDTDSRQTVTYQANLETATVTYVDVTTGHRLGTSVTLTGRFGTQADYQPTTMIAQYTQAGYVLMGSDYPATGVTFNQAGVVQKYTVYLAHNKIVITAPDQLTKTITQTVHYQDQAGHTLQADTIRALTFTRSGMKDAVTGVATYRDWAPTGLNFTAVSAPTIAKYHALTATTQAVAITAASADDVQTLTYALDVPTPTKPVKPTKPAKPTKPTTSDDLIKPTTKPITAAKPTQLTEPATVVKDFQATTGNQTPAKSTRTLVSSRIKAVKTAPASAIIKPGSEVTEPAHKAQADTTSRLPQTGETRRSEAAAETLGLTLATLLLGFGGLKRKRHEK
>NZ_CP050805.1|WP_003643397.1|1569109_1570588_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVAPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALVLFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>NZ_CP050805.1|WP_003645365.1|1570919_1571159_+|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLMLEFVLLFVVKGSIDRYNQLPYDWFAYLTTLIHYFLGTFTFFGIILVIECVWNKLK
>NZ_CP050805.1|WP_003645366.1|1571405_1571597_-|hypothetical-protein
MAAFSEKQLKKAPVTDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>NZ_CP050805.1|WP_003645367.1|1572106_1573060_+|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRIQLDYLDSFLLHRPDPLMDPAEVAAAFDELQAAGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>NZ_CP050805.1|WP_015640979.1|1573278_1573845_+|DUF1211-domain-containing-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFVSVILATKRKWHLRKYF
>NZ_CP050805.1|WP_003642344.1|1573993_1575031_-|aldehyde-reductase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>NZ_CP050805.1|WP_003645369.1|1575157_1575724_+|TetR/AcrR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLDAYFAPAIAARFQDVLQHVPANQKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQTTMANGTLTAVQLKYWTRFMSAGVYAIWREWLLGGQLEPLTMIHELLATLQTATMQALTQAQK
>NZ_CP050805.1|WP_167803103.1|1575882_1576611_-|SDR-family-oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMCDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>NZ_CP050805.1|WP_003643392.1|1576743_1577109_+|helix-turn-helix-transcriptional-regulator
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKKLEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>NZ_CP050805.1|WP_003642340.1|1577392_1577677_-|DUF1905-domain-containing-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP050805_1	1.7\|790603\|18\|NZ_CP050805\|CRT	790603-790620	18	NZ_CP050805.1	790315-790332	1	0.944
NZ_CP050805_1	1.1\|790387\|18\|NZ_CP050805\|CRT	790387-790404	18	NZ_CP050805.1	197775-197792	2	0.889
NZ_CP050805_1	1.1\|790387\|18\|NZ_CP050805\|CRT	790387-790404	18	NZ_CP050805.1	790351-790368	2	0.889
NZ_CP050805_1	1.2\|790423\|18\|NZ_CP050805\|CRT	790423-790440	18	NZ_CP050805.1	197775-197792	2	0.889
NZ_CP050805_1	1.2\|790423\|18\|NZ_CP050805\|CRT	790423-790440	18	NZ_CP050805.1	790351-790368	2	0.889
NZ_CP050805_1	1.3\|790459\|18\|NZ_CP050805\|CRT	790459-790476	18	NZ_CP050805.1	760333-760350	2	0.889
NZ_CP050805_1	1.3\|790459\|18\|NZ_CP050805\|CRT	790459-790476	18	NZ_CP050805.1	1977210-1977227	2	0.889
NZ_CP050805_1	1.4\|790495\|18\|NZ_CP050805\|CRT	790495-790512	18	NZ_CP050805.1	1977210-1977227	2	0.889
NZ_CP050805_1	1.4\|790495\|18\|NZ_CP050805\|CRT	790495-790512	18	NZ_CP050806.1	56547-56564	2	0.889
NZ_CP050805_1	1.4\|790495\|18\|NZ_CP050805\|CRT	790495-790512	18	NZ_CP050809.1	8977-8994	2	0.889
NZ_CP050805_1	1.5\|790531\|18\|NZ_CP050805\|CRT	790531-790548	18	NZ_CP050805.1	790351-790368	2	0.889
NZ_CP050805_1	1.6\|790567\|18\|NZ_CP050805\|CRT	790567-790584	18	NZ_CP050805.1	1977210-1977227	2	0.889
NZ_CP050805_1	1.6\|790567\|18\|NZ_CP050805\|CRT	790567-790584	18	NZ_CP050806.1	56547-56564	2	0.889
NZ_CP050805_1	1.6\|790567\|18\|NZ_CP050805\|CRT	790567-790584	18	NZ_CP050809.1	8977-8994	2	0.889
NZ_CP050805_1	1.8\|790639\|18\|NZ_CP050805\|CRT	790639-790656	18	NZ_CP050805.1	790351-790368	2	0.889
NZ_CP050805_1	1.9\|790675\|18\|NZ_CP050805\|CRT	790675-790692	18	NZ_CP050805.1	1009779-1009796	2	0.889

1. spacer 1.7|790603|18|NZ_CP050805|CRT matches to position: 790315-790332, mismatch: 1, identity: 0.944

cttcttcgaagatttttt	CRISPR spacer
ctttttcgaagatttttt	Protospacer
***.**************

2. spacer 1.1|790387|18|NZ_CP050805|CRT matches to position: 197775-197792, mismatch: 2, identity: 0.889

cttcttggaagatttctt	CRISPR spacer
cttcgtggaagaattctt	Protospacer
**** ******* *****

3. spacer 1.1|790387|18|NZ_CP050805|CRT matches to position: 790351-790368, mismatch: 2, identity: 0.889

cttcttggaagatttctt	CRISPR spacer
cttcttagatgatttctt	Protospacer
******.** ********

4. spacer 1.2|790423|18|NZ_CP050805|CRT matches to position: 197775-197792, mismatch: 2, identity: 0.889

cttcttggaagatttctt	CRISPR spacer
cttcgtggaagaattctt	Protospacer
**** ******* *****

5. spacer 1.2|790423|18|NZ_CP050805|CRT matches to position: 790351-790368, mismatch: 2, identity: 0.889

cttcttggaagatttctt	CRISPR spacer
cttcttagatgatttctt	Protospacer
******.** ********

6. spacer 1.3|790459|18|NZ_CP050805|CRT matches to position: 760333-760350, mismatch: 2, identity: 0.889

tttcttggaagacttctt	CRISPR spacer
tttcttggaataattctt	Protospacer
********** * *****

7. spacer 1.3|790459|18|NZ_CP050805|CRT matches to position: 1977210-1977227, mismatch: 2, identity: 0.889

tttcttggaagacttctt	CRISPR spacer
tttcttggtagacttgtt	Protospacer
******** ****** **

8. spacer 1.4|790495|18|NZ_CP050805|CRT matches to position: 1977210-1977227, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttggtagacttgtt	Protospacer
******** ****** **

9. spacer 1.4|790495|18|NZ_CP050805|CRT matches to position: 56547-56564, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

10. spacer 1.4|790495|18|NZ_CP050805|CRT matches to position: 8977-8994, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

11. spacer 1.5|790531|18|NZ_CP050805|CRT matches to position: 790351-790368, mismatch: 2, identity: 0.889

cttcttagaagacttctt	CRISPR spacer
cttcttagatgatttctt	Protospacer
********* **.*****

12. spacer 1.6|790567|18|NZ_CP050805|CRT matches to position: 1977210-1977227, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttggtagacttgtt	Protospacer
******** ****** **

13. spacer 1.6|790567|18|NZ_CP050805|CRT matches to position: 56547-56564, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

14. spacer 1.6|790567|18|NZ_CP050805|CRT matches to position: 8977-8994, mismatch: 2, identity: 0.889

tttcttggaagacttttt	CRISPR spacer
tttcttgaaagatttttt	Protospacer
*******.****.*****

15. spacer 1.8|790639|18|NZ_CP050805|CRT matches to position: 790351-790368, mismatch: 2, identity: 0.889

cttcttagaagacttctt	CRISPR spacer
cttcttagatgatttctt	Protospacer
********* **.*****

16. spacer 1.9|790675|18|NZ_CP050805|CRT matches to position: 1009779-1009796, mismatch: 2, identity: 0.889

tttcctggccgctttctt	CRISPR spacer
ttttcttgccgctttctt	Protospacer
***.** ***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP050805_1	1.10\|790711\|30\|NZ_CP050805\|CRT	790711-790740	30	NZ_CP006988	Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence	31053-31082	8	0.733

1. spacer 1.10|790711|30|NZ_CP050805|CRT matches to NZ_CP006988 (Rhizobium sp. IE4771 plasmid pRetIE4771b, complete sequence) position: , mismatch: 8, identity: 0.733

tttcttggccgctttcttcttgtgtgactt	CRISPR spacer
cttcttggcggctttattcttgtgcggtcg	Protospacer
.******** ***** ********.*...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 38107

Lactobacillus_phage(90.32%)

integrase,capsid,tail,head,portal,terminase,protease

attL 26477:26493|attR 34277:34293

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803043.1\|2423_4193_-\|tail	phage tail protein	E9LUR2	Lactobacillus_phage	0.0e+00	91.5
WP_167803044.1\|4266_8874_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	70.6
WP_015640500.1\|8905_9091_-	hypothetical protein	NA	NA	NA	NA
WP_123808113.1\|9135_9510_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	3.5e-57	93.5
WP_167803045.1\|9586_10240_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	3.2e-106	88.5
WP_123808109.1\|10256_10637_-	DUF806 family protein	A0A2P0ZLF4	Lactobacillus_phage	9.3e-58	88.1
WP_123808107.1\|10636_11044_-	HK97 gp10 family phage protein	A0A2P0ZLE6	Lactobacillus_phage	9.4e-64	91.5
WP_041142734.1\|11046_11394_-\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	1.2e-43	72.2
WP_123808105.1\|11380_11716_-\|head,tail	phage gp6-like head-tail connector protein	E9LUQ4	Lactobacillus_phage	1.7e-47	88.2
WP_167803046.1\|11788_13021_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	2.5e-208	92.4
WP_123808102.1\|13020_13776_-\|protease	Clp protease ClpP	E9LUQ2	Lactobacillus_phage	4.4e-123	92.8
WP_123808100.1\|13753_14947_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	2.8e-225	99.5
WP_024624700.1\|14949_15144_-	DUF1056 family protein	E9LUQ0	Lactobacillus_phage	2.8e-26	96.9
WP_123808098.1\|17084_17543_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	4.7e-80	96.7
WP_167803047.1\|17750_18263_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	1.4e-80	92.3
WP_167803048.1\|18231_18378_-	hypothetical protein	E9LUP6	Lactobacillus_phage	9.8e-16	80.4
WP_167803049.1\|18361_18676_-	hypothetical protein	NA	NA	NA	NA
WP_167803050.1\|19078_19510_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	4.3e-75	96.5
WP_167803051.1\|19645_19804_-	hypothetical protein	O03920	Lactobacillus_phage	3.8e-13	75.0
WP_167803052.1\|19800_19965_-	hypothetical protein	A0A2P0ZLB5	Lactobacillus_phage	1.5e-17	92.3
WP_167803053.1\|19957_20338_-	hypothetical protein	NA	NA	NA	NA
WP_071542861.1\|20334_20853_-	hypothetical protein	O03915	Lactobacillus_phage	1.5e-37	52.6
WP_046038735.1\|21012_21798_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	4.1e-132	91.2
WP_003641373.1\|23324_23630_-	hypothetical protein	NA	NA	NA	NA
WP_167803054.1\|23630_23801_-	hypothetical protein	NA	NA	NA	NA
WP_015825330.1\|24076_24256_-	helix-turn-helix domain-containing protein	E9LUT5	Lactobacillus_phage	1.4e-24	100.0
WP_063487252.1\|24345_24675_-	DUF771 domain-containing protein	E9LUT3	Lactobacillus_phage	4.4e-48	81.7
WP_003644549.1\|24767_25124_+	hypothetical protein	NA	NA	NA	NA
WP_167803055.1\|25120_25324_-	hypothetical protein	NA	NA	NA	NA
WP_087511436.1\|25334_25544_-	hypothetical protein	NA	NA	NA	NA
WP_167803056.1\|25555_26251_-	phage regulatory protein	D2IYT0	Enterococcus_phage	3.9e-70	62.6
WP_021732033.1\|26265_26487_-	hypothetical protein	NA	NA	NA	NA
26477:26493	attL	NA	NA	NA	NA
WP_167803057.1\|26727_27066_+	helix-turn-helix transcriptional regulator	Q8W5Y0	Listeria_phage	4.6e-16	43.1
WP_046783456.1\|27075_27354_+	hypothetical protein	D2KRD5	Lactobacillus_phage	1.3e-21	59.3
WP_167803058.1\|27410_27797_+	hypothetical protein	NA	NA	NA	NA
WP_003641358.1\|28714_28915_+	hypothetical protein	E9LUS6	Lactobacillus_phage	4.9e-26	100.0
WP_027822546.1\|29220_29403_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	8.8e-14	66.7
WP_003641356.1\|29587_29902_+	hypothetical protein	NA	NA	NA	NA
WP_056988408.1\|29973_30204_-	hypothetical protein	U5U783	Lactobacillus_phage	5.4e-08	47.5
WP_063485466.1\|30227_30965_+	hypothetical protein	U5U717	Lactobacillus_phage	4.4e-35	40.7
WP_123808165.1\|31128_32265_+\|integrase	site-specific integrase	E9LUS1	Lactobacillus_phage	7.5e-212	98.4
WP_041142698.1\|32909_35177_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.0e-118	31.5
34277:34293	attR	NA	NA	NA	NA
WP_003643147.1\|35241_35529_-	hypothetical protein	NA	NA	NA	NA
WP_003643148.1\|35643_36156_+	hypothetical protein	NA	NA	NA	NA
WP_003643149.1\|36272_36749_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003645251.1\|37420_38107_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_2

