CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP048852	Bacillus tequilensis strain EA-CB0015 chromosome, complete genome	3 crisprs	csa3,RT,cas3,DEDDh,WYL,DinG	1	1	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP048852_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048852_1

1699358-1699462

Orphan

Consensus_repeat	Method
GGTCTTCCAAACCCAAAGCCGAATCCAGGTCTTCCAAAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048852_1

>merge|NZ_CP048852|1|1699358-1699462|CRISPRCasFinder
GGTCTTCCAAACCCAAAGCCGAATCCAGGTCTTCCAAATCCGAATGGCCGGCCGAAACCAAATCCAGGTCTTCCAAATCCAAAGCCGAATCCAGGTCTTCCAAAT

>NZ_CP048852|1|1|1699358-1699462|CRISPRCasFinder
GGTCTTCCAAACCCAAAGCCGAATCCAGGTCTTCCAAAT	CCGAATGGCCGGCCGAAACCAAATCCA
GGTCTTCCAAATCCAAAGCCGAATCCAGGTCTTCCAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048852.1\|WP_167872400.1\|1698377_1698731_-\|multidrug-efflux-SMR-transporter-subunit-EbrB	unknown	unknown	gnl\|CDD\|224987
NZ_CP048852.1\|WP_167873847.1\|1689904_1690246_-\|DUF3139-domain-containing-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_024715969.1\|1702312_1702705_+\|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI	unknown	unknown	gnl\|CDD\|179603
NZ_CP048852.1\|WP_024715972.1\|1700105_1701050_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP048852.1\|WP_014113879.1\|1704784_1705774_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP048852.1\|WP_024715981.1\|1693757_1694114_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_167872404.1\|1705823_1706444_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226597
NZ_CP048852.1\|WP_167872405.1\|1706504_1707272_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|119407
NZ_CP048852.1\|WP_024715983.1\|1692311_1692869_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_024715970.1\|1701838_1702069_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_024715982.1\|1692988_1693606_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379409
NZ_CP048852.1\|WP_167872402.1\|1699593_1700007_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378946
NZ_CP048852.1\|WP_024715968.1\|1702664_1704767_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|236069
NZ_CP048852.1\|WP_167872399.1\|1697913_1698366_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|132602
NZ_CP048852.1\|WP_167872401.1\|1698744_1699062_-\|multidrug-efflux-SMR-transporter-subunit-EbrA	unknown	unknown	gnl\|CDD\|224987
NZ_CP048852.1\|WP_167872397.1\|1691718_1692174_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372952
NZ_CP048852.1\|WP_167872403.1\|1701484_1701757_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372934
NZ_CP048852.1\|WP_024715978.1\|1697132_1697840_+\|poly-gamma-glutamate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|226658
NZ_CP048852.1\|WP_003221097.1\|1701089_1701311_+\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP048852.1\|WP_167872398.1\|1695091_1696420_-\|S8-family-peptidase	unknown	unknown	gnl\|CDD\|173812

Protein	Function_ID	Function_description	E-value
NZ_CP048852.1\|WP_167872400.1\|1698377_1698731_-\|multidrug-efflux-SMR-transporter-subunit-EbrB	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	9.65099e-31
NZ_CP048852.1\|WP_167872401.1\|1698744_1699062_-\|multidrug-efflux-SMR-transporter-subunit-EbrA	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	7.33615e-30
NZ_CP048852.1\|WP_024715969.1\|1702312_1702705_+\|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI	gnl\|CDD\|179603	PRK03600, nrdI, class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI.	6.51352e-55
NZ_CP048852.1\|WP_024715972.1\|1700105_1701050_+\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.80091e-164
NZ_CP048852.1\|WP_014113879.1\|1704784_1705774_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP048852.1\|WP_167872405.1\|1706504_1707272_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|119407	cd02696, MurNAc-LAA, N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.	9.44915e-65
NZ_CP048852.1\|WP_167872404.1\|1705823_1706444_+\|hypothetical-protein	gnl\|CDD\|226597	COG4112, COG4112, Predicted phosphoesterase (MutT family) [General function prediction only].	4.15414e-103
NZ_CP048852.1\|WP_024715982.1\|1692988_1693606_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|379409	pfam13977, TetR_C_6, BetI-type transcriptional repressor, C-terminal. This family comprises the C-terminal portion of proteins that belong to the TetR family of transcriptional regulators. The C-terminus represents the regulatory region, and does not include the DNA binding helix-turn-helix domain. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. One of the target proteins is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	4.96395e-21
NZ_CP048852.1\|WP_167872402.1\|1699593_1700007_+\|hypothetical-protein	gnl\|CDD\|378946	pfam12788, YmaF, YmaF family. This family of proteins contain 6 HXH motifs and is named after the B. subtilis YmaF protein. It seems likely that these are involved in metal binding. The function of this protein is unknown.	4.97482e-07
NZ_CP048852.1\|WP_024715968.1\|1702664_1704767_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|236069	PRK07632, PRK07632, ribonucleotide-diphosphate reductase subunit alpha; Validated.	0
NZ_CP048852.1\|WP_167872399.1\|1697913_1698366_+\|OsmC-family-protein	gnl\|CDD\|132602	TIGR03563, perox_SACOL1771, peroxiredoxin, SACOL1771 subfamily. This protein family belongs to the OsmC/Ohr family (pfam02566, OsmC-like protein) of peroxiredoxins.	8.45973e-87
NZ_CP048852.1\|WP_167872397.1\|1691718_1692174_-\|hypothetical-protein	gnl\|CDD\|372952	pfam14184, YrvL, Regulatory protein YrvL. YrvL prevents expression and activity of the YrvI sigma factor. It may function as an anti-sigma factor.	3.30517e-19
NZ_CP048852.1\|WP_167872398.1\|1695091_1696420_-\|S8-family-peptidase	gnl\|CDD\|173812	cd07487, Peptidases_S8_1, Peptidase S8 family domain, uncharacterized subfamily 1. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	2.10898e-137
NZ_CP048852.1\|WP_024715978.1\|1697132_1697840_+\|poly-gamma-glutamate-hydrolase-family-protein	gnl\|CDD\|226658	COG4195, COG4195, Phage-related replication protein [General function prediction only].	5.73827e-109
NZ_CP048852.1\|WP_003221097.1\|1701089_1701311_+\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	1.03827e-39
NZ_CP048852.1\|WP_167872403.1\|1701484_1701757_+\|hypothetical-protein	gnl\|CDD\|372934	pfam14157, YmzC, YmzC-like protein. The YmzC-like protein family includes the B. subtilis YmzC protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 91 amino acids in length. There is a conserved ELR sequence motif.	1.33912e-20

>NZ_CP048852.1|WP_167872401.1|1698744_1699062_-|multidrug-efflux-SMR-transporter-subunit-EbrA
MLIGYIFLTIAICSESIGAAMLKVSDGFKKWKPSALVVIGYSLAFYMLSLTLNHIPLSLAYATWSGAGTVLTAVIGVKWFKEELNVKGLFGILLLLSGVVLLNWQ
>NZ_CP048852.1|WP_167872400.1|1698377_1698731_-|multidrug-efflux-SMR-transporter-subunit-EbrB
MKGLLYLALAIVSEVFGSTMLKLSEGFTQGLPIVGVIAGFLSAFTFLSFSLKTIDLSSAYATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVIVLNQSKAPAKDKKQTACE
>NZ_CP048852.1|WP_167872399.1|1697913_1698366_+|OsmC-family-protein
MADHHFYLKANWPGNRNDVGTIESGNLITTISIPKEMDGPGEGTNPDEMLLGAAATCYIITLAAMMERSGLVKEDLQIESEGIVDVTKGVFTYKKIIHRPSVVLKHGASQEDVALAHKLCEKAESSCMISRAIQGNVEMQLEAAVKRAGE
>NZ_CP048852.1|WP_024715978.1|1697132_1697840_+|poly-gamma-glutamate-hydrolase-family-protein
MRRFLLNVIFVLTIVLFLKYVHYSLEPEPSNQPDTYPNFSSLAENESPADYDISYNEKKGSKVLIMSPHGGRIEGGVSELVRYFNNEYSTYLFEGFKSQDNQTLHITSTNFDEPLAEKKIKEHQYVVAFHGYKGENKNTLVGGTDRKRAKMIVRALKRSGFSAELASTGSGLAGLNAENINNQGETGLSIQLEISREQREAFFDDFYYKNRKYTKNNEFYAYVRAIKSVLENEYS
>NZ_CP048852.1|WP_167872398.1|1695091_1696420_-|S8-family-peptidase
MFGYSMVQMVRANAHKLDWPLRESVLQLYKPFKWTPCFLHQFFETKLRNRKKISVIIEFEEGCHETGLQMAAEVLQKEKRSKLKNRFNKINCCSAVVTPSALDSLLSACSEIRKVYLNREVKALLDTATEASHAKKVIRNGHTLTGKGVTVAVVDTGIYPHPDLKGRIIDFADMINQKTEPYDDNGHGTHCAGDIASSGASSSGQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPNEPIDIISMSLGGDALRYDNEQEDPLVRAVEEAWNAGIVVCVAAGNSGPDPQTIASPGVSEKVITVGALDDNNTPSDDDDTVASFSSRGPTVYGKEKPDILAPGVDIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALLLQQNPDLTPDEVKELLKNGADKWKNEDPNVYGAGAVNAEKSIPGQ
>NZ_CP048852.1|WP_024715981.1|1693757_1694114_-|hypothetical-protein
MAHTNTQLSQWLESKVGQTLDIRKGELTHDEEISDLDQIVLNLQKVGIRSTNHPDDYVAKEELVLEGEGTTFTEEGNVPLPQNAYEIPLLGDIHIHQENEGLKVVTDRAVYTIDIQHS
>NZ_CP048852.1|WP_024715982.1|1692988_1693606_+|TetR-family-transcriptional-regulator
MPKQIDHEKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLVFAMKLVQEKARARIEDIATKDLPPKEKMLHILLEIVPTNEETIREMEVWFAFTVYARHKKDMFDANHDGIYGGIRNLIAYLDEFDLLKQDADKDIEAERLYALIDGLALHAMLDPVRVNKDRITRVIMQHVESICAEETNETEGREY
>NZ_CP048852.1|WP_024715983.1|1692311_1692869_-|hypothetical-protein
MNGIAWMIVFCEIAFWVVIVLGLAVRYLFKQRTLGLLVLALTPVIDLILLAATGVDLYRGASATAAHGIAAVYIGISIAYGKQMIQWADERFQYYVTKQGSKPLKRYGMDYAKHNAKSWIRHVLAYLIGAGLLAGMIYFINDSARTEALSGILKIWTVILGIDFLFTASYFIWPKKEKASENLKS
>NZ_CP048852.1|WP_167872397.1|1691718_1692174_-|hypothetical-protein
MSQKEQNEQFKDLNLSSKIIVIVSIILIVAIALAVIFGGYFFGMKGLFSILGITYDSNQTLVLFLLVCFAAGMIIDPLTKIASMILAKSFSLKKTALFAFILYFVSNFITICFADYFMQSISIPDILLFVISALMALIELAFDYKPNEQTA
>NZ_CP048852.1|WP_167873847.1|1689904_1690246_-|DUF3139-domain-containing-protein
MVKKILLSLLALAIIVAGVFLLMHFNSRKVAEDKIDHYISDYGIPQKEIESEEYPMFNSLSAPTGFTKAVFVKNENNKSNYYIFHYDPSNKKITFSGVIDGNEVSINDKLIKK
>NZ_CP048852.1|WP_167872402.1|1699593_1700007_+|hypothetical-protein
MNILGLYQSDWSKAPPHVHAYHVKTMREQGHYHLIEGFTQPANGSNTDQHTHYFSGITSFENGHFHRYYGVSGPAIPLADGTHYHEIEETTYLAYNEPIEIQYGGVVYHHGDGERKTHRHALKGKTREIVGNEPFGW
>NZ_CP048852.1|WP_024715972.1|1700105_1701050_+|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MNNTKQPVVILVGPTAVGKTNLSIQLAKSLNAEIISGDSMQVYKGMDIGTAKITEREMEGVPHHLIDILDPQDSFSTADYQSLVRKKISEIAKRGKLPMIVGGTGLYIQSVLYDYTFTEEANDPAFRQRMQTAAEREGADFLHAKLAEADPEAAAAIHPNNTRRVIRALEILHTSGKTMSQHLKEQKRELLYNAVLIGLTMDRDTLYARINQRVDMMMEAGLLPEVKHLYDRNIRDCQSIQAIGYKELYAYFDGFVTLSDAVDQLKQNSRRYAKRQLTWFRNKMQVTWFDMTPPVDMELKKKEIFTHIAGKLEL
>NZ_CP048852.1|WP_003221097.1|1701089_1701311_+|RNA-chaperone-Hfq
MKPINIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLIYKHAISTFAPQKNVQLELE
>NZ_CP048852.1|WP_167872403.1|1701484_1701757_+|hypothetical-protein
MFDSEAELRRIRIALVWIAVFLLFGACGNHDTVIETDSGYSGDETPQPTSFPLEHNHFGVMEDGYIKIYEYNESRNEVKLKKEYLDDELE
>NZ_CP048852.1|WP_024715970.1|1701838_1702069_+|hypothetical-protein
MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIISALKAVLEEIGADVEIEETVESETCCDRLRKKNLDY
>NZ_CP048852.1|WP_024715969.1|1702312_1702705_+|class-Ib-ribonucleoside-diphosphate-reductase-assembly-flavoprotein-NrdI
MVQIIFDSKTGNVQRFVNKIGFQQIRKVDEIDHLDTPFVLVTYTTNFGQVPASTQSFLEKYAHLLLGVAASGNKVWGDYYAKSADTISRQYQVPILHKFELSGTSKDVELFTQEVERVVTKSSAKMDPVK
>NZ_CP048852.1|WP_024715968.1|1702664_1704767_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-alpha
MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHDLKEKLDYLIKNQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEYVDLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYVFYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMFQDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVMEHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKYEKIASLFEGMHIPTKEDWEKLKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKDTMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
>NZ_CP048852.1|WP_014113879.1|1704784_1705774_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEIALNGDLLTWKYLGKNEQDTYMKVLAGLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETINEVFEWVKQNKYLQKKAQIIVGLYKAIQKDDEISLFKAMVASVYLESFLFYSGFYYPLYFYGQGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTEEKKAELREFAIDLLNELYENELEYTEDLYDQVGLSHDVKKFIRYNANKALMNLGFDPYFEEEDINPIVLNGLNTKTKSHDFFSMKGNGYKKATVEPLKDDDFYFGDEKEQI
>NZ_CP048852.1|WP_167872404.1|1705823_1706444_+|hypothetical-protein
MGKMDEMILVTPRDEVFKKESLTFQGVYSEDSRVAEIMAQIEAGYREMRRGDAEEDPHFKQPIPYVVIKREEEVFLYERLAGGGESRLHNKLSLGFGGHMNAIDGAASFAEVLKLNTDRELDEELQIKEEDKQAIVTLGLINDDENSVGKVHIGILSALQLKPGSQVEVKEKEQIAGKWMKISELKQDDIYNRLETWSQFVVDILE
>NZ_CP048852.1|WP_167872405.1|1706504_1707272_-|N-acetylmuramoyl-L-alanine-amidase
MVKIFIDPGHGGSDPGATGNGLQEKTLTLQIALALRTILTNEYEEISLLLSRTSDKYVSLTDRTNAANNWGADFFLSIHVNSGGGTGFESYIYPGVGAPTTTYQSMIHSEVIQAVNFADRGKKTANFHVLRESTMPALLTENGFIDTLADANKLKTSSFIQSLARGHANGLKQAFNLKKTSISGLYKVQIGAFKVKANADSHASSAEAKGFDTIVVLKDGLYKVQIGAFSSKDNADALAAKAKNAGFDAIVIPEP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048852_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048852_2