48350 : 49208

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643164.1\|48350_49208_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	1.3e-17	33.0

DBSCAN-SWA_3

54468 : 55984

Lactobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643169.1\|54468_55116_+	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	2.4e-45	47.5
WP_016527036.1\|55297_55984_-	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	6.3e-12	32.8

DBSCAN-SWA_4

59086 : 60187

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527034.1\|59086_60187_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-23	33.8

DBSCAN-SWA_5

66506 : 70675

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645265.1\|66506_68933_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	68.0
WP_015640223.1\|69395_70079_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_003644228.1\|70147_70675_+	rRNA methyltransferase	A0A2H4PQV0	Staphylococcus_phage	1.7e-33	46.6

DBSCAN-SWA_6

85560 : 86748

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644222.1\|85560_86748_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.2e-144	67.2

DBSCAN-SWA_7

106895 : 112171

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644210.1\|106895_109001_-	LTA synthase family protein	W6LM83	Streptococcus_phage	2.0e-157	48.1
WP_003643297.1\|109156_109393_-	YkuJ family protein	NA	NA	NA	NA
WP_003646543.1\|109584_110772_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003646542.1\|110932_112171_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.4e-16	27.9

DBSCAN-SWA_8

118936 : 124876

Agrobacterium_phage(25.0%)

protease,integrase

attL 114029:114042|attR 123500:123513

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
114029:114042	attL	NA	NA	NA	NA
WP_003644206.1\|118936_121156_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	7.3e-126	40.4
WP_003646539.1\|121270_121822_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	1.4e-30	42.8
WP_003643287.1\|122015_122405_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003643241.1\|122824_123790_-	ATP-binding cassette domain-containing protein	Q6GZ03	Mycoplasma_phage	5.7e-11	36.4
123500:123513	attR	NA	NA	NA	NA
WP_003643240.1\|123796_124876_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-18	29.4

DBSCAN-SWA_9

135314 : 139579

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643227.1\|135314_136892_-	peptide chain release factor 3	D0R0F5	Streptococcus_phage	7.7e-29	25.1
WP_016527024.1\|137189_138512_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-25	27.1
WP_003644199.1\|138682_139579_+	decarboxylating 6-phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	1.9e-48	35.7

DBSCAN-SWA_10

142640 : 143039

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643222.1\|142640_143039_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	9.3e-16	39.9

DBSCAN-SWA_11

146402 : 147134

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644195.1\|146402_147134_+	gamma-D-glutamate-meso-diaminopimelate muropeptidase	A0A0A8WF62	Clostridium_phage	1.0e-15	43.7

DBSCAN-SWA_12

154539 : 162075

Lactobacillus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002816285.1\|154539_154791_+\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
WP_003645717.1\|154844_155687_+\|transposase	IS3 family transposase	Q6J1X2	Lactobacillus_phage	1.7e-155	98.6
WP_016527019.1\|157666_158329_-	helix-turn-helix domain-containing protein	A0A0C5AJ29	Paenibacillus_phage	1.8e-24	30.2
WP_003643315.1\|158735_159452_-	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	5.6e-19	32.7
WP_016527018.1\|159641_160571_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
WP_015640196.1\|160956_162075_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.7e-20	31.2

DBSCAN-SWA_13

170144 : 174526

Diachasmimorpha_longicaudata_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641354.1\|170144_171479_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.9e-37	30.9
WP_003646272.1\|171491_172499_-	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_003638174.1\|172685_172886_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
WP_003641352.1\|173228_173594_+	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_003646273.1\|173749_174526_-	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1

DBSCAN-SWA_14

177987 : 184355

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646275.1\|177987_180327_-	cation-translocating P-type ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	7.1e-39	24.8
WP_015640184.1\|180594_181173_-	transcription regulator	NA	NA	NA	NA
WP_003644130.1\|181625_182999_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.2e-124	50.0
WP_003641344.1\|183332_184355_-	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5

DBSCAN-SWA_15

188879 : 196776

Serratia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527015.1\|188879_190919_-	NAD-dependent DNA ligase LigA	A0A289ZTZ3	Serratia_phage	7.0e-91	36.5
WP_003644128.1\|190935_193203_-	DNA helicase PcrA	A7KV33	Bacillus_phage	4.8e-133	42.7
WP_003641337.1\|193643_194813_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_003644127.1\|194925_195474_-	DUF2179 domain-containing protein	NA	NA	NA	NA
WP_003641335.1\|195496_196084_-	xanthine phosphoribosyltransferase	NA	NA	NA	NA
WP_015380033.1\|196134_196776_-	glycoside hydrolase family 73 protein	S5M633	Brevibacillus_phage	6.7e-24	42.0

DBSCAN-SWA_16

201820 : 205314

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646281.1\|201820_203581_-	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	1.7e-24	24.3
WP_003646282.1\|203580_205314_-	thiol reductant ABC exporter subunit CydD	A0A076FI99	Aureococcus_anophage	5.1e-10	21.6

DBSCAN-SWA_17

219447 : 220836

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646286.1\|219447_220836_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	4.5e-57	34.6

DBSCAN-SWA_18

234546 : 235284

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645514.1\|234546_235284_-	metal ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.4e-11	26.1

DBSCAN-SWA_19

254285 : 255991

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379998.1\|254285_255173_-	energy-coupling factor ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-13	31.6
WP_027821308.1\|255148_255991_-	energy-coupling factor ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-14	30.8

DBSCAN-SWA_20

278111 : 363279

Lactobacillus_phage(16.67%)

bacteriocin,integrase,transposase,tRNA,protease

attL 357805:357826|attR 361623:361644

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645499.1\|278111_280208_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.4e-67	27.5
WP_003638057.1\|280349_280820_-	30S ribosomal protein S7	NA	NA	NA	NA
WP_003641249.1\|280836_281250_-	30S ribosomal protein S12	NA	NA	NA	NA
WP_003641247.1\|282845_286487_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.3e-63	24.3
WP_003644088.1\|286504_290119_-	DNA-directed RNA polymerase subunit beta	A0A1B1ISA9	uncultured_Mediterranean_phage	1.5e-51	25.1
WP_003644087.1\|290365_290968_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003641244.1\|291146_293651_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	2.9e-123	38.3
WP_003644086.1\|293669_294137_-	CtsR family transcriptional regulator	NA	NA	NA	NA
WP_003644085.1\|295678_296956_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.4e-94	49.5
WP_003641239.1\|297238_297874_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	8.9e-53	47.5
WP_016527004.1\|298264_299038_-	M15 family metallopeptidase	NA	NA	NA	NA
WP_003645494.1\|299383_300835_-	amino acid permease	NA	NA	NA	NA
WP_016527003.1\|301218_302901_-	acetolactate synthase AlsS	NA	NA	NA	NA
WP_015640132.1\|303086_303611_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_016527002.1\|303622_304168_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016527001.1\|304230_305025_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003645492.1\|305209_305872_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_016527000.1\|306133_307171_+	transcriptional attenuator, cell envelope-related, LytR family	NA	NA	NA	NA
WP_003641229.1\|307457_307919_-	threonine/serine exporter	NA	NA	NA	NA
WP_003641228.1\|307952_308702_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_003641227.1\|308871_309072_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.0e-23	78.8
WP_003641226.1\|309323_309971_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_003644081.1\|310182_310527_+	hypothetical protein	NA	NA	NA	NA
WP_003641224.1\|311030_311495_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003641223.1\|311624_313103_+	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_003641222.1\|313102_313825_+	DUF4811 domain-containing protein	NA	NA	NA	NA
WP_016526998.1\|314594_315737_-	hypothetical protein	NA	NA	NA	NA
WP_003641218.1\|316721_316940_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003645727.1\|317270_317972_+	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_003645729.1\|317968_318295_+	AzlD domain-containing protein	NA	NA	NA	NA
WP_016526997.1\|318765_320667_+	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	2.3e-35	32.4
WP_003641214.1\|320671_321874_+	aspartate kinase	NA	NA	NA	NA
WP_003645731.1\|322068_323550_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_003645732.1\|323893_325294_+	MFS transporter	NA	NA	NA	NA
WP_033615720.1\|325280_326294_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_003641210.1\|326437_326767_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003645735.1\|326975_327644_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_016526995.1\|327775_328345_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011101234.1\|328395_329160_-	YibE/F family protein	NA	NA	NA	NA
WP_015640120.1\|329156_330407_-	YibE/F family protein	NA	NA	NA	NA
WP_003645738.1\|330370_331372_-	hypothetical protein	NA	NA	NA	NA
WP_003645739.1\|331791_332556_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641203.1\|332908_333235_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645740.1\|333426_334308_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_016511043.1\|334350_336159_-	DNA helicase RecQ	M1PGQ0	Moumouvirus	1.0e-77	36.1
WP_003641200.1\|336416_336614_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003644064.1\|336833_337100_+	hypothetical protein	NA	NA	NA	NA
WP_003645742.1\|337150_338383_+	hypothetical protein	NA	NA	NA	NA
WP_003641197.1\|338418_339825_+	C69 family dipeptidase	NA	NA	NA	NA
WP_003641196.1\|340277_341285_+	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
WP_003645743.1\|341323_342619_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	4.2e-57	31.2
WP_016526992.1\|342789_343419_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_003641193.1\|343527_344001_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_016526991.1\|344279_346169_-	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	8.9e-16	26.2
WP_003645746.1\|346355_347282_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
WP_003644057.1\|347352_347904_-	helix-turn-helix domain-containing protein	X2CXD8	Lactobacillus_phage	4.9e-07	48.4
WP_003645747.1\|348003_348756_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003644055.1\|348824_349319_-	kinase	NA	NA	NA	NA
WP_003645748.1\|349407_349527_-	putative metal homeostasis protein	NA	NA	NA	NA
WP_071542762.1\|349735_353509_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003645751.1\|353623_354154_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_077727077.1\|354289_355465_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_016526894.1\|356378_357554_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_046783358.1\|357791_358379_+	restriction endonuclease subunit S	NA	NA	NA	NA
357805:357826	attL	NA	NA	NA	NA
WP_015379944.1\|358389_359307_-\|integrase	site-specific integrase	A8ATM2	Listeria_phage	2.7e-74	44.7
WP_016526887.1\|359574_360504_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_167803063.1\|360598_361696_-	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	5.0e-11	27.4
361623:361644	attR	NA	NA	NA	NA
WP_016526987.1\|361692_363279_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	4.2e-176	62.9

DBSCAN-SWA_21

366393 : 368928

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645758.1\|366393_368928_-	M1 family metallopeptidase	A0A0P0IY26	Acinetobacter_phage	3.5e-68	27.4

DBSCAN-SWA_22

374812 : 376660

Salmonella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526983.1\|374812_376660_-	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	5.8e-20	23.7

DBSCAN-SWA_23

381663 : 385592

Shigella_phage(50.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640093.1\|381663_382539_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.8e-20	28.9
WP_003645768.1\|382547_383255_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003645769.1\|383410_383755_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003645770.1\|383974_384658_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641165.1\|385223_385592_+	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7

DBSCAN-SWA_24

392062 : 395703

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526887.1\|392062_392992_-\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_015640088.1\|394137_395703_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.5e-16	29.8

DBSCAN-SWA_25

406955 : 410295

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644029.1\|406955_407393_-	NUDIX domain-containing protein	A0A1V0SJK7	Klosneuvirus	3.6e-05	40.6
WP_003641141.1\|407481_408777_+	GTPase HflX	NA	NA	NA	NA
WP_003641140.1\|408888_409449_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011101192.1\|409533_410295_+	sulfite exporter TauE/SafE family protein	Q6EVM7	Oenoccocus_phage	1.7e-42	39.6

DBSCAN-SWA_26

421524 : 424275

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641125.1\|421524_422265_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-35	40.5
WP_015379917.1\|422584_422740_-	hypothetical protein	NA	NA	NA	NA
WP_003641122.1\|422797_423049_+	hypothetical protein	NA	NA	NA	NA
WP_013355278.1\|423282_424275_-	D-2-hydroxyacid dehydrogenase	M1HI29	Paramecium_bursaria_Chlorella_virus	3.8e-42	34.3

DBSCAN-SWA_27

430176 : 433263

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645788.1\|430176_430758_-	guanylate kinase	A0A218KC48	Bacillus_phage	8.5e-10	27.3
WP_003641114.1\|430908_431058_+	hypothetical protein	NA	NA	NA	NA
WP_003644009.1\|431134_431554_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003645789.1\|431607_432426_-	pyridoxal kinase	NA	NA	NA	NA
WP_003641111.1\|432789_433263_-	alcohol dehydrogenase	A0A218KDM1	Bacillus_phage	2.4e-10	51.7

DBSCAN-SWA_28

438881 : 440864

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645793.1\|438881_440864_-	acetyltransferase	W6MVL2	Pseudomonas_phage	3.3e-29	29.1

DBSCAN-SWA_29

449197 : 452612

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526966.1\|449197_450505_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.3e-45	30.5
WP_003641099.1\|450784_450946_+	hypothetical protein	NA	NA	NA	NA
WP_003644000.1\|451160_451634_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_003645798.1\|451802_452612_+	LicD family protein	A0A1V0SD50	Indivirus	7.2e-07	32.4

DBSCAN-SWA_30

472734 : 474552

Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641075.1\|472734_474552_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	Q76DQ7	Chlorella_virus	1.4e-90	36.5

DBSCAN-SWA_31

484317 : 491270

Cafeteria_roenbergensis_virus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016526962.1\|484317_485082_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	2.3e-55	45.8
WP_003645814.1\|485144_485681_+	exonuclease	A0A2I6PEZ7	Staphylococcus_phage	5.2e-22	32.5
WP_003641062.1\|485904_486420_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643982.1\|486425_486887_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_003641060.1\|486996_487974_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003643980.1\|487997_488690_-	uracil-DNA glycosylase	A0A1R3T3N6	Sphenicid_alphaherpesvirus	4.5e-42	40.6
WP_003641058.1\|488805_489675_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_003641057.1\|489698_490262_+	hypothetical protein	NA	NA	NA	NA
WP_003641056.1\|490535_491270_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-32	39.7

DBSCAN-SWA_32

501051 : 503962

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641053.1\|501051_501522_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	8.6e-45	61.0
WP_003645816.1\|501547_503962_-	ribonuclease R	Q0GXV6	Lactococcus_phage	7.2e-87	39.6

DBSCAN-SWA_33

507697 : 509026

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643976.1\|507697_509026_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	7.3e-174	71.1

DBSCAN-SWA_34

515863 : 522702

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641041.1\|515863_516454_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.0e-55	56.0
WP_016526957.1\|516612_517587_+	2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	7.6e-19	28.6
WP_049816390.1\|517797_519420_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003641038.1\|519874_520807_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.7e-49	36.8
WP_003645822.1\|520819_521821_-	YvcK family protein	A1IMD5	Streptococcus_phage	3.2e-97	55.0
WP_003641036.1\|521817_522702_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.2e-08	30.5

DBSCAN-SWA_35

527150 : 534142

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643969.1\|527150_530006_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.4e-299	54.4
WP_003641029.1\|530040_532044_-	excinuclease ABC subunit UvrB	NA	NA	NA	NA
WP_003646087.1\|532192_532840_-	HD domain-containing protein	NA	NA	NA	NA
WP_003641027.1\|532945_534142_-	tetracycline resistance MFS efflux pump	A0A2H4UVM2	Bodo_saltans_virus	2.6e-05	19.5

DBSCAN-SWA_36

537662 : 545432

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646085.1\|537662_539390_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	7.7e-192	56.9
WP_003646084.1\|539608_540061_+	DUF3290 domain-containing protein	NA	NA	NA	NA
WP_003641021.1\|540061_540694_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_016526953.1\|540799_541738_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.6e-85	52.3
WP_016526952.1\|541930_543343_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_003641011.1\|543733_544414_+	EAL domain-containing protein	NA	NA	NA	NA
WP_003641010.1\|544511_545432_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.5e-72	48.8

DBSCAN-SWA_37

549954 : 551531

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646079.1\|549954_550710_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-15	29.1
WP_003641002.1\|550721_551531_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-11	28.3

DBSCAN-SWA_38

554579 : 556698

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643953.1\|554579_555983_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	2.1e-25	34.1
WP_003646076.1\|555975_556698_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-35	34.9

DBSCAN-SWA_39

563368 : 566528

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803067.1\|563368_564721_-	DEAD/DEAH box helicase family protein	A0A1X9I5S6	Streptococcus_phage	4.2e-68	40.4
WP_003640991.1\|564787_565435_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.5e-36	40.4
WP_003643949.1\|565625_566528_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	9.2e-11	28.7

DBSCAN-SWA_40

570250 : 577869

uncultured_virus(50.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640986.1\|570250_571876_-	chaperonin GroEL	A0A240F766	uncultured_virus	2.4e-155	54.3
WP_003640985.1\|571931_572216_-	co-chaperone GroES	A0A221S3C8	uncultured_virus	3.5e-09	40.2
WP_003640984.1\|572408_573053_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003640983.1\|573217_573895_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_003646070.1\|574063_576046_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	2.6e-50	28.8
WP_003640980.1\|576822_577869_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.5e-62	41.7

DBSCAN-SWA_41

580978 : 581749

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644904.1\|580978_581749_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8

DBSCAN-SWA_42

585470 : 600189

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643943.1\|585470_586466_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	5.9e-51	38.2
WP_003640969.1\|586604_587390_-	acyl-ACP thioesterase	NA	NA	NA	NA
WP_003643942.1\|587393_588290_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
WP_003640967.1\|588388_588736_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
WP_003640966.1\|588760_589780_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
WP_003640965.1\|589796_590126_-	hypothetical protein	NA	NA	NA	NA
WP_003644908.1\|590122_590788_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
WP_003640957.1\|591185_591437_-	YaaL family protein	NA	NA	NA	NA
WP_003637790.1\|591451_592051_-	recombination protein RecR	NA	NA	NA	NA
WP_003640956.1\|592066_592375_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_003644909.1\|592396_594094_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
WP_043992975.1\|594619_595099_-	nucleoside deaminase	NA	NA	NA	NA
WP_003640953.1\|595128_595737_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_003640952.1\|595959_596190_+	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
WP_003643938.1\|596328_598494_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.7e-269	63.5
WP_003640950.1\|598521_599532_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
WP_003640949.1\|599613_600189_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.4e-26	41.7

DBSCAN-SWA_43

612544 : 613957

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644975.1\|612544_613957_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.1e-45	30.0

DBSCAN-SWA_44

619656 : 622727

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640928.1\|619656_620193_-	dUTP diphosphatase	J9PV85	Bacillus_phage	2.4e-35	45.8
WP_003640927.1\|620331_620628_+	N-acetyltransferase	NA	NA	NA	NA
WP_003640926.1\|620636_621320_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_003643927.1\|621395_622727_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3

DBSCAN-SWA_45

647878 : 653294

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803069.1\|647878_650533_-	cation-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	8.8e-70	28.9
WP_003640900.1\|650988_651816_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.5e-72	54.0
WP_003640899.1\|651815_653294_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-106	44.1

DBSCAN-SWA_46

656297 : 658271

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640895.1\|656297_657089_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.5e-30	36.1
WP_003640894.1\|657449_658271_+	nicotinamide mononucleotide transporter	A0A2K9VCL6	Lactobacillus_phage	3.3e-52	42.2

DBSCAN-SWA_47

663584 : 665057

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643855.1\|663584_665057_-	peptide MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.1e-68	34.3

DBSCAN-SWA_48

671606 : 679478

Tupanvirus(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033099065.1\|671606_673085_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	9.5e-90	37.5
WP_003642089.1\|673209_674217_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_003642088.1\|674216_675104_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_003643854.1\|675252_677490_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	6.0e-104	47.8
WP_003642086.1\|677569_678112_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.5e-08	26.0
WP_003642085.1\|678131_679478_-\|tRNA	tRNA lysidine(34) synthetase TilS	A0A0N7G7K4	Chrysochromulina_ericina_virus	2.6e-09	23.8

DBSCAN-SWA_49

691107 : 693907

Pneumococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642074.1\|691107_691614_-	QueT transporter family protein	E7DN70	Pneumococcus_phage	2.9e-06	32.1
WP_003646530.1\|691722_692745_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_003646529.1\|692737_693907_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	2.9e-17	26.6

DBSCAN-SWA_50

701467 : 712208

Bacillus_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646524.1\|701467_702238_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-30	34.9
WP_003646522.1\|702253_703267_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_003642064.1\|703287_704340_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003646520.1\|705035_707015_-	potassium uptake protein	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	1.8e-67	35.1
WP_003637688.1\|707306_707699_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A291I9M9	Lactobacillus_phage	5.7e-10	36.0
WP_003646519.1\|708107_709235_-	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.2e-29	28.6
WP_003642061.1\|709234_709597_-	holo-ACP synthase	NA	NA	NA	NA
WP_003642058.1\|710621_712208_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-73	40.4

DBSCAN-SWA_51

727416 : 782938

uncultured_Mediterranean_phage(20.0%)

tRNA,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646511.1\|727416_728688_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
WP_003642042.1\|729155_730769_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
WP_003642041.1\|730941_731550_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
WP_003642040.1\|731594_732035_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_015639962.1\|732397_733330_+	lipoate--protein ligase family protein	NA	NA	NA	NA
WP_003643832.1\|733344_734697_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
WP_003646508.1\|734716_735526_+	sugar-phosphatase	NA	NA	NA	NA
WP_003643831.1\|735695_736682_-	lipoprotein	NA	NA	NA	NA
WP_003646506.1\|736764_737787_-	YdcF family protein	NA	NA	NA	NA
WP_003643830.1\|738076_739057_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
WP_003646504.1\|740482_741865_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
WP_003642030.1\|741933_742770_-	pur operon repressor	NA	NA	NA	NA
WP_003642029.1\|743262_743526_-	hypothetical protein	NA	NA	NA	NA
WP_003646503.1\|743540_744083_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_003646500.1\|745163_745961_-	metal ABC transporter permease	NA	NA	NA	NA
WP_003642023.1\|745953_746652_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
WP_003642022.1\|746918_747863_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_003643828.1\|748172_749039_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_003642020.1\|749171_749423_-	Veg protein	NA	NA	NA	NA
WP_003646498.1\|749527_750418_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_011101014.1\|750414_750978_-	ribonuclease M5	NA	NA	NA	NA
WP_003643825.1\|750964_751741_-	TatD family hydrolase	NA	NA	NA	NA
WP_003646496.1\|751992_752481_-	hypothetical protein	NA	NA	NA	NA
WP_003646495.1\|753043_753778_+	transcriptional regulator	NA	NA	NA	NA
WP_016511603.1\|753966_755151_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_003646493.1\|755383_757435_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
WP_003643822.1\|757752_758181_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_003642012.1\|758738_759581_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_003646490.1\|759580_760285_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_071542784.1\|760306_761266_-	IpaB/EvcA family protein	NA	NA	NA	NA
WP_003642009.1\|761258_762533_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
WP_003642008.1\|762578_763496_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
WP_003646487.1\|763937_764951_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
WP_003646486.1\|765181_765547_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	1.8e-21	44.1
WP_003646485.1\|765533_765752_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_003646484.1\|765885_766308_-	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_003641999.1\|766297_766486_-	hypothetical protein	NA	NA	NA	NA
WP_003641998.1\|766492_767854_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003641997.1\|767926_768637_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003646482.1\|769044_770061_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_003646481.1\|770500_771277_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_167803071.1\|771535_773845_+	ATP-binding domain-containing protein	NA	NA	NA	NA
WP_003646479.1\|774134_774428_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
WP_101494318.1\|774459_774732_-	hypothetical protein	NA	NA	NA	NA
WP_003646477.1\|774847_775534_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646476.1\|775627_776308_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_167803072.1\|776394_777063_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646474.1\|777130_777820_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003646473.1\|777909_779286_-	HlyD family secretion protein	NA	NA	NA	NA
WP_071542788.1\|779301_781452_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.8e-44	27.7
WP_003646471.1\|781718_781883_+	hypothetical protein	NA	NA	NA	NA
WP_003643811.1\|781907_782066_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
WP_003646470.1\|782164_782938_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_52

793611 : 794331

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021731937.1\|793611_794331_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9

DBSCAN-SWA_53

799584 : 800556

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641941.1\|799584_800556_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7

DBSCAN-SWA_54

815147 : 816464

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643760.1\|815147_816464_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.1e-33	29.6

DBSCAN-SWA_55

819655 : 820747

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641921.1\|819655_820747_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7

DBSCAN-SWA_56

840570 : 842513

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646423.1\|840570_841668_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	5.9e-36	41.1
WP_003646422.1\|841679_842513_+	ABC transporter permease	Q6GZ02	Mycoplasma_phage	5.0e-11	22.5

DBSCAN-SWA_57

851951 : 859349

Bacillus_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646416.1\|851951_852668_+	hypothetical protein	A0A1I9S5V4	Bacillus_phage	1.9e-19	37.1
WP_015639906.1\|852664_853582_+	sce7725 family protein	NA	NA	NA	NA
WP_003641878.1\|853588_853966_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_003646413.1\|854370_855009_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	1.0e-16	62.0
WP_003641876.1\|856059_856863_+	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	4.6e-14	50.4
WP_003646412.1\|856984_857704_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_011100955.1\|857799_858561_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003641873.1\|858689_859349_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	6.5e-14	30.4