2974005-2974112

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048852_2

>merge|NZ_CP048852|2|2974005-2974112|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTATTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>NZ_CP048852|2|2|2974005-2974112|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTATTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048852.1\|WP_167873173.1\|2963818_2964892_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
NZ_CP048852.1\|WP_167873180.1\|2981096_2981675_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
NZ_CP048852.1\|WP_167873170.1\|2960872_2961424_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP048852.1\|WP_024713039.1\|2984995_2985574_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
NZ_CP048852.1\|WP_167873182.1\|2982260_2983790_-\|flotillin-lipid-rafts-scaffold-protein-FloT	unknown	unknown	gnl\|CDD\|225177
NZ_CP048852.1\|WP_167873179.1\|2971503_2973387_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
NZ_CP048852.1\|WP_167873175.1\|2965475_2967872_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
NZ_CP048852.1\|WP_167873177.1\|2969309_2970341_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966
NZ_CP048852.1\|WP_167873178.1\|2970364_2971507_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP048852.1\|WP_167873172.1\|2962495_2963629_-\|spore-coat-protein-CotSA	unknown	unknown	gnl\|CDD\|340831
NZ_CP048852.1\|WP_167873176.1\|2967858_2969313_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
NZ_CP048852.1\|WP_024713035.1\|2989305_2989851_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
NZ_CP048852.1\|WP_167873181.1\|2981714_2982236_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP048852.1\|WP_024713036.1\|2988556_2989099_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
NZ_CP048852.1\|WP_167873174.1\|2964977_2965445_+\|TspO/MBR-family-protein	unknown	unknown	gnl\|CDD\|226007
NZ_CP048852.1\|WP_024713040.1\|2984501_2984990_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP048852.1\|WP_167873171.1\|2961425_2962481_-\|spore-coat-protein-CotS	unknown	unknown	gnl\|CDD\|131952
NZ_CP048852.1\|WP_167873184.1\|2986885_2988358_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
NZ_CP048852.1\|WP_167873893.1\|2985660_2986869_-\|choline-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
NZ_CP048852.1\|WP_167873183.1\|2983808_2984333_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684

Protein	Function_ID	Function_description	E-value
NZ_CP048852.1\|WP_167873173.1\|2963818_2964892_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	8.96749e-129
NZ_CP048852.1\|WP_167873180.1\|2981096_2981675_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.37539e-73
NZ_CP048852.1\|WP_167873170.1\|2960872_2961424_-\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	0.00031174
NZ_CP048852.1\|WP_024713039.1\|2984995_2985574_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	1.64061e-06
NZ_CP048852.1\|WP_167873182.1\|2982260_2983790_-\|flotillin-lipid-rafts-scaffold-protein-FloT	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	6.26067e-120
NZ_CP048852.1\|WP_167873179.1\|2971503_2973387_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP048852.1\|WP_167873175.1\|2965475_2967872_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP048852.1\|WP_167873177.1\|2969309_2970341_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
NZ_CP048852.1\|WP_167873178.1\|2970364_2971507_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP048852.1\|WP_167873172.1\|2962495_2963629_-\|spore-coat-protein-CotSA	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.84242e-73
NZ_CP048852.1\|WP_167873176.1\|2967858_2969313_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
NZ_CP048852.1\|WP_024713035.1\|2989305_2989851_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	2.61097e-44
NZ_CP048852.1\|WP_167873181.1\|2981714_2982236_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	2.25234e-09
NZ_CP048852.1\|WP_024713036.1\|2988556_2989099_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	5.11802e-70
NZ_CP048852.1\|WP_167873174.1\|2964977_2965445_+\|TspO/MBR-family-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	4.99128e-40
NZ_CP048852.1\|WP_024713040.1\|2984501_2984990_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	1.27515e-16
NZ_CP048852.1\|WP_167873171.1\|2961425_2962481_-\|spore-coat-protein-CotS	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	2.53096e-127
NZ_CP048852.1\|WP_167873184.1\|2986885_2988358_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
NZ_CP048852.1\|WP_167873893.1\|2985660_2986869_-\|choline-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	5.93447e-174
NZ_CP048852.1\|WP_167873183.1\|2983808_2984333_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.00232621