DBSCAN-SWA_58

877241 : 879309

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015639898.1\|877241_877946_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-31	32.6
WP_003646400.1\|877932_879309_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.6e-25	30.8

DBSCAN-SWA_59

891623 : 892028

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646390.1\|891623_892028_-	glycerol-3-phosphate cytidylyltransferase	E3SJ88	Synechococcus_phage	1.1e-16	42.1

DBSCAN-SWA_60

900887 : 911395

Lactobacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641839.1\|900887_901676_-	nicotinamide mononucleotide transporter	A0A2H4PB74	Lactobacillus_phage	4.3e-97	75.4
WP_003641837.1\|902037_902829_+	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003646386.1\|903441_904353_+	cysteine synthase family protein	A0A1X9I5K7	Streptococcus_phage	1.1e-56	41.3
WP_167803076.1\|904364_905510_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_003646384.1\|905514_906057_+	serine acetyltransferase	NA	NA	NA	NA
WP_003643701.1\|906196_906745_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	2.1e-10	29.3
WP_003646383.1\|907044_908391_-	DUF2252 domain-containing protein	NA	NA	NA	NA
WP_003641831.1\|908625_909090_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	3.8e-21	41.9
WP_003646381.1\|909331_909733_+	hypothetical protein	NA	NA	NA	NA
WP_016526878.1\|909797_910352_-	hypothetical protein	NA	NA	NA	NA
WP_003646379.1\|910641_910968_+	hypothetical protein	NA	NA	NA	NA
WP_167803077.1\|911062_911395_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	2.9e-15	36.8

DBSCAN-SWA_61

924694 : 932314

Clostridioides_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641816.1\|924694_924898_+	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	9.8e-06	39.7
WP_003641815.1\|924910_925324_+	hypothetical protein	NA	NA	NA	NA
WP_003646373.1\|925409_925880_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_003646372.1\|926471_927302_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.0e-53	41.2
WP_003646371.1\|927352_927838_-	glutathione peroxidase	NA	NA	NA	NA
WP_015639877.1\|928178_928748_+	ECF transporter S component	NA	NA	NA	NA
WP_016526875.1\|928777_930184_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.9e-15	30.0
WP_003646368.1\|930180_930840_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_016526887.1\|931384_932314_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9

DBSCAN-SWA_62

940566 : 943274

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641796.1\|940566_941640_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	6.4e-96	50.3
WP_003641795.1\|941655_942834_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	8.1e-84	41.1
WP_003646363.1\|942830_943274_+	GNAT family N-acetyltransferase	A0A1X9I6I8	Streptococcus_phage	7.6e-19	37.9

DBSCAN-SWA_63

974026 : 975133

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641775.1\|974026_975133_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.6e-27	33.2

DBSCAN-SWA_64

994363 : 996998

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646339.1\|994363_995281_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-21	29.2
WP_003646338.1\|995543_996338_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.0e-09	30.3
WP_003641754.1\|996506_996998_-	hypothetical protein	A8ATW6	Listeria_phage	1.9e-18	36.1

DBSCAN-SWA_65

1001343 : 1003044

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646334.1\|1001343_1003044_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-18	34.4

DBSCAN-SWA_66

1011523 : 1012372

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646328.1\|1011523_1012372_-	aldo/keto reductase	A0A1V0SKP9	Klosneuvirus	1.3e-27	30.1

DBSCAN-SWA_67

1016618 : 1022460

Wolbachia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641733.1\|1016618_1017041_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	2.4e-06	33.3
WP_003646321.1\|1017186_1017660_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003646320.1\|1017773_1018376_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_003641730.1\|1018441_1018636_+	PspC domain-containing protein	NA	NA	NA	NA
WP_003646319.1\|1018678_1019437_-	nucleoside phosphorylase	F5CA76	Streptococcus_phi-m46.1-like_phage	2.0e-35	46.8
WP_016526851.1\|1019721_1022460_+	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.4e-62	29.4

DBSCAN-SWA_68

1025897 : 1026368

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646315.1\|1025897_1026368_+	NUDIX hydrolase	D0R7J3	Paenibacillus_phage	4.9e-16	33.8

DBSCAN-SWA_69

1035012 : 1037766

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643656.1\|1035012_1035729_-	aquaporin family protein	M1H4F4	Acanthocystis_turfacea_Chlorella_virus	4.1e-22	33.6
WP_071540923.1\|1035733_1036225_-	DUF111 family protein	NA	NA	NA	NA
WP_003646305.1\|1036203_1036995_-	LarC family nickel insertion protein	NA	NA	NA	NA
WP_003646304.1\|1037025_1037766_-	nickel pincer cofactor biosynthesis protein LarB	A0A288TYA6	Enterococcus_phage	4.7e-21	47.2

DBSCAN-SWA_70

1041758 : 1042490

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646303.1\|1041758_1042490_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-11	26.9

DBSCAN-SWA_71

1052775 : 1058498

Megavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641694.1\|1052775_1053780_+	NADP-dependent oxidoreductase	K7Z7U2	Megavirus	7.6e-06	31.1
WP_016526841.1\|1053817_1054186_+	glutamine amidotransferase	NA	NA	NA	NA
WP_003641692.1\|1054216_1054708_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003643649.1\|1054895_1055780_-	DMT family transporter	NA	NA	NA	NA
WP_003646155.1\|1055785_1056157_-	hypothetical protein	NA	NA	NA	NA
WP_003641689.1\|1056186_1056462_-	hypothetical protein	NA	NA	NA	NA
WP_003646156.1\|1056479_1058498_-	TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein	D0R0F5	Streptococcus_phage	1.8e-70	30.7

DBSCAN-SWA_72

1065896 : 1066913

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803081.1\|1065896_1066913_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	2.9e-29	35.5

DBSCAN-SWA_73

1072430 : 1072856

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641672.1\|1072430_1072856_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.1e-29	51.6

DBSCAN-SWA_74

1076563 : 1078933

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646167.1\|1076563_1078933_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	3.3e-52	24.3

DBSCAN-SWA_75

1086634 : 1095039

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641660.1\|1086634_1087897_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	2.3e-15	28.8
WP_003641659.1\|1088007_1088823_-	MBL fold metallo-hydrolase	A0A0D3MKU5	Leuconostoc_phage	2.8e-11	28.0
WP_003646175.1\|1089181_1090036_-	hypothetical protein	NA	NA	NA	NA
WP_003646176.1\|1090047_1091373_-	hypothetical protein	NA	NA	NA	NA
WP_152707130.1\|1091353_1093225_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.5e-34	31.8
WP_003637294.1\|1093241_1093949_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-44	40.1
WP_003641655.1\|1094522_1094747_-	hypothetical protein	NA	NA	NA	NA
WP_003643615.1\|1094838_1095039_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.8e-21	74.6

DBSCAN-SWA_76

1103929 : 1106326

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643612.1\|1103929_1106326_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.6e-09	42.9

DBSCAN-SWA_77

1114388 : 1131493

Streptococcus_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012778280.1\|1114388_1115627_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	6.3e-111	52.9
WP_003643611.1\|1115645_1116443_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-45	39.2
WP_003641639.1\|1116464_1117688_-	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	2.4e-54	33.6
WP_003641638.1\|1117909_1119334_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	9.7e-124	53.1
WP_003641637.1\|1119349_1119802_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_003643610.1\|1119814_1121827_-	DHH family phosphoesterase	NA	NA	NA	NA
WP_003641635.1\|1122007_1122244_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_003646183.1\|1122282_1122864_-	single-stranded DNA-binding protein	A0A218MNB4	uncultured_virus	2.7e-40	72.1
WP_003637271.1\|1122900_1123200_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_003641633.1\|1123821_1126383_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	2.8e-113	37.4
WP_003641632.1\|1126527_1128474_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	5.5e-146	46.7
WP_003641631.1\|1128470_1129595_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003641630.1\|1129595_1129829_-	S4 domain-containing protein YaaA	NA	NA	NA	NA
WP_016526819.1\|1130353_1131493_-	DNA polymerase III subunit beta	D0R7I4	Paenibacillus_phage	4.3e-13	29.9

DBSCAN-SWA_78

1148871 : 1150623

Phaeocystis_globosa_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641614.1\|1148871_1150188_+	C1 family peptidase	R4TV59	Phaeocystis_globosa_virus	5.9e-59	32.5
WP_016511073.1\|1150200_1150623_+	helix-turn-helix domain-containing protein	Q9G039	Staphylococcus_virus	1.2e-10	53.1

DBSCAN-SWA_79

1169073 : 1169877

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803083.1\|1169073_1169877_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.7e-08	28.1

DBSCAN-SWA_80

1181289 : 1183404

Cronobacter_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642931.1\|1181289_1183404_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	3.1e-118	38.7

DBSCAN-SWA_81

1198678 : 1200187

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646211.1\|1198678_1200187_+	sodium:solute symporter	A0A219Y9P9	Aeromonas_phage	1.5e-18	25.3

DBSCAN-SWA_82

1215709 : 1216363

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646201.1\|1215709_1216363_+	fructose-6-phosphate aldolase	R9TM64	Synechococcus_phage	3.3e-50	49.3

DBSCAN-SWA_83

1219485 : 1220460

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015379561.1\|1219485_1220460_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	5.8e-27	33.5

DBSCAN-SWA_84

1234409 : 1235858

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527398.1\|1234409_1235858_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	7.8e-36	26.5

DBSCAN-SWA_85

1251828 : 1255861

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645690.1\|1251828_1252587_+	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	4.4e-22	31.4
WP_003643071.1\|1252620_1253577_+	FAD:protein FMN transferase	NA	NA	NA	NA
WP_015641109.1\|1253569_1255861_+	FAD-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.7e-42	51.7

DBSCAN-SWA_86

1265619 : 1270016

Herpes_simplex_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803087.1\|1265619_1267500_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	6.4e-99	35.4
WP_015641105.1\|1267783_1268947_+	galactokinase	NA	NA	NA	NA
WP_003646237.1\|1269011_1270016_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.3e-50	37.3

DBSCAN-SWA_87

1283379 : 1285978

Micromonas_pusilla_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645622.1\|1283379_1285116_+	AarF/ABC1/UbiB kinase family protein	G8DDN0	Micromonas_pusilla_virus	1.9e-41	27.7
WP_003643044.1\|1285327_1285978_-	aquaporin	A0A1V0SCL5	Indivirus	1.9e-05	41.6

DBSCAN-SWA_88

1298914 : 1311072

Cafeteria_roenbergensis_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803088.1\|1298914_1300831_-	M13 family peptidase	E3T4I7	Cafeteria_roenbergensis_virus	6.2e-73	29.6
WP_003643545.1\|1301141_1301807_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003643544.1\|1302004_1302229_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_003645583.1\|1302241_1302796_+	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
WP_003645582.1\|1302924_1303128_+	hypothetical protein	NA	NA	NA	NA
WP_003643024.1\|1303227_1303497_-	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_003643543.1\|1303520_1303841_-	thioredoxin family protein	A0A2K9L3H4	Tupanvirus	5.2e-09	39.1
WP_003645580.1\|1304225_1304978_+	aquaporin family protein	M1HQW3	Paramecium_bursaria_Chlorella_virus	4.5e-27	31.4
WP_016527387.1\|1305131_1307036_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	7.4e-95	34.4
WP_003645521.1\|1307372_1308344_+	SGNH/GDSL hydrolase family protein	A0A2H4PRU1	Lactococcus_phage	1.7e-34	31.4
WP_015379514.1\|1308441_1309137_-	YdcF family protein	NA	NA	NA	NA
WP_003645523.1\|1309137_1309851_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_003645524.1\|1310118_1311072_-	Dyp-type peroxidase	S4VXK8	Pandoravirus	1.5e-19	29.1

DBSCAN-SWA_89

1329691 : 1330210

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645538.1\|1329691_1330210_+	RNase III inhibitor	A0A0K1L687	Scale_drop_disease_virus	5.4e-32	58.0

DBSCAN-SWA_90

1333518 : 1334379

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003643521.1\|1333518_1334379_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.9e-58	42.3

DBSCAN-SWA_91

1337567 : 1340180

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527376.1\|1337567_1340180_+	cation-translocating P-type ATPase	A0A1J0FA34	Only_Syngen_Nebraska_virus	1.7e-73	30.0

DBSCAN-SWA_92

1351076 : 1354199

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645551.1\|1351076_1353116_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.3e-56	27.1
WP_003643511.1\|1353212_1354199_+	choloylglycine hydrolase family protein	M1HS66	Paramecium_bursaria_Chlorella_virus	2.8e-29	33.2

DBSCAN-SWA_93

1365833 : 1366334

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645558.1\|1365833_1366334_-	hypothetical protein	A0A291I9Q0	Lactobacillus_phage	1.3e-43	58.0

DBSCAN-SWA_94

1377617 : 1381899

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645564.1\|1377617_1379462_-	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-64	28.8
WP_003642847.1\|1380231_1381899_+	glycine/betaine ABC transporter	A0A2I7QNT1	Vibrio_phage	1.5e-06	21.1

DBSCAN-SWA_95

1385293 : 1390924

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511736.1\|1385293_1386214_-	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	4.6e-10	28.4
WP_003645568.1\|1387273_1387585_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
WP_003642837.1\|1387807_1388629_-	pyruvate formate lyase-activating protein	NA	NA	NA	NA
WP_003642836.1\|1388665_1390924_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	5.2e-164	41.3

DBSCAN-SWA_96

1403910 : 1404480

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642515.1\|1403910_1404480_+	GTP cyclohydrolase I FolE	A0A088F7Y4	Vibrio_phage	2.4e-33	42.9

DBSCAN-SWA_97

1412272 : 1418287

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645471.1\|1412272_1413391_-	vitamin B12 independent methionine synthase	A0A218MNE0	uncultured_virus	4.1e-69	43.5
WP_003645472.1\|1413852_1414899_+	AI-2E family transporter	NA	NA	NA	NA
WP_003642499.1\|1415227_1416172_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_167803092.1\|1416244_1418287_-	KUP/HAK/KT family potassium transporter	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	6.8e-62	33.7

DBSCAN-SWA_98

1424432 : 1431686

Staphylococcus_virus(20.0%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645478.1\|1424432_1425404_-	GMP reductase	Q4ZCY7	Staphylococcus_virus	1.8e-137	71.2
WP_003643473.1\|1425452_1426742_-	adenylosuccinate synthase	L7Y4J5	Megavirus	3.5e-72	37.0
WP_016527358.1\|1427058_1428357_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.9e-18	34.2
WP_003642489.1\|1428579_1428909_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_003645481.1\|1429103_1430438_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-26	26.9
WP_016527357.1\|1430573_1431686_+	glycerate kinase	W6LM47	Streptococcus_phage	1.5e-34	35.0

DBSCAN-SWA_99

1462047 : 1464291

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642454.1\|1462047_1463493_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	4.9e-83	37.7
WP_003643459.1\|1463640_1464291_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.2e-22	31.5

DBSCAN-SWA_100

1473419 : 1479397

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645325.1\|1473419_1473995_+	zinc ribbon domain-containing protein	D6PSS6	Lactobacillus_phage	2.1e-21	31.1
WP_167803098.1\|1474163_1474979_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_003642441.1\|1475450_1476212_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-27	36.0
WP_024521920.1\|1476223_1476922_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003642439.1\|1476999_1477803_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_016527348.1\|1478170_1479397_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	4.6e-21	31.1

DBSCAN-SWA_101

1488322 : 1499779

Bacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645330.1\|1488322_1489174_+	nucleoid occlusion protein	A0A1C9EHY8	Gordonia_phage	1.0e-11	30.1
WP_003642431.1\|1489176_1489944_+	ParA family protein	Q8JL10	Natrialba_phage	3.7e-29	32.3
WP_003645331.1\|1489933_1490824_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.5e-16	32.2
WP_003639829.1\|1490848_1491040_+	DUF951 domain-containing protein	NA	NA	NA	NA
WP_003642429.1\|1491070_1492171_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_003642428.1\|1492192_1492918_+	DUF1129 domain-containing protein	NA	NA	NA	NA
WP_003645332.1\|1493203_1494355_+	guanosine monophosphate reductase	A0A1V0SHK8	Klosneuvirus	1.4e-51	39.2
WP_003645333.1\|1494623_1495553_+	foldase	NA	NA	NA	NA
WP_003642425.1\|1495728_1496418_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_003642424.1\|1496508_1497198_+	response regulator transcription factor	W8CYM9	Bacillus_phage	4.8e-36	35.8
WP_003642423.1\|1497214_1498375_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.2e-28	30.8
WP_003645334.1\|1498444_1499779_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.4e-09	25.9

DBSCAN-SWA_102

1504372 : 1505298

Brochothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642413.1\|1504372_1504927_-	DUF4352 domain-containing protein	D7RWL3	Brochothrix_phage	1.5e-11	26.8
WP_003642412.1\|1504935_1505298_-	DUF4064 domain-containing protein	D7RWL4	Brochothrix_phage	4.5e-09	45.1

DBSCAN-SWA_103

1516739 : 1523262

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527344.1\|1516739_1517630_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-29	36.4
WP_016527343.1\|1517619_1518378_+	ABC transporter permease	NA	NA	NA	NA
WP_003645347.1\|1518393_1519158_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003645348.1\|1519185_1519551_+	helix-turn-helix transcriptional regulator	A0A0S2MVM8	Bacillus_phage	1.5e-07	51.7
WP_015380962.1\|1520026_1521115_-	Ldh family oxidoreductase	NA	NA	NA	NA
WP_003643427.1\|1521998_1522565_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003643426.1\|1522548_1523262_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.2e-16	26.9

DBSCAN-SWA_104

1526887 : 1528159

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645352.1\|1526887_1528159_-	DUF805 domain-containing protein	Q9AZW5	Lactococcus_phage	4.7e-21	41.7

DBSCAN-SWA_105

1534909 : 1535377

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003587210.1\|1534909_1535377_-	DNA starvation/stationary phase protection protein	A0A222Z0F3	Streptomyces_phage	1.6e-06	29.2

DBSCAN-SWA_106

1539659 : 1541141

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645359.1\|1539659_1541141_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	7.2e-29	27.4

DBSCAN-SWA_107

1545635 : 1547423

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803101.1\|1545635_1547423_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	1.3e-19	30.1

DBSCAN-SWA_108

1561656 : 1567106

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642355.1\|1561656_1562403_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	8.1e-05	27.2
WP_167803102.1\|1562696_1563590_+	SDR family oxidoreductase	M1HZA6	Acanthocystis_turfacea_Chlorella_virus	6.1e-07	24.7
WP_003643401.1\|1563570_1564083_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_016511874.1\|1564326_1565322_-	iron ABC transporter permease	NA	NA	NA	NA
WP_016527331.1\|1566311_1567106_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.4e-17	28.6

DBSCAN-SWA_109

1586746 : 1588648

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645377.1\|1586746_1588648_+	asparagine synthase (glutamine-hydrolyzing)	R4TIC1	Phaeocystis_globosa_virus	4.7e-33	29.6

DBSCAN-SWA_110

1592004 : 1592658

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645380.1\|1592004_1592658_+	HAD family phosphatase	A0A1D8KNV9	Synechococcus_phage	2.9e-14	29.0

DBSCAN-SWA_111

1614151 : 1620496

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645396.1\|1614151_1616077_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.6e-83	34.6
WP_016527323.1\|1616441_1617563_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	4.2e-13	27.8
WP_003644879.1\|1618632_1619805_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_167803106.1\|1620100_1620496_-	transglycosylase	A0A249XZV3	Enterococcus_phage	1.6e-15	60.0

DBSCAN-SWA_112

1624061 : 1634320

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644885.1\|1624061_1624952_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.6e-55	46.4
WP_015640952.1\|1625043_1626243_-	amidohydrolase	NA	NA	NA	NA
WP_003644887.1\|1626805_1627093_-	hypothetical protein	NA	NA	NA	NA
WP_003644888.1\|1627533_1629258_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.5e-33	27.5
WP_016511764.1\|1629250_1631032_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.6e-44	27.0
WP_003642293.1\|1631053_1632244_+	membrane protein	NA	NA	NA	NA
WP_003644890.1\|1632799_1634320_+	Y-family DNA polymerase	D0R0A3	Streptococcus_phage	6.5e-25	28.0

DBSCAN-SWA_113

1639705 : 1641423

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015640945.1\|1639705_1640383_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	1.2e-15	53.6
WP_003643361.1\|1640808_1641423_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9V574	Lactobacillus_phage	3.3e-12	61.5

DBSCAN-SWA_114

1654521 : 1656522

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380873.1\|1654521_1656522_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-33	39.2

DBSCAN-SWA_115

1668380 : 1669865

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646065.1\|1668380_1669160_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.2e-12	24.0
WP_003646064.1\|1669160_1669865_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.0e-14	26.8

DBSCAN-SWA_116

1677333 : 1678107

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033615733.1\|1677333_1678107_+	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	5.6e-09	26.1

DBSCAN-SWA_117

1684328 : 1686086

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646051.1\|1684328_1686086_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.0e-107	41.6

DBSCAN-SWA_118

1713859 : 1720107

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644790.1\|1713859_1714270_-	peptide deformylase	A0A067XQZ3	Caulobacter_phage	1.5e-13	43.8
WP_003644789.1\|1714412_1714886_-	lipoprotein	NA	NA	NA	NA
WP_016527304.1\|1715334_1717557_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	8.0e-250	58.7
WP_015640911.1\|1717489_1718071_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	3.9e-55	59.7
WP_071542569.1\|1718976_1720107_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.3e-18	34.0

DBSCAN-SWA_119

1726969 : 1728265

Shearwaterpox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644865.1\|1726969_1728265_+	alkaline phosphatase family protein	A0A1V0QG10	Shearwaterpox_virus	1.0e-07	21.3

DBSCAN-SWA_120

1732435 : 1734943

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644861.1\|1732435_1734943_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.9e-135	32.3

DBSCAN-SWA_121

1738113 : 1739736

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644858.1\|1738113_1739736_+	ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	8.4e-47	26.9

DBSCAN-SWA_122

1753348 : 1756887

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511510.1\|1753348_1755100_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.5e-54	30.4
WP_003644847.1\|1755099_1756887_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.5e-44	25.0

DBSCAN-SWA_123

1775893 : 1776595

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644830.1\|1775893_1776595_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-32	35.7

DBSCAN-SWA_124

1784178 : 1788928

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644823.1\|1784178_1785078_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.0e-17	26.9
WP_033615654.1\|1785390_1785591_+	hypothetical protein	NA	NA	NA	NA
WP_003644821.1\|1785794_1786295_-	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_003644820.1\|1786476_1787535_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	1.3e-19	71.2
WP_015640870.1\|1787986_1788928_-	LysM peptidoglycan-binding domain-containing protein	K4ID66	Lactobacillus_phage	9.6e-11	50.6

DBSCAN-SWA_125

1807984 : 1808665

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644807.1\|1807984_1808665_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-31	37.7

DBSCAN-SWA_126

1817180 : 1820925

Lactobacillus_virus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527281.1\|1817180_1818479_+	glycosyl hydrolase	Q5ULM6	Lactobacillus_virus	5.0e-34	42.1
WP_003644804.1\|1818578_1819244_+	hypothetical protein	NA	NA	NA	NA
WP_003642093.1\|1819668_1820925_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	3.5e-85	43.1

DBSCAN-SWA_127

1828522 : 1829386

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645825.1\|1828522_1829386_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	8.7e-51	39.8

DBSCAN-SWA_128

1850009 : 1850684

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645837.1\|1850009_1850684_-	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	4.2e-08	27.0

DBSCAN-SWA_129

1858632 : 1862815

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642546.1\|1858632_1859376_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-27	33.5
WP_016511800.1\|1859353_1860604_+	ABC transporter permease	NA	NA	NA	NA
WP_003645842.1\|1860608_1861280_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003645843.1\|1861381_1862815_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	9.5e-95	43.8

DBSCAN-SWA_130

1866274 : 1867626

Listeria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642553.1\|1866274_1866496_+	DUF2829 domain-containing protein	A8AT88	Listeria_phage	6.7e-08	35.2
WP_003642554.1\|1866495_1867242_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
WP_003642555.1\|1867257_1867626_+	HIT family protein	D7NW73	Streptomyces_phage	6.8e-13	40.6

DBSCAN-SWA_131

1881337 : 1885480

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642573.1\|1881337_1882216_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.1e-16	30.3
WP_003642574.1\|1882212_1882584_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_003645857.1\|1882611_1882887_-	hypothetical protein	NA	NA	NA	NA
WP_003645858.1\|1882909_1884691_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_003642577.1\|1884721_1885480_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.6e-32	36.6

DBSCAN-SWA_132

1890942 : 1903476

Lactobacillus_phage(22.22%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642583.1\|1890942_1891551_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	7.9e-59	54.5
WP_003644728.1\|1891565_1892861_+	NADPH-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.5e-56	59.8
WP_003642585.1\|1893428_1893914_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
WP_015380738.1\|1893897_1895028_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003642587.1\|1895030_1895762_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
WP_003642588.1\|1895763_1896018_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_016511634.1\|1896020_1896698_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003645864.1\|1896690_1898910_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	4.5e-144	39.3
WP_016527273.1\|1898894_1900349_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
WP_003645866.1\|1900345_1901371_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-59	41.0
WP_003645867.1\|1901363_1901942_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
WP_003645868.1\|1901943_1903476_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	E3SNU8	Prochlorococcus_phage	6.7e-46	52.9

DBSCAN-SWA_133

1909765 : 1912758

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645873.1\|1909765_1911049_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.1e-45	30.7
WP_003645874.1\|1911417_1912758_-	purine permease	Q9KX94	Enterobacteria_phage	1.4e-34	28.6

DBSCAN-SWA_134

1916247 : 1919570

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645876.1\|1916247_1917183_+	aspartate carbamoyltransferase catalytic subunit	M1HGA5	Paramecium_bursaria_Chlorella_virus	2.9e-28	33.0
WP_003645877.1\|1917186_1918479_+	dihydroorotase	NA	NA	NA	NA
WP_003645878.1\|1918475_1919570_+	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	2.8e-54	35.2

DBSCAN-SWA_135

1930160 : 1933910

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645886.1\|1930160_1933910_+	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	1.3e-13	22.6