>NZ_CP048852.1|WP_167873179.1|2971503_2973387_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGQSGYEFCVWAPHASEVRVVGDFNSWSGERHVMHRVSDNGIWALFIPGLREEERYKYEIVTHSGEIKLKADPYAIYSEVRPDTASLTYDLGEYNWKDQKWQKKQKTRTMYEKPVFIYELHLGSWKKHSDGRHYSYKELSQSLIPYIKEHGFTHIELLPIYEHPYDRSWGYQGTGYYSPTSRFGTPYDLMKFVDECHQENIGVILDWVPGHFCKDAHGLYMFDGEPLYEYQEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEIYHIDGFRVDAVANILYWTNQDERHTNPYAVQFLKKLNQTMREAHPHVMMIAEDSTDWPQVTGAVEEGGLGFHFKWNMGWMNDVLTYMETPPEERRYCHQFISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTAHPGKKLIFMGSEFAQFDEWKDTEQLDWFLNSFPMHQKASVYTQDLLRFYQKSKILYEHDHRAKSFEWIDVHNDEQSIFSFLRYGKRHGEALVIICNFTPEVYHHYDVGVPFLTQYIEVLNSDSETYGGSGQINQKPLTAKKGALHQKPCFITMTIPPYGISILRAVKKRGEIKR
>NZ_CP048852.1|WP_167873178.1|2970364_2971507_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSGVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDFHIKKKADVTISVIEVGWEEASRFGIMKTDADGTITHFDEKPKCPKSNLASMGIYIFNWPLLKQSLEMDGRNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERNWKIYSVNPNQPPQFISSDAQVHESLVNEGCAVYGNVSHSVLFQGVTVGKHATVTSSVIMPDVTVGEHVVIENAIVPKGLVLPDGAVIRSEKDIQEVLLVSEEFVEKELI
>NZ_CP048852.1|WP_167873177.1|2969309_2970341_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLAAQRSLGAIPFAGRYRLIDFMLSNMVNADIKSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPRLHQEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQPLQIYIMSTALLKDLIYGHSEKGYKTIQEAVEKESSSLTVCPYEYSGYVAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGNATEAAGTAEQPLVLRKGLVQGELMNS
>NZ_CP048852.1|WP_167873176.1|2967858_2969313_-|glycogen-synthase-GlgA
MKVLFAVSECTPFVKSGGLADVAGALPKALVRLGNEVAVMLPKYSQIPERWKKRMKKTAECTVAVGWRQQYCGIEHMAEDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAEAVNVQADIIHTHDWHTAMVNYLLKEEYKTLPFYERMKCVLTIHNLQFQGIFPPDVTHDLLGLGMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEILTPYYGEQLERVLQYRENDVTGILNGIDDTFYQPKSDPYIEVHYDSEHLAFKEENKRKLQRRLGLPERNDIPLISMVTRLTKQKGLDLVRRMMHELLEEQDIQLVVLGTGEREFEDYFRYAEFAFYEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGTIPIVRETGGLYDTVRSYQEEEGTGNGFTFSAFNAHDLKFTIERALLFYRQKDVWKSIMKTAMNADYSWEQSAKEYQRIFEHVTRSGRDVLE
>NZ_CP048852.1|WP_167873175.1|2965475_2967872_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFAALFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIQTNEKSRSNAGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEVGINLGEILQIESDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNENVWEVRNADQSVDVPFWGEVHLTEKNGRLHVRHEQATIVTAVPYDIPIIGFETGTVNTLRLWNAEPYTHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTNRSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMTWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRMVWEKHPGDWKRIENMAITAHGVIKMAHLAIVGSYSVNGVAKIHSDLLKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGNQWVKQPESLIGLEPYASDPAFIEQFQNNKSRKKQELADLIFCTAGVVVNPDSIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDGGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAKKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADDVLSYQENGGYRSREYYQHDRRIRQAADQLINGFFEGETDEFEAIYDSLLPHNDEYFVLKDFSSYAEAQERIQADYCDRRKWSERSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>NZ_CP048852.1|WP_167873174.1|2964977_2965445_+|TspO/MBR-family-protein
MKKIAGAIAVFVITYALFSAAGCLFPIDQEWYNSLKKPDWTPSGSAIGIIWAILFALISLSAAIVYAAFSFKDAKSFWFVLLINYVLNQAFSYFQFTQKNLLAASIDCLLVAITALVLMIVSKKYSKAASYLLLPYVLWSAFATFLSFTIESMNL
>NZ_CP048852.1|WP_167873173.1|2963818_2964892_+|CotS-family-spore-coat-protein
MCPLMAENQEVIEEGNSSELPLSAEDERKLTELAENVLQGWDIQVEKIDVIQGNQMALVWKIHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGIRPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVQSDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMDTWKLMAQMENEDPFSQLYLQEIDSFIEEGLRIKDRLLQSSYVPWTEQLKKSPNLCHQDYGTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFHVMLNAYESRAPLTDEQKQVMFIDMLFPYELYDVIREKYVRKSALSKEELESAFEYERIKANALQQLI
>NZ_CP048852.1|WP_167873172.1|2962495_2963629_-|spore-coat-protein-CotSA
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADRETADGVHYVHLDEKRYEEAVGEELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFVLSVHNEMFAYDKISQAEGEVCINSVAQIVTVSDYIGRTITSRFPSAQSKTKTVYSGVDLKAYHPRWTKEGQRAREEMRSELDFHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKEHVTFIQFVKPKDIPRLYSMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAEHINDLLSSSEKRERLGKYSRRVAESQFGWQRVADNLLSVYEKNR
>NZ_CP048852.1|WP_167873171.1|2961425_2962481_-|spore-coat-protein-CotS
MYQKEHEEQIVSDILSYYPFQIEHVALKSNKSGRKIWEIQTDQGPKLLKEAQMKAERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDRVSYSLYDKVTGKEMIYYDAEQMKKVLSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKKALQALDESEYENWTKEALEHGGFCFQDFTLARLTEIDGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVALLAAYDKVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDVFLDKLPELYKKIKAYREAN
>NZ_CP048852.1|WP_167873170.1|2960872_2961424_-|hypothetical-protein
MRSSRQKSSISKLDLDQFVFTPPGSMGWQAHDSISAEKEEEEMHLAAGSIRELPYINAPNEYQEEKKEKETDREVTDDEATKFETVREPEEERASKRSAPPVEEEEEKEKETDREVTDDEATKFETVREPEEERASKRSAPPVEEEEEEEEPEQMEDDRVEIIILPSDSAPAPWVSNAVKRKA
>NZ_CP048852.1|WP_167873180.1|2981096_2981675_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFPQHPIQLLLDYIIAFSAIGVSGCFASSVRKAAESKTKGKLIASVIGAVFIGSFLRYTAHVISGAVFFGSYAPEGTPVWIYSLTYNATYMVPSFIICAIVLCLLFLTAPRLLKTDKT
>NZ_CP048852.1|WP_167873181.1|2981714_2982236_-|GNAT-family-N-acetyltransferase
MVAVREAKVEDIKDIAKVHVDSWRTTYREMIPADYLNSLNYKDFEDKWKRRSLKGVFVAQDEKGSIFGFASFGPIRSEQEGYDGELYAIYLLEECQRQGAGRALLIKGAEFLLHHGFSSMFVWVIEQNPSIIFYQSYSPERVAEDSIDIGGVRIKEVGLGWPDLSALKTVLKR
>NZ_CP048852.1|WP_167873182.1|2982260_2983790_-|flotillin-lipid-rafts-scaffold-protein-FloT
MTMPIIIVIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRLKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEAAKDAKKSELERATEIAEAEKINQLKMAEYRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAQAEAEKVRIDGLANAEAEKAKGETEAEVIRLKGLAEAEAKEKIANAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMMENFSGKGNVKQSINELTNEIKEAKAAPKSE
>NZ_CP048852.1|WP_167873183.1|2983808_2984333_-|hypothetical-protein
MELLGVPIQTIYLYVLIIAGSLTLLFLFFGDVFAGLSEGIPFLNPTLVLAFFTCCSAGGYIGELVLPLSSLLIALFSCILSIMLVVLLHLFVLVPLSSAEESLAYKEDDLRGRVGKVITAVPVDGFGEVVIEGIGGTISKSAISFENQQIGYGTRVLVVDVKNGVLSVIPHEPI
>NZ_CP048852.1|WP_024713040.1|2984501_2984990_+|DinB-family-protein
MSIFNEARLETWNEIKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQQMLKERVKEAPIKEIEEKSLEAAQNRNNKRKAPSHLEPAHDFISSSQMKRELDVVREQLTAVIASLKEEDFERVLPHPVFQELTVKQWIDFIGHHEKRHLSQIKEIKEKVERA
>NZ_CP048852.1|WP_024713039.1|2984995_2985574_-|MOSC-domain-containing-protein
MWKRMSAKTEGLYIADTESFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSAEECDEMALKMGVPSIFPEWLGANVAVSGIPDFTSLKEGSRLIFPSGAALLCEGENDPCIQPGEVIQSYYPDKPKLAPAFVRHALGMRGIVCIVERPGAVYAGDEVEVYSYQRKVKRKAERV
>NZ_CP048852.1|WP_167873893.1|2985660_2986869_-|choline-dehydrogenase
MTLNMKVESMHKFHTFEIPTVIKHGIGAVKHMGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFHKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEAREFKFNTGGPLIAAHLTIIDPELHISMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYHWIYKRCFNLIPKTV
>NZ_CP048852.1|WP_167873184.1|2986885_2988358_-|betaine-aldehyde-dehydrogenase
MSQTLYIDGEWISAEKGQIRTIINPFNQEEIAAVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGNIVLKIAELIRRDLDELAELESLDTGKTLEESKADMNDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNKDVDLISFTGGIETGKSIMRAASGNVKKIALELGGKNPNIVFRDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEEAVHDQFLAELVKRTKRIKLGNGFHAETESGPLISAEHRAKIEKYVEIGIEEGAKLETGGKRPEDPELQNGFFYEPTIFSNCKSDMRIVQEEIFGPVLTVETFSSEEEVIALANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>NZ_CP048852.1|WP_024713036.1|2988556_2989099_+|GbsR/MarR-family-transcriptional-regulator
MDESPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQDVLNKEGLNEDIKNEALQLFEQLESSKAYYDWLKRLADAVQSGEIFKFIPIETK
>NZ_CP048852.1|WP_024713035.1|2989305_2989851_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTATKAHTESTMKTQATASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTMNGHALRTTQILNNGKTVRIPLALDLLGAGEFKLRLNNKTLPAAGTYTFRAENRSLSVGDRFYAEASIDVAKRSTPPTQPCDSK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP048852_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP048852_3