DBSCAN-SWA_136

1941481 : 1946741

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644713.1\|1941481_1942966_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	1.4e-77	37.5
WP_003642623.1\|1943083_1943431_-	SdpI family protein	NA	NA	NA	NA
WP_003645894.1\|1943838_1944783_-	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_003645895.1\|1944868_1945246_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_003645896.1\|1945577_1946741_+	MFS transporter	A0A2H4PQR6	Staphylococcus_phage	1.1e-56	33.7

DBSCAN-SWA_137

1954025 : 1954682

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642635.1\|1954025_1954682_+	HD domain-containing protein	S4W232	Pandoravirus	1.3e-11	31.2

DBSCAN-SWA_138

1964984 : 1967342

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825798.1\|1964984_1967342_+	cell wall hydrolase	A0A249Y0X5	Enterococcus_phage	2.2e-40	51.9

DBSCAN-SWA_139

1985393 : 1987482

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642672.1\|1985393_1986104_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.7e-10	27.3
WP_003642673.1\|1986093_1986867_+	ABC transporter permease	NA	NA	NA	NA
WP_003642674.1\|1986927_1987482_-	cysteine hydrolase	G3MA16	Bacillus_virus	4.1e-30	40.5

DBSCAN-SWA_140

1997320 : 1998205

Lactobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646571.1\|1997320_1998205_-	ribonuclease H	C1KFJ1	Lactobacillus_virus	2.4e-32	36.9

DBSCAN-SWA_141

2006075 : 2010405

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_063493488.1\|2006075_2007869_-	hypothetical protein	M1HTS7	Paramecium_bursaria_Chlorella_virus	4.2e-07	25.5
WP_003646579.1\|2008251_2010405_-	LTA synthase family protein	W6LM83	Streptococcus_phage	2.7e-170	49.1

DBSCAN-SWA_142

2020742 : 2021567

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642705.1\|2020742_2021567_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	1.1e-05	25.8

DBSCAN-SWA_143

2032933 : 2035693

Pacmanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646593.1\|2032933_2034004_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	1.4e-18	24.0
WP_003642721.1\|2034189_2034744_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_003646594.1\|2034919_2035693_+	TerC family protein	A0A068EP98	Bacillus_phage	6.0e-43	43.5

DBSCAN-SWA_144

2039366 : 2040149

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642726.1\|2039366_2040149_-	ATP-binding cassette domain-containing protein	A0A1V0SE00	Indivirus	4.1e-07	27.2

DBSCAN-SWA_145

2044339 : 2045626

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003642732.1\|2044339_2045626_+	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A0B5JD48	Pandoravirus	2.7e-08	24.0

DBSCAN-SWA_146

2054568 : 2056122

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646605.1\|2054568_2056122_+	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	1.2e-39	27.0

DBSCAN-SWA_147

2068804 : 2072530

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646617.1\|2068804_2069533_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-34	37.1
WP_016527243.1\|2069529_2071053_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_003642757.1\|2071348_2072530_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.0e-46	30.1

DBSCAN-SWA_148

2076216 : 2081541

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527241.1\|2076216_2078211_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.2e-32	41.3
WP_003642762.1\|2078228_2079806_+	glycosyltransferase	NA	NA	NA	NA
WP_003646621.1\|2079777_2081541_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.9e-95	40.5

DBSCAN-SWA_149

2090479 : 2145669

Lactobacillus_phage(58.33%)

integrase,capsid,tail,transposase,holin,head,portal,terminase

attL 2104903:2104923|attR 2149241:2149261

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803113.1\|2090479_2091637_-\|integrase	site-specific integrase	Q938N9	Temperate_phage	8.6e-54	34.8
WP_167803114.1\|2091695_2092262_-	helix-turn-helix transcriptional regulator	A0A1P8BMN9	Lactococcus_phage	5.9e-08	50.0
WP_167803115.1\|2092416_2092596_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_167803116.1\|2092873_2093092_+	hypothetical protein	NA	NA	NA	NA
WP_167803117.1\|2093088_2093889_+	DNA replication protein	NA	NA	NA	NA
WP_167803118.1\|2093888_2095283_+	virulence protein	Q4ZD27	Staphylococcus_phage	1.2e-70	36.1
WP_003645297.1\|2095426_2095846_+	hypothetical protein	NA	NA	NA	NA
WP_012778293.1\|2095870_2096053_+	sporulation protein Cse60	NA	NA	NA	NA
WP_167803119.1\|2096062_2096401_+\|head	phage head closure protein	A0A2P0ZLF0	Lactobacillus_phage	6.0e-08	35.6
WP_063846829.1\|2096393_2096783_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	7.9e-20	45.6
WP_021356979.1\|2097613_2098087_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
WP_167803120.1\|2098083_2099787_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	2.4e-121	40.9
WP_167803121.1\|2099941_2101042_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	7.2e-50	35.2
WP_167803122.1\|2101038_2102574_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	3.4e-42	25.1
WP_021356366.1\|2102983_2103253_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_045353068.1\|2103408_2103780_+	hypothetical protein	NA	NA	NA	NA
WP_003642774.1\|2104585_2104792_+	hypothetical protein	NA	NA	NA	NA
2104903:2104923	attL	NA	NA	NA	NA
WP_016527218.1\|2105142_2106264_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	7.6e-47	32.7
WP_016527217.1\|2106553_2107648_-	hypothetical protein	NA	NA	NA	NA
WP_016511204.1\|2107844_2108021_-	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	3.9e-11	53.4
WP_016527216.1\|2108623_2109334_-	hypothetical protein	NA	NA	NA	NA
WP_016527215.1\|2109470_2109725_-	hypothetical protein	NA	NA	NA	NA
WP_016527214.1\|2109734_2110526_-	hypothetical protein	NA	NA	NA	NA
WP_003644968.1\|2110548_2110962_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
WP_003644967.1\|2110973_2111342_-	helix-turn-helix transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
WP_016527213.1\|2111491_2111728_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_049816387.1\|2111720_2111915_+	hypothetical protein	NA	NA	NA	NA
WP_016527211.1\|2111926_2112232_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_016527210.1\|2112299_2112812_+	helix-turn-helix transcriptional regulator	D6PST4	Lactobacillus_phage	3.0e-27	42.9
WP_167803041.1\|2112912_2113056_+	hypothetical protein	NA	NA	NA	NA
WP_167803042.1\|2113131_2113314_+	hypothetical protein	NA	NA	NA	NA
WP_016527208.1\|2113306_2113819_+	hypothetical protein	NA	NA	NA	NA
WP_016527207.1\|2113821_2114469_+	hypothetical protein	D6PSU1	Lactobacillus_phage	1.3e-64	59.5
WP_016527206.1\|2114465_2114861_+	single-stranded DNA-binding protein	D6PSU2	Lactobacillus_phage	2.5e-45	67.2
WP_063493493.1\|2114948_2115881_+	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	8.7e-57	45.8
WP_016527204.1\|2115877_2116165_+	hypothetical protein	NA	NA	NA	NA
WP_016527203.1\|2116161_2116884_+	bacteriophage antirepressor	Q8SDM9	Staphylococcus_phage	2.1e-50	45.6
WP_167803123.1\|2116888_2117407_+	hypothetical protein	O03915	Lactobacillus_phage	5.0e-54	68.0
WP_016527201.1\|2117403_2117778_+	hypothetical protein	NA	NA	NA	NA
WP_016527200.1\|2117780_2118092_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	4.3e-53	99.0
WP_003642805.1\|2118315_2118777_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.1e-39	57.0
WP_143453264.1\|2118999_2119167_+	BC1881 family protein	NA	NA	NA	NA
WP_016527197.1\|2119163_2119373_-	KTSC domain-containing protein	NA	NA	NA	NA
WP_016527196.1\|2120065_2120245_+	hypothetical protein	E9LUP6	Lactobacillus_phage	7.8e-07	52.7
WP_016527195.1\|2120213_2120486_+	hypothetical protein	A0A2D2W301	Escherichia_phage	1.8e-18	50.6
WP_016527194.1\|2120517_2120667_+	hypothetical protein	NA	NA	NA	NA
WP_016527193.1\|2120707_2121235_+\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.5e-48	64.2
WP_016527192.1\|2121218_2122505_+\|terminase	PBSX family phage terminase large subunit	A0A2H4IYR5	uncultured_Caudovirales_phage	2.8e-114	50.1
WP_041161839.1\|2122494_2124147_+\|portal	phage portal protein	D2IZF6	Enterococcus_phage	2.4e-65	32.9
WP_016527190.1\|2124149_2125094_+\|capsid	minor capsid protein	NA	NA	NA	NA
WP_016527189.1\|2125200_2125848_+	DUF4355 domain-containing protein	NA	NA	NA	NA
WP_016527188.1\|2125864_2126917_+	hypothetical protein	A0A0S0N2Q7	Pseudomonas_phage	2.6e-33	31.0
WP_016527187.1\|2126931_2127297_+\|head,tail	phage head-tail connector protein	A0A1W6JNH7	Staphylococcus_phage	2.3e-05	39.6
WP_041161865.1\|2127301_2127625_+	hypothetical protein	NA	NA	NA	NA
WP_016527185.1\|2127614_2128169_+	hypothetical protein	NA	NA	NA	NA
WP_016527184.1\|2128122_2128557_+	hypothetical protein	NA	NA	NA	NA
WP_016527183.1\|2128568_2129129_+	hypothetical protein	NA	NA	NA	NA
WP_016527182.1\|2129146_2129635_+	hypothetical protein	NA	NA	NA	NA
WP_167803124.1\|2129727_2129964_+	hypothetical protein	NA	NA	NA	NA
WP_167803125.1\|2129963_2133893_+	tape measure protein	E9LUR1	Lactobacillus_phage	9.6e-81	45.4
WP_016527179.1\|2133902_2134799_+	hypothetical protein	A8ATA8	Listeria_phage	3.2e-16	27.1
WP_016526894.1\|2135883_2137059_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_167803126.1\|2137190_2137334_+	hypothetical protein	NA	NA	NA	NA
WP_016527175.1\|2137333_2137585_+	hypothetical protein	NA	NA	NA	NA
WP_016527174.1\|2137585_2137996_+	hypothetical protein	NA	NA	NA	NA
WP_016527173.1\|2137979_2139020_+	hypothetical protein	E9LUJ9	Lactobacillus_phage	4.4e-25	33.9
WP_016527172.1\|2139034_2139856_+	collagen-like protein	NA	NA	NA	NA
WP_016527171.1\|2139869_2140802_+	hypothetical protein	NA	NA	NA	NA
WP_016526887.1\|2140843_2141773_+\|transposase	IS30-like element ISLpl1 family transposase	H7BW61	unidentified_phage	3.2e-19	29.9
WP_016527170.1\|2141828_2142407_+	hypothetical protein	NA	NA	NA	NA
WP_041161837.1\|2142419_2143625_+	collagen-like protein	A0A2K9VCK7	Lactobacillus_phage	1.5e-40	64.8
WP_016527168.1\|2143621_2143834_+	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	3.6e-19	85.2
WP_016527167.1\|2143845_2145018_+	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.1e-194	86.9
WP_016527166.1\|2145017_2145281_+	hypothetical protein	E9LUR9	Lactobacillus_phage	9.4e-33	86.2
WP_016527165.1\|2145291_2145669_+\|holin	prophage P2a protein 58, holin	A0A2K9VCG4	Lactobacillus_phage	1.3e-14	62.5
2149241:2149261	attR	NA	NA	NA	NA

DBSCAN-SWA_150

2151128 : 2154748

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645428.1\|2151128_2152859_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.6e-46	27.4
WP_003641422.1\|2152858_2154748_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1

DBSCAN-SWA_151

2158079 : 2159099

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645424.1\|2158079_2159099_+	serine hydrolase	A0A249XPW4	Mycobacterium_phage	5.3e-07	24.2

DBSCAN-SWA_152

2162734 : 2171018

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644660.1\|2162734_2163313_+	thymidine kinase	A0A249XZX5	Enterococcus_phage	7.3e-46	49.7
WP_003641433.1\|2163326_2164409_+	peptide chain release factor 1	NA	NA	NA	NA
WP_003645420.1\|2164401_2165268_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_003645419.1\|2165558_2166578_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	9.3e-52	41.5
WP_003641436.1\|2166636_2167875_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	1.4e-94	50.6
WP_003639227.1\|2167954_2168584_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_003645418.1\|2168901_2169075_-	hypothetical protein	NA	NA	NA	NA
WP_003641437.1\|2169737_2171018_+	uracil transporter	Q9KX94	Enterobacteria_phage	1.8e-65	37.3

DBSCAN-SWA_153

2181831 : 2185394

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644657.1\|2181831_2182104_+	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	9.8e-17	47.7
WP_003645416.1\|2182087_2182315_+	DUF2969 domain-containing protein	NA	NA	NA	NA
WP_003644656.1\|2182462_2183668_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_003644655.1\|2183698_2183995_+	glycine cleavage system protein H	NA	NA	NA	NA
WP_003641452.1\|2184362_2185394_+	methionine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.2e-28	35.6

DBSCAN-SWA_154

2197307 : 2198588

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641463.1\|2197307_2198588_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	9.7e-99	47.8

DBSCAN-SWA_155

2211728 : 2214398

Catovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645403.1\|2211728_2214398_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.1e-163	43.2

DBSCAN-SWA_156

2222020 : 2222662

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641493.1\|2222020_2222662_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.5e-28	37.3

DBSCAN-SWA_157

2226158 : 2227424

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646117.1\|2226158_2227424_+	insulinase family protein	A0A1X9I714	Streptococcus_phage	3.2e-54	32.5

DBSCAN-SWA_158

2231930 : 2243375

Bacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641504.1\|2231930_2233073_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	8.6e-123	65.6
WP_003644638.1\|2233303_2234863_+	ribonuclease Y	NA	NA	NA	NA
WP_003641506.1\|2234987_2235794_+	TIGR00282 family metallophosphoesterase	NA	NA	NA	NA
WP_003641507.1\|2235821_2238512_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	6.9e-38	23.1
WP_016527149.1\|2238679_2240716_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.1e-56	29.6
WP_167803127.1\|2241641_2243375_-\|transposase	IS1182 family transposase	A0A146ICT8	Staphylococcus_phage	8.5e-90	40.6

DBSCAN-SWA_159

2248756 : 2266340

Bacillus_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641514.1\|2248756_2249767_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	9.6e-09	29.6
WP_003641515.1\|2249784_2250819_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_003641516.1\|2251128_2252271_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.0e-83	42.9
WP_003645451.1\|2252348_2252732_+	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_003641518.1\|2252861_2253995_+	DNA polymerase IV	NA	NA	NA	NA
WP_003641519.1\|2254087_2255044_+	bifunctional oligoribonuclease/PAP phosphatase NrnA	NA	NA	NA	NA
WP_003645450.1\|2255046_2256390_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-46	31.6
WP_003645449.1\|2256717_2259360_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	1.5e-61	32.0
WP_003641523.1\|2259746_2260016_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
WP_003641524.1\|2260012_2260447_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_003641525.1\|2260459_2260756_+	DUF1292 domain-containing protein	NA	NA	NA	NA
WP_003645448.1\|2260887_2261139_+	cell division protein ZapA	NA	NA	NA	NA
WP_003645447.1\|2261198_2263562_+	endonuclease MutS2	Q94M10	Lactobacillus_phage	8.5e-24	53.1
WP_003641528.1\|2263717_2264029_+	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.2e-16	45.8
WP_003641529.1\|2264196_2264880_-	YslB family protein	NA	NA	NA	NA
WP_003645446.1\|2264917_2265739_+	glutamate racemase	NA	NA	NA	NA
WP_003641531.1\|2265731_2266340_+	XTP/dITP diphosphatase	X5LRP0	Ugandan_cassava_brown_streak_virus	6.8e-10	28.6

DBSCAN-SWA_160

2286208 : 2286817

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641558.1\|2286208_2286817_+	metallophosphatase	H6W7Z4	Escherichia_phage	9.8e-09	28.8

DBSCAN-SWA_161

2291268 : 2291853

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003641564.1\|2291268_2291853_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	8.5e-26	44.2

DBSCAN-SWA_162

2318919 : 2321307

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527143.1\|2318919_2321307_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	1.8e-82	47.9

DBSCAN-SWA_163

2337393 : 2340192

Orpheovirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015380541.1\|2337393_2340192_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	6.2e-90	27.8

DBSCAN-SWA_164

2353704 : 2364114

Virus_Rctr197k(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016511428.1\|2353704_2356254_+	ATP-dependent RecD-like DNA helicase	A0A1P8DII4	Virus_Rctr197k	1.3e-49	29.1
WP_003645927.1\|2356408_2357374_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.5e-38	33.0
WP_063493433.1\|2357733_2359224_+	peptidoglycan endopeptidase	D2KRB9	Lactobacillus_phage	2.5e-13	42.6
WP_003645925.1\|2359397_2359601_+	hypothetical protein	NA	NA	NA	NA
WP_003645924.1\|2359822_2360782_-	diacylglycerol kinase family lipid kinase	A0A1V0SBJ0	Catovirus	3.8e-15	29.7
WP_003640828.1\|2360844_2362521_-	ribonuclease J	NA	NA	NA	NA
WP_003640827.1\|2362517_2362736_-	DNA-dependent RNA polymerase auxiliary subunit epsilon family protein	NA	NA	NA	NA
WP_003640826.1\|2363017_2363524_+	hypothetical protein	NA	NA	NA	NA
WP_003645922.1\|2363553_2364114_-	peptide deformylase	A0A2I7S809	Vibrio_phage	1.0e-12	36.5

DBSCAN-SWA_165

2367871 : 2369284

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640822.1\|2367871_2369284_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.8e-46	28.3

DBSCAN-SWA_166

2385991 : 2391182

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645665.1\|2385991_2386483_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.3e-23	38.9
WP_003640808.1\|2386475_2387522_+	PDZ domain-containing protein	NA	NA	NA	NA
WP_003645664.1\|2387624_2388350_+	hypothetical protein	NA	NA	NA	NA
WP_003640806.1\|2388401_2388890_+	ComE operon protein 2	A7KUY9	Bacillus_phage	1.6e-33	55.3
WP_016510987.1\|2388890_2391182_+	DNA internalization-related competence protein ComEC/Rec2	Q332B9	Clostridium_botulinum_C_phage	2.8e-24	29.5

DBSCAN-SWA_167

2398386 : 2407003

Hokovirus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640798.1\|2398386_2399574_+	elongation factor Tu	A0A1V0SGC3	Hokovirus	2.5e-32	29.7
WP_003645655.1\|2399777_2401100_+	trigger factor	NA	NA	NA	NA
WP_003640796.1\|2401394_2402660_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.6e-141	58.9
WP_003640795.1\|2402818_2403412_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_003640794.1\|2403413_2403710_+	nucleoside triphosphate pyrophosphohydrolase family protein	A0A1S7FYY8	Listeria_phage	2.9e-22	51.6
WP_016527129.1\|2403956_2404364_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_003640792.1\|2404418_2404589_-	hypothetical protein	NA	NA	NA	NA
WP_003640791.1\|2404794_2406270_+	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_003640790.1\|2406262_2407003_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-31	36.1

DBSCAN-SWA_168

2411681 : 2412623

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640785.1\|2411681_2412623_+	SDR family NAD(P)-dependent oxidoreductase	A0A1V0SAI6	Catovirus	7.0e-38	35.2

DBSCAN-SWA_169

2423639 : 2424413

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640775.1\|2423639_2424413_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	3.8e-21	31.9

DBSCAN-SWA_170

2428922 : 2431796

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645643.1\|2428922_2431259_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	5.2e-74	31.4
WP_003640768.1\|2431277_2431796_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	9.5e-29	42.1

DBSCAN-SWA_171

2439854 : 2444176

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645638.1\|2439854_2440646_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
WP_016527117.1\|2440626_2441811_+	LCP family protein	NA	NA	NA	NA
WP_003645636.1\|2441962_2442535_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003645635.1\|2443234_2444176_-	glycosyltransferase family 2 protein	V9QJB1	Oenococcus_phage	3.1e-78	48.7

DBSCAN-SWA_172

2448077 : 2452369

Phage_Wrath(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640747.1\|2448077_2448710_-	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
WP_003644501.1\|2448861_2449101_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_013355613.1\|2449204_2449435_+	YneF family protein	NA	NA	NA	NA
WP_003645630.1\|2449491_2450127_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003645629.1\|2450238_2450997_+\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
WP_003645628.1\|2450980_2451286_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_003640741.1\|2451370_2452369_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9

DBSCAN-SWA_173

2456996 : 2457776

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640735.1\|2456996_2457776_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1

DBSCAN-SWA_174

2462134 : 2471688

Bradyrhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640729.1\|2462134_2466448_+	DNA polymerase III subunit alpha	A0A1X9SH08	Bradyrhizobium_phage	1.0e-14	34.0
WP_003640728.1\|2466743_2467220_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_003640727.1\|2467240_2468458_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_003640726.1\|2468502_2468802_+	YlxR family protein	NA	NA	NA	NA
WP_003640725.1\|2468791_2469097_+	hypothetical protein	NA	NA	NA	NA
WP_167803130.1\|2469111_2471688_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.3e-20	23.3

DBSCAN-SWA_175

2484032 : 2496524

Tupanvirus(33.33%)

integrase

attL 2483994:2484009|attR 2497997:2498012

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2483994:2484009	attL	NA	NA	NA	NA
WP_167803131.1\|2484032_2485901_+	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	2.2e-136	47.1
WP_003640710.1\|2486002_2487145_+	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
WP_003640709.1\|2487560_2488754_+	serine hydrolase	NA	NA	NA	NA
WP_003640708.1\|2488785_2488935_+	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
WP_003640707.1\|2488977_2490504_+	D-alanine--poly(phosphoribitol) ligase subunit DltA	A0A2K9KZV5	Tupanvirus	7.6e-42	27.6
WP_003640706.1\|2490500_2491715_+	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-27	30.5
WP_003640705.1\|2491738_2491981_+	D-alanine--poly(phosphoribitol) ligase subunit DltC	NA	NA	NA	NA
WP_003640704.1\|2491977_2493255_+	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
WP_003640703.1\|2493418_2495254_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-23	26.1
WP_016527114.1\|2495369_2496524_-\|integrase	site-specific integrase	A0A0A8WIE1	Clostridium_phage	3.3e-98	44.7
2497997:2498012	attR	NA	NA	NA	NA

DBSCAN-SWA_176

2501984 : 2519172

Salmonella_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640696.1\|2501984_2504252_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	S4TRQ0	Salmonella_phage	2.4e-07	43.6
WP_003640695.1\|2504261_2504708_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_003645975.1\|2504780_2505404_+	HAD family hydrolase	NA	NA	NA	NA
WP_016511330.1\|2505511_2506354_-	phosphotransferase	NA	NA	NA	NA
WP_003645977.1\|2506622_2507471_-	SH3 domain-containing protein	C8CHK8	Thermus_virus	3.0e-11	38.9
WP_003640691.1\|2507860_2509141_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
WP_003640690.1\|2509182_2510979_+\|tRNA	aspartate--tRNA ligase	A0A1V0SFI4	Hokovirus	3.0e-05	30.2
WP_003644477.1\|2511059_2511590_+	peptide-methionine (S)-S-oxide reductase MsrA	NA	NA	NA	NA
WP_003640688.1\|2511792_2512668_+	YitT family protein	M1Q1P6	Streptococcus_phage	5.9e-23	29.7
WP_003645978.1\|2513041_2514202_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
WP_003640686.1\|2514314_2515211_+	deoxyribonuclease IV	A0A2H4UU70	Bodo_saltans_virus	4.4e-21	30.7
WP_016527110.1\|2515365_2515995_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_003640684.1\|2516137_2516956_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_003638914.1\|2517188_2517377_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_003640683.1\|2517418_2517862_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.5e-17	35.6
WP_003645980.1\|2518200_2519172_+	PhoH family protein	L7TP00	Rhizobium_phage	2.2e-50	49.3

DBSCAN-SWA_177

2525379 : 2528445

Helicobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803133.1\|2525379_2527257_+	DNA primase	A0A1S5RH70	Helicobacter_phage	4.2e-50	29.9
WP_003640674.1\|2527338_2528445_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.7e-38	37.4

DBSCAN-SWA_178

2533296 : 2534196

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645989.1\|2533296_2534196_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-30	36.1

DBSCAN-SWA_179

2568610 : 2572244

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003646019.1\|2568610_2569900_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	8.3e-106	51.2
WP_016527099.1\|2569967_2572244_+	HAD-IC family P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	2.2e-32	23.8

DBSCAN-SWA_180

2577900 : 2582074

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527098.1\|2577900_2580297_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.5e-118	31.4
WP_003644447.1\|2580451_2580958_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_016527097.1\|2581132_2582074_+	daunorubicin resistance protein DrrA family ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.2e-26	33.9

DBSCAN-SWA_181

2587833 : 2595004

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527095.1\|2587833_2590437_+	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	7.2e-125	36.6
WP_003640607.1\|2590792_2590933_+	hypothetical protein	NA	NA	NA	NA
WP_003640606.1\|2591092_2591293_-	YjzD family protein	NA	NA	NA	NA
WP_003646035.1\|2591653_2595004_+	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	6.4e-150	32.8

DBSCAN-SWA_182

2600307 : 2607344

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644441.1\|2600307_2601198_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	4.6e-39	33.3
WP_003644440.1\|2601236_2601620_+	hypothetical protein	NA	NA	NA	NA
WP_003640597.1\|2601585_2602353_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.3e-09	23.3
WP_003640596.1\|2602339_2602939_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.6e-11	30.5
WP_003640595.1\|2602938_2603655_+	rRNA pseudouridine synthase	NA	NA	NA	NA
WP_003644438.1\|2603954_2604539_+	ECF transporter S component	NA	NA	NA	NA
WP_003645009.1\|2604874_2605918_+	hypothetical protein	NA	NA	NA	NA
WP_003645010.1\|2605904_2607344_+	ATP-dependent DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	3.9e-56	38.9

DBSCAN-SWA_183

2611833 : 2612109

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640587.1\|2611833_2612109_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	6.8e-26	69.7