3535639-3535852

Orphan

Consensus_repeat	Method
GACGATTGATAACCTGAAGACCCCGGTGATCGTTTAGATGATTTTGATGAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP048852_3

>merge|NZ_CP048852|3|3535639-3535852|CRISPRCasFinder
GATGATTGGTAATCTGAAGACCTCGGTGATCGTTTAGATGATTTTGATGAACTTTTTGAACCTGATGAATGGTCGGATTTTGATGATTGGTAATCTGAAGACCTCAGTGATCGTTTAGATGATTTTGATGAACTTTTTGAACCTGATGAATGGTGGGATTTCGACGATTGATAACCTGAAGACCCCGGTGATCGTTTAGATGATTTTGATGAAC

>NZ_CP048852|3|3|3535639-3535852|CRISPRCasFinder
GATGATTGGTAATCTGAAGACCTCGGTGATCGTTTAGATGATTTTGATGAAC	TTTTTGAACCTGATGAATGGTCGGATTTTGATGATTGGTAATCTGAAGACCTCAGTGATCGTTTAGATGATTTTGATGAACTTTTTGAACCTGATGAATGGTGGGATTTC
GACGATTGATAACCTGAAGACCCCGGTGATCGTTTAGATGATTTTGATGAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP048852.1\|WP_167873484.1\|3526914_3527832_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	unknown	unknown	gnl\|CDD\|380546
NZ_CP048852.1\|WP_024713724.1\|3538087_3538702_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_024713729.1\|3542687_3543224_+\|chromate-resistance-efflux-protein-ChrA	unknown	unknown	gnl\|CDD\|224970
NZ_CP048852.1\|WP_167873485.1\|3527939_3528476_+\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|214600
NZ_CP048852.1\|WP_167873919.1\|3533415_3534732_+\|arsenic-transporter	unknown	unknown	gnl\|CDD\|238538
NZ_CP048852.1\|WP_024713723.1\|3536855_3537944_-\|spore-coat-protein-CotH	unknown	unknown	gnl\|CDD\|227642
NZ_CP048852.1\|WP_167873493.1\|3544136_3545018_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP048852.1\|WP_167873486.1\|3528630_3528927_+\|DUF3892-domain-containing-protein	unknown	unknown	gnl\|CDD\|379026
NZ_CP048852.1\|WP_167873492.1\|3543468_3544014_-\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|223728
NZ_CP048852.1\|WP_024714269.1\|3528968_3529496_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225158
NZ_CP048852.1\|WP_024713727.1\|3541607_3542084_+\|chromate-efflux-transcriptional-regulator-ChrS	unknown	unknown	gnl\|CDD\|214628
NZ_CP048852.1\|WP_167873490.1\|3539816_3541394_-\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|129176
NZ_CP048852.1\|WP_024714274.1\|3534782_3535460_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_167873488.1\|3532293_3533202_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176143
NZ_CP048852.1\|WP_167873491.1\|3543250_3543472_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP048852.1\|WP_024713725.1\|3538874_3539492_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP048852.1\|WP_167873483.1\|3525936_3526902_+\|ribose-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|181922
NZ_CP048852.1\|WP_167873487.1\|3529591_3530359_-\|acetolactate-decarboxylase	unknown	unknown	gnl\|CDD\|273524
NZ_CP048852.1\|WP_024714271.1\|3530422_3532135_-\|acetolactate-synthase-AlsS	unknown	unknown	gnl\|CDD\|236312
NZ_CP048852.1\|WP_024713728.1\|3542097_3542691_+\|chromate-efflux-transporter-subunit-ChrB	unknown	unknown	gnl\|CDD\|224970

Protein	Function_ID	Function_description	E-value
NZ_CP048852.1\|WP_167873484.1\|3526914_3527832_+\|ribose-ABC-transporter-substrate-binding-protein-RbsB	gnl\|CDD\|380546	cd06323, PBP1_ribose_binding, periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs. Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis D-ribose binding protein (ttRBP) and its mesophilic homologs. Members of this group belong to the type 1 periplasmic binding protein superfamily, whose members are involved in chemotaxis, ATP-binding cassette transport, and intercellular communication in central nervous system. The thermophilic and mesophilic ribose-binding proteins are structurally very similar, but differ substantially in thermal stability.	7.18775e-134
NZ_CP048852.1\|WP_024713725.1\|3538874_3539492_+\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	1.29089e-42
NZ_CP048852.1\|WP_024713729.1\|3542687_3543224_+\|chromate-resistance-efflux-protein-ChrA	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	4.88542e-48
NZ_CP048852.1\|WP_167873485.1\|3527939_3528476_+\|SH3-domain-containing-protein	gnl\|CDD\|214600	smart00287, SH3b, Bacterial SH3 domain homologues.	6.91526e-11
NZ_CP048852.1\|WP_167873919.1\|3533415_3534732_+\|arsenic-transporter	gnl\|CDD\|238538	cd01118, ArsB_permease, Anion permease ArsB. These permeases have been shown to export arsenate and antimonite in eubacteria and archaea. A typical ArsB permease contains 8-13 transmembrane helices and can function either independently as a chemiosmotic transporter or as a channel-forming subunit of an ATP-driven anion pump (ArsAB). The ArsAB complex is similar in many ways to ATP-binding cassette transporters, which have two groups of six transmembrane-spanning helical segments and two nucleotide-binding domains. The ArsB proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium, arsenate, sulfate, and organic anions across biological membranes in all three kingdoms of life.	1.01296e-106
NZ_CP048852.1\|WP_024713723.1\|3536855_3537944_-\|spore-coat-protein-CotH	gnl\|CDD\|227642	COG5337, CotH, Spore coat assembly protein [Cell envelope biogenesis, outer membrane].	3.1233e-177
NZ_CP048852.1\|WP_167873493.1\|3544136_3545018_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	7.92503e-67
NZ_CP048852.1\|WP_167873486.1\|3528630_3528927_+\|DUF3892-domain-containing-protein	gnl\|CDD\|379026	pfam13031, DUF3892, Protein of unknown function (DUF3892). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 87 and 104 amino acids in length.	4.53223e-14
NZ_CP048852.1\|WP_167873492.1\|3543468_3544014_-\|flavodoxin-family-protein	gnl\|CDD\|223728	COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only].	2.37113e-34
NZ_CP048852.1\|WP_024714269.1\|3528968_3529496_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|225158	COG2249, MdaB, Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only].	9.81799e-56
NZ_CP048852.1\|WP_024713727.1\|3541607_3542084_+\|chromate-efflux-transcriptional-regulator-ChrS	gnl\|CDD\|214628	smart00344, HTH_ASNC, helix_turn_helix ASNC type. AsnC: an autogenously regulated activator of asparagine synthetase A transcription in Escherichia coli).	1.04957e-37
NZ_CP048852.1\|WP_167873490.1\|3539816_3541394_-\|gamma-glutamyltransferase	gnl\|CDD\|129176	TIGR00066, Contains:_Gamma-glutamyltranspeptidase_large_chain, gamma-glutamyltranspeptidase. Also called gamma-glutamyltranspeptidase (ggt). Some members of this family have antibiotic synthesis or resistance activities. In the case of a cephalosporin acylase from Pseudomonas sp., the enzyme was shown to retain some gamma-glutamyltranspeptidase activity. Other, more distantly related proteins have ggt-related activities and score below the trusted cutoff. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs].	0
NZ_CP048852.1\|WP_024713728.1\|3542097_3542691_+\|chromate-efflux-transporter-subunit-ChrB	gnl\|CDD\|224970	COG2059, ChrA, Chromate transport protein ChrA [Inorganic ion transport and metabolism].	2.98042e-54
NZ_CP048852.1\|WP_167873488.1\|3532293_3533202_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176143	cd08452, PBP2_AlsR, The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate. Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.90154e-124
NZ_CP048852.1\|WP_167873483.1\|3525936_3526902_+\|ribose-ABC-transporter-permease	gnl\|CDD\|181922	PRK09512, rbsC, ribose ABC transporter permease protein; Reviewed.	1.17316e-117
NZ_CP048852.1\|WP_167873487.1\|3529591_3530359_-\|acetolactate-decarboxylase	gnl\|CDD\|273524	TIGR01252, Alpha-acetolactate_decarboxylase, alpha-acetolactate decarboxylase. Puruvate can be fermented to 2,3-butanediol. It is first converted to alpha-acetolactate by alpha-acetolactate synthase, then decarboxylated to acetoin by this enzyme. Acetoin can be reduced in some species to 2,3-butanediol by acetoin reductase. [Energy metabolism, Fermentation].	1.01148e-133
NZ_CP048852.1\|WP_024714271.1\|3530422_3532135_-\|acetolactate-synthase-AlsS	gnl\|CDD\|236312	PRK08617, PRK08617, acetolactate synthase AlsS.	0

>NZ_CP048852.1|WP_024714274.1|3534782_3535460_-|hypothetical-protein
MKGLNQFLDTDVEVVISGDTRFVGTLKDIGQDIFVICDGCHYLYIPLMHLHQMNKAVINMTSEKSFLRDLEDPVIQEENNAFSYRNSLNKMKGKFIEVYVTGGRSIHGYVTSVLNDYIVFFSPVFKTLFISMNHLKWFTPYSTEQTPYTLDNSQLPVVPSNVSLVRNFEEQIKKYIGKLVIFDMGEVPEKVGLLKDVSHNIIELISATGESIIWKLSHLKTMHLP
>NZ_CP048852.1|WP_167873919.1|3533415_3534732_+|arsenic-transporter
MLAFFATMIFIFWRPKGLNEAIPATLGALIVFLCGSVSLADLGEIGTKITGASVTILATMTMAIALESFGFFYWVATKLLQQSKGSGIKLFWLTNLLCFLMTIFLNNDGSVLITTPILLLVLKYLGLKRHQKTPYLLSGVLIATASSTPIGVSNIVNLISLKMIGMDLYLHTAMMFVPSMIGLIFMACLLFMFFYKRLPKSLPDIPDHFQAQLYRHHSPSAPLPERNQTKMMLCVLAFVFLVRISLFAASYTGISVPLVAAIGSFILLSWRWIYYKTSPRDLLYKTPWHIFIFAFTMYVLIYGLHNIGFTELLVNLFEPVVSGSLALATFISGISTSVFSNLFNNHPALMISTFTLTEMSLNPSTAKIIYLANIIGSDIGSLLLPIGTLATLIWMHILKQHDERISWGEYLKTTVLIIPLTVLFTLTCLYVWISWLFV
>NZ_CP048852.1|WP_167873488.1|3532293_3533202_+|LysR-family-transcriptional-regulator
MELRHLQYFIVVAEELHFGRAARRLNMTQPPLSQQIKQLEEEIGVTLLKRTKRMVELTAAGEIFLNHCRTALMQIDQAIELAQRTARGEHGHLVIGFVGSATYEFLPPIVREYRKKFPSVKIELREISSFRQQDELLKGNIDIGILHPPLQHTALHTEIAQSSPCILALPKQHPLTSKESITIEDLRDQPIITVSKEAWPTLYLDFIQLCEQAGFKPNIVQEATEYQMVIGLVSAGIGITFVPSSAKKLFNLDVTYRTMDQIQLNAEWVIAYRKDNCNPLLKQFIHISNCNQSRSKERNAGT
>NZ_CP048852.1|WP_024714271.1|3530422_3532135_-|acetolactate-synthase-AlsS
MTKATKEQKSLVKSKGAELVVDCLVEQGVTHVFGIPGAKIDAVFDVLQDKGPEIIVARHEQNAAFMAQAVGRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFKPITKYSVEVQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNELTNTNNVRAVAAPKLGPAADDTISAAIAKIQTAKLPVVLVGMKGGRPEAIKAVRKLLKKIQLPFVETYQAAGTLTRDLEDQYFGRIGLFRNQPGDLLLEQADVVLTIGYDPIEYDPKFWNVNGDRTIIHLDEILADIDHAYQPELELIGDIPATINHIEHDAVKVNLGEREQKILSDLKQYMHEGEQVPADWKSDRVHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISNGMQTLGVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTYDMVAFQQLKKYNRTSAVDFGNIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVIIDVPVDYSDNMNLASDKLPKEFGELMKTKAL
>NZ_CP048852.1|WP_167873487.1|3529591_3530359_-|acetolactate-decarboxylase
MKHQSNMQVLSRGQNDQPVSQIYQVSTMTSLLDGVYDGDFELSEIPKYGDFGIGTFNKLDGELIGFDGEFYRLRSDGTATPVQNGDRSPFCSFTFFKPDITHKIDAKTSREEFENEINSILPSKNLFYAIRIDGLFKKVQTRTVELQEKPYVPMVEAVKTQPIFNFDNVRGTIVGFLTPAYANGIAVSGYHLHFIDEGRNSGGHVFDYVLEDCTVTISQKMNMNLRLPNTEDFFNANLDNPDFAKDIETTEGSPE
>NZ_CP048852.1|WP_024714269.1|3528968_3529496_-|NAD(P)H-dependent-oxidoreductase
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCELYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVKYAAQEDISLSAKRLAEYIQKPFA
>NZ_CP048852.1|WP_167873486.1|3528630_3528927_+|DUF3892-domain-containing-protein
MDQFEAAYQSYKAQQTSAKHSDIRTGQEEIIAVRRNEEDNIIAVKTNTGRELHYPAALSEAKAGKLSHVDVFHKYGRDILRSEPDGIKENNLSELPDF
>NZ_CP048852.1|WP_167873485.1|3527939_3528476_+|SH3-domain-containing-protein
MNKPTKVLSALALAAGITAASVGGASTIHAQQPNTTVSIDDLYSYPIDSYLVSAEALNVRTKASASSQKADTLHLGDSLKLISFANADWAKVHYKNGKTGFVSTHYIVKAATTIKTKTKTKVYTSAEGKGIKTLPADTSVSFLGWSKTKKGGFDFDWVFVDYGGATGYMKTKDLHMTK
>NZ_CP048852.1|WP_167873484.1|3526914_3527832_+|ribose-ABC-transporter-substrate-binding-protein-RbsB
MKKAAAVILTLSLFLLTACSLEPPQWAKPSNSGNKKEFTIGLSVSTLNNPFFVSLKKGIEKEAEKRGMKVIIVDAQNDSSKQTSDAEDLIQQGVDALLINPTDSSAISTAVESANAVGVPVVTIDRSAEQGKVETLVASDNVKGGEMAAAFIADKLGKGAKVAELEGVPGASATRERGSGFHHIADQKLDVVTKQSADFDRTKGLTVMENLLQGHPDIQAVFAHNDEMALGALEAIYSSGKEILVIGFDGNQDALASIKNGKLSATVAQQPELIGKLATEAADDILHGKKVKKSISAPLKLEIQK
>NZ_CP048852.1|WP_167873483.1|3525936_3526902_+|ribose-ABC-transporter-permease
MKAEHQQEQKRIHFDGVMQKLGPFLGLFILVIIVSILNPSFLEPLNILNLLRQVAINGLIAFGMTFVILTGGIDLSVGAILALSSALVAGMIVSGVDPILAIILGCIIGAALGMINGLLITKGKMAPFIATLATMTVFRGLTLVYTDGNPITGLGTNYAFQLFGRGYFLGIPVPAITMVLAFAFLWALLHKTPFGRRTYAIGGNEKAALISGIKVTRVKVMIYSLAGLLSALAGAILTSRLHSAQPTAGESYELDAIAAVVLGGTSLSGGRGRIIGTLIGVLIIGTLNNGLNLLGVSSFYQLVVKGIVILIAVLLDRKKSA
>NZ_CP048852.1|WP_024713723.1|3536855_3537944_-|spore-coat-protein-CotH
MKNQSRLPLYQLFVHPKDLRELKKDIWDDDPVPAVMKVNQKRLDIDIAYRGSHIRDFKKKSYHISFYQPKTFRGAREIHLNAEYKDPSMMRNKLSLDFFSELGTLSPQAEFVFLKVNGKNEGVYLELESVDEYYLAKRKLADGAVFYAVDDDANFSLMSDLERETKTSLELGYEKKTGTKEDDFYLQDMIFKINTVPKAQFKSEVTKHVDVDKYLRWLAGIVFTSNYDGFVHNYALYRSSETGLFEVLPWDYDATWGRDIHGERMAADYVRIQGFNTLTARILDEPEFRKSYKRLLEKTLQSLFTIEYLKPKIMAMYEQIRPFVLMDPYKKNDIERFDREPAVICEYIKNRSQYLKNHLNIL
>NZ_CP048852.1|WP_024713724.1|3538087_3538702_+|hypothetical-protein
MGHYSHIDIEEAVKSAKKEGLKDYLYQEPHGKERSHKKSHRSHKKSRSQKKSYSSHKKSRSHKKSYSSHKKSRSHKKSYSSHKKSRSYKKSYSSHKKSRSHKKSYSSHKKSRSYKKSYRSHKKKSRSYKKSYCSHKKKSRSYKKSYCSYKKKSRSYKKSYRTHKTSYRPDKKKSHHDYYKQDDYHSKKEFWKDGNCWVVKKKYK
>NZ_CP048852.1|WP_024713725.1|3538874_3539492_+|flavin-reductase-family-protein
MYIFQADQLSSKDTYKLLSGAVIPRPIAFVTTLSSSGAVNAAPFSFYNVVSSDPPLLSVSVNRTEGRQKDTARNTVENGEFVVHVSDESIIEDINETAASLEPEESELIRTSLHPVESKSVSVPGIKEARIRFECTLERHITFDNDQGVTTADLLIGRVVCFHLDEKVYDAEKGYVLTDELQAVSRLAGNHYAKLGEEFTLIRPS
>NZ_CP048852.1|WP_167873490.1|3539816_3541394_-|gamma-glutamyltransferase
MNKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLAFHQESNAVRVYNGSGRSGKNVTRDVYKGKSAIPLRGIDSAITVPGMVDSWDAVLKEYGRMSLADVLEPARDYAQNGFPVSADQCRHTEMNLELLASTPYTADIFTRSGKAPVPGERFVQKELAECLIMIAEKGRSAFYEGDIAQRIVSYLQHNGSHMTLDDFKAHRGEWMEPVLSDYRGYSVYQAPPNSQGFTGLLTLNILENYHFNQIEHGSFEYYHVLVEALKKSFLDRNAVLTDPAFADIPLERLLDKKYAKQLAEDIGYLAKPAESRPVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDQDHVNTLEPKKRTFHTLMPAMVCKDGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGEEYEGLRVEGRFSEEIIEKLKDSGHLVEIVGDYDPLMGHAAAIKVDDEGFLQGGADPRGDGAAVGI
>NZ_CP048852.1|WP_024713727.1|3541607_3542084_+|chromate-efflux-transcriptional-regulator-ChrS
MSHDYQIPNLVLDEIDKQILSILHEEGRISYTDLGKRVDLSRVAVQARINQLIEAGVIEKFTAVINPAKIGIHVSVFFNVEVEPQFLEEVALKLEEEPAVTSLYHMTGPSKLHMHGIFANDQEMEEFLTKRLYPLQGVVSVDCQMLIKRYKSRMGMKL
>NZ_CP048852.1|WP_024713728.1|3542097_3542691_+|chromate-efflux-transporter-subunit-ChrB
MKNHPYRDMTAAMVRTGILGFGGGPSVIPLIRHEAVNKYKWIDDDEFGEILAIANALPGPIATKMAAYLGFKLKGTLGAIVATLAHILPTCLAMVGLFAAVNVLSHSAVVAGMIGAVTPVIAVMLGIMAYEFGQKALKGFGWVTGILFFIIAFIGLQTLQINPGLVIIIFLAYGAFHFKLKDKITNKQSKDKGMSAS
>NZ_CP048852.1|WP_024713729.1|3542687_3543224_+|chromate-resistance-efflux-protein-ChrA
MIMIYLFMAFFIANVLGYGGGPASIPLMFEEVVNRYSWLSNDQFSNMLALANALPGPIATKIAAYVGYSAGGWPGFLIALIATIVPSALALIVLLRIIQRFRQSPIIKGMTLSVQPVIAVMMLILTWQIGADGIKAIGWIQSIVIAGIALLAMTKFKMHPAFLIIAAFLYGGLVIPHL
>NZ_CP048852.1|WP_167873491.1|3543250_3543472_-|hypothetical-protein
MKCLLSVLAGMLILAFFLFWKVQPPVWIHVETNSRQVQQSVRMAGTTLQVKQIIKRDAGEETVVISNGISGPK
>NZ_CP048852.1|WP_167873492.1|3543468_3544014_-|flavodoxin-family-protein
MKIAVINGGTRSGGNTDTLAEKAVQGFDAEHIYLRKYRIQPIEDLRHAHGGFRPVQDDYDSIIERILPCDILVFATPIYWFGMSGPLKLFIDRWSQTLRDPRFPDFKQQMSAKQAYVTAVGGDNPKIKGLPMIQQFEHIFDFIGMPFKGYVLGEGNRPGDILHDHQALSAAGCLLKRSDAI
>NZ_CP048852.1|WP_167873493.1|3544136_3545018_+|LysR-family-transcriptional-regulator
MEMKQLITFITAAEHVNFTLTAKMLNYAQSSVTSQIKSLEEEIGTPLFERLGKRLILTEAGKTFKSYAEKIIALTEEAKMAANQVKETTGTLKIGATESQCTYRLPPIIKEFKQTFPQVKLIFKPYISNEQAKEQLLQGQLDITFILDVNRTEDALHVESLIQDEIKMVAANDHPFPADSPATLKDLQNETLLLTEDGCSYRTLFENTLHDAGVYPNKLEFVSIEAIKQCVMAGLGIGLLPEMTVKDDIAEGRMKELNWQSDCPVFTQLAWHKDKWMSAPLKAFIDLTRKTLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP048852_1	1.1\|1699397\|27\|NZ_CP048852\|CRISPRCasFinder	1699397-1699423	27	NZ_CP048852.1	1699328-1699354	0	1.0

1. spacer 1.1|1699397|27|NZ_CP048852|CRISPRCasFinder matches to position: 1699328-1699354, mismatch: 0, identity: 1.0

ccgaatggccggccgaaaccaaatcca	CRISPR spacer
ccgaatggccggccgaaaccaaatcca	Protospacer
***************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP048852_2	2.1\|2974029\|60\|NZ_CP048852\|CRISPRCasFinder	2974029-2974088	60	NZ_CP015439	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence	255887-255946	7	0.883
NZ_CP048852_2	2.1\|2974029\|60\|NZ_CP048852\|CRISPRCasFinder	2974029-2974088	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	10	0.833
NZ_CP048852_2	2.1\|2974029\|60\|NZ_CP048852\|CRISPRCasFinder	2974029-2974088	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	10	0.833
NZ_CP048852_2	2.1\|2974029\|60\|NZ_CP048852\|CRISPRCasFinder	2974029-2974088	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	11	0.817
NZ_CP048852_2	2.1\|2974029\|60\|NZ_CP048852\|CRISPRCasFinder	2974029-2974088	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	13	0.783

1. spacer 2.1|2974029|60|NZ_CP048852|CRISPRCasFinder matches to NZ_CP015439 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaattattatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgca--tattatatacgacggt	Protospacer
******************************************  ****** *. *.**.*

2. spacer 2.1|2974029|60|NZ_CP048852|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.833

cagcttggaaggctgaggttttaccactaaactacacccgca--attattatttggggcg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
******************************************  .***  * **  * *.

3. spacer 2.1|2974029|60|NZ_CP048852|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 10, identity: 0.833

cagcttggaaggctgaggttttaccactaaactacacccgcaattattatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgc-ataataatatataccatt	Protospacer
***************************************** ** ** ** *. . *. *

4. spacer 2.1|2974029|60|NZ_CP048852|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 11, identity: 0.817

cagcttggaaggctgaggttttaccactaaactacacccgc-----aattattatttggg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
*****************************************     *.**** ....***

5. spacer 2.1|2974029|60|NZ_CP048852|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc-----aattattatttggg	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************     ** ** * .**.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

664499 : 672883

Synechococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167871783.1\|664499_665795_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.7e-18	33.5
WP_167871784.1\|665869_666595_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	3.5e-45	43.2
WP_024715848.1\|666587_666842_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_024715847.1\|666838_667522_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_167871785.1\|667505_669734_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-159	40.3
WP_167871786.1\|