DBSCAN-SWA_184

2615564 : 2625307

unidentified_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645014.1\|2615564_2616788_+\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.7e-44	50.0
WP_003640581.1\|2616844_2617297_+	hypothetical protein	NA	NA	NA	NA
WP_003645015.1\|2617482_2619393_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.0e-51	28.4
WP_003640579.1\|2619405_2620356_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	3.8e-116	61.5
WP_003640578.1\|2620365_2620857_+	dihydrofolate reductase	A0A1L7N103	Ralstonia_phage	9.4e-18	37.9
WP_003640577.1\|2620963_2621815_+	DegV family protein	NA	NA	NA	NA
WP_003644430.1\|2621964_2622909_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_003640575.1\|2622921_2623566_+	YpmS family protein	NA	NA	NA	NA
WP_003640574.1\|2623577_2623799_+	YozE family protein	NA	NA	NA	NA
WP_016527094.1\|2623828_2625307_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.8e-19	29.9

DBSCAN-SWA_185

2630558 : 2649442

Bacillus_virus(25.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645022.1\|2630558_2631488_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	9.1e-06	35.0
WP_003645024.1\|2631677_2632826_+	cobalamin-independent methionine synthase II family protein	A0A218MNE0	uncultured_virus	2.7e-47	33.2
WP_003644425.1\|2633375_2634230_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_003645025.1\|2634222_2634990_+	ribonuclease HII	G4YAY0	Emiliania_huxleyi_virus	7.5e-22	35.6
WP_003640564.1\|2635068_2635935_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_003645027.1\|2636023_2638171_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	4.1e-102	37.3
WP_003645028.1\|2638448_2639774_+\|tRNA	FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO	NA	NA	NA	NA
WP_003640561.1\|2639853_2640798_+	tyrosine recombinase XerC	S5M872	Bacillus_phage	4.2e-14	26.5
WP_003638820.1\|2640781_2641324_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
WP_003645029.1\|2641341_2642760_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IDZ7	Erwinia_phage	2.8e-30	27.9
WP_003645030.1\|2642786_2643665_+	aldose 1-epimerase family protein	NA	NA	NA	NA
WP_003644419.1\|2643860_2644487_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_003640557.1\|2644971_2646978_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.6e-124	42.7
WP_003645031.1\|2646991_2649442_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	1.4e-93	31.9

DBSCAN-SWA_186

2659836 : 2661186

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645036.1\|2659836_2661186_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	8.0e-27	25.7

DBSCAN-SWA_187

2685901 : 2686801

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825576.1\|2685901_2686801_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	9.7e-37	40.1

DBSCAN-SWA_188

2690746 : 2691346

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644391.1\|2690746_2691346_-	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	3.3e-33	39.3

DBSCAN-SWA_189

2695882 : 2696806

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011101547.1\|2695882_2696806_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.2e-10	29.1

DBSCAN-SWA_190

2703708 : 2711076

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640500.1\|2703708_2704386_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.1e-07	25.7
WP_015380346.1\|2704385_2705144_-	hypothetical protein	NA	NA	NA	NA
WP_003645068.1\|2705285_2706254_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_003645069.1\|2706425_2707769_-	glycosyl hydrolase family 25	A0A2P0ZKX1	Lactobacillus_phage	2.9e-37	32.2
WP_003645070.1\|2707916_2708405_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015640382.1\|2708502_2709582_-	LD-carboxypeptidase	NA	NA	NA	NA
WP_015380342.1\|2709735_2711076_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.7e-05	31.9

DBSCAN-SWA_191

2716702 : 2721463

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640485.1\|2716702_2717272_-	DUF1273 domain-containing protein	U5J9F7	Bacillus_phage	8.6e-07	25.9
WP_003644374.1\|2717386_2718010_+	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	3.2e-23	38.7
WP_003640483.1\|2718021_2720325_+	penicillin-binding protein	NA	NA	NA	NA
WP_003645078.1\|2720509_2721463_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-21	34.0

DBSCAN-SWA_192

2726424 : 2734839

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527087.1\|2726424_2727492_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.6e-30	37.9
WP_011101531.1\|2727865_2728072_-	hypothetical protein	NA	NA	NA	NA
WP_003645085.1\|2728127_2728853_-	DnaD domain protein	A0A0N7AE27	Bacillus_phage	7.4e-11	40.4
WP_015640374.1\|2728930_2730226_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	2.3e-55	29.0
WP_016511714.1\|2730246_2731446_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_003640471.1\|2731468_2731930_-	DUF5590 domain-containg protein	NA	NA	NA	NA
WP_003645087.1\|2732034_2734839_-	ATP-dependent helicase DinG	A0A127AW80	Bacillus_phage	5.2e-36	24.1

DBSCAN-SWA_193

2750242 : 2753606

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644352.1\|2750242_2751592_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	1.4e-18	24.0
WP_003644351.1\|2752025_2752298_-	hypothetical protein	NA	NA	NA	NA
WP_003644350.1\|2752437_2752737_-	hypothetical protein	NA	NA	NA	NA
WP_003640453.1\|2752829_2753606_-	potassium channel family protein	A0A1B0Y2S3	Lactobacillus_phage	1.4e-23	35.0

DBSCAN-SWA_194

2764198 : 2767004

Apis_mellifera_filamentous_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640437.1\|2764198_2764804_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.0e-15	32.1
WP_003645106.1\|2765831_2767004_-	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	1.9e-40	37.8

DBSCAN-SWA_195

2797625 : 2805236

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015825530.1\|2797625_2798408_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	7.6e-30	34.3
WP_071542698.1\|2798404_2799424_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.6e-51	37.8
WP_003640393.1\|2799448_2800024_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.6e-35	39.1
WP_003645140.1\|2800007_2801444_-	anthranilate synthase component I family protein	S4VT78	Pandoravirus	1.7e-22	28.9
WP_167803155.1\|2801916_2803512_-	ABC transporter permease	NA	NA	NA	NA
WP_003640390.1\|2803504_2804269_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.8e-22	28.6
WP_003645142.1\|2804765_2805236_-	alcohol dehydrogenase	M4SQJ2	Pseudoalteromonas_phage	1.9e-07	46.3

DBSCAN-SWA_196

2823024 : 2823720

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640377.1\|2823024_2823720_-	ribonuclease III	A0A1V0SDK0	Indivirus	2.7e-18	33.0

DBSCAN-SWA_197

2832876 : 2846795

Noumeavirus(20.0%)

tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645152.1\|2832876_2834901_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1Q1PNS5	Noumeavirus	2.9e-20	30.5
WP_003640367.1\|2834897_2835644_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
WP_003645153.1\|2835661_2837005_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_003645154.1\|2837001_2837955_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.7e-10	31.4
WP_015640323.1\|2837978_2840396_-	primosomal protein N'	NA	NA	NA	NA
WP_003644318.1\|2840418_2841645_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	7.5e-40	33.1
WP_003640362.1\|2841808_2842021_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_003640361.1\|2842017_2842638_-	guanylate kinase	A0A0M5KCK5	Mollivirus	1.4e-10	33.6
WP_003644317.1\|2842812_2843166_+	hypothetical protein	NA	NA	NA	NA
WP_003640359.1\|2843371_2844025_-	ABC transporter permease	NA	NA	NA	NA
WP_003640358.1\|2844024_2844960_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003644316.1\|2844972_2845602_-	ABC transporter permease	NA	NA	NA	NA
WP_003644315.1\|2845598_2846795_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	3.0e-17	46.2

DBSCAN-SWA_198

2851445 : 2853642

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645161.1\|2851445_2852789_-	exodeoxyribonuclease VII large subunit	A0A160DEV2	Gordonia_phage	6.7e-26	30.8
WP_003645162.1\|2852781_2853642_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.1e-32	40.1

DBSCAN-SWA_199

2866144 : 2866879

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640330.1\|2866144_2866879_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	4.5e-16	44.3

DBSCAN-SWA_200

2879529 : 2880159

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640313.1\|2879529_2880159_-	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	39.6

DBSCAN-SWA_201

2883955 : 2885002

Bodo_saltans_virus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644299.1\|2883955_2885002_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.0e-26	37.9

DBSCAN-SWA_202

2890869 : 2901003

Bacillus_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645180.1\|2890869_2894055_+	SMC family ATPase	G3MAB6	Bacillus_virus	2.8e-06	20.9
WP_049816385.1\|2894189_2895155_-	prenyltransferase	NA	NA	NA	NA
WP_003645182.1\|2895528_2897172_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	9.4e-22	28.7
WP_003638551.1\|2897171_2897858_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-30	32.4
WP_167803143.1\|2898048_2899398_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.9e-84	42.5
WP_003645183.1\|2899566_2901003_-	NADP-dependent phosphogluconate dehydrogenase	M4SJX8	Cyanophage	2.6e-28	29.3

DBSCAN-SWA_203

2915608 : 2929234

Bacillus_phage(28.57%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645191.1\|2915608_2916871_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.5e-67	38.4
WP_003645192.1\|2917042_2917354_-	hypothetical protein	NA	NA	NA	NA
WP_003640279.1\|2917597_2917954_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_003638526.1\|2917990_2918185_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_003640278.1\|2918206_2918707_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.4e-16	38.0
WP_003645193.1\|2918949_2920914_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	4.5e-103	34.4
WP_003645194.1\|2921246_2922182_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	2.8e-26	30.3
WP_167803144.1\|2922185_2923589_-	helicase DnaB	NA	NA	NA	NA
WP_003640274.1\|2923610_2924126_-	transcriptional repressor NrdR	NA	NA	NA	NA
WP_167803145.1\|2924167_2924761_-	dephospho-CoA kinase	NA	NA	NA	NA
WP_003640272.1\|2924770_2925595_-	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	8.9e-29	33.0
WP_003645196.1\|2925606_2928255_-	DNA polymerase I	F8WQ35	Bacillus_phage	6.8e-46	35.1
WP_003640270.1\|2928517_2929234_-	Bax inhibitor-1/YccA family protein	A2VCJ8	Vaccinia_virus	2.9e-07	25.2

DBSCAN-SWA_204

2933173 : 2936507

environmental_halophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527064.1\|2933173_2934412_-	cysteine desulfurase	Q2XUY6	environmental_halophage	9.4e-107	46.6
WP_003645199.1\|2934395_2935697_-	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
WP_071542708.1\|2935709_2936507_-	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	1.8e-10	25.5

DBSCAN-SWA_205

2940819 : 2943810

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016527061.1\|2940819_2943810_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	2.4e-87	49.7

DBSCAN-SWA_206

2947951 : 2948689

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003644277.1\|2947951_2948689_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-20	27.8

DBSCAN-SWA_207

2958751 : 2966407

Staphylococcus_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003640243.1\|2958751_2960068_-	FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	8.7e-10	25.3
WP_003640242.1\|2960221_2960848_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011101408.1\|2960983_2961625_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_003645210.1\|2961713_2962277_+	hypothetical protein	NA	NA	NA	NA
WP_003640239.1\|2962453_2963014_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_003640238.1\|2963044_2963524_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.1e-34	47.3
WP_003645212.1\|2963520_2964735_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.7e-84	46.7
WP_003640236.1\|2964736_2965339_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.8e-23	38.9
WP_003644273.1\|2965339_2966407_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.2e-38	32.8

DBSCAN-SWA_208

2972120 : 2981958

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645220.1\|2972120_2973116_-	glycosyltransferase family 2 protein	S5FKN0	Shigella_phage	3.1e-52	38.8
WP_015380221.1\|2973742_2973880_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_003643094.1\|2973975_2974416_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	8.0e-77	99.3
WP_016527054.1\|2974486_2975047_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	1.3e-100	99.5
WP_015380220.1\|2975134_2977573_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
WP_003643097.1\|2977575_2978190_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
WP_003645222.1\|2978533_2979481_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.7e-177	99.7
WP_015640259.1\|2979666_2980638_+	Nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	2.0e-181	98.8
WP_041161831.1\|2980728_2981958_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	7.9e-215	97.4

DBSCAN-SWA_209

3005114 : 3009749

Planktothrix_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803146.1\|3005114_3007109_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.3e-35	40.4
WP_003645237.1\|3007378_3007855_+	hypothetical protein	NA	NA	NA	NA
WP_003645238.1\|3008060_3009749_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9

DBSCAN-SWA_210

3018008 : 3019810

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003645243.1\|3018008_3018632_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
WP_003645244.1\|3018634_3019810_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	1.4e-48	31.7

DBSCAN-SWA_211

3029844 : 3033812

Lactobacillus_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167803148.1\|3029844_3030222_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	5.3e-13	77.1
WP_167803156.1\|3030233_3030497_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.2e-29	79.3
WP_167803149.1\|3030496_3031678_-	LysM peptidoglycan-binding domain-containing protein	E9LUR8	Lactobacillus_phage	1.8e-192	86.0
WP_167803150.1\|3031689_3031929_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	2.0e-18	73.3
WP_167803151.1\|3033405_3033567_-	hypothetical protein	A0A2P0ZLG1	Lactobacillus_phage	1.5e-17	90.6
WP_167803152.1\|3033569_3033812_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.2e-29	93.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050806

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP050809

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

3. NZ_CP050805

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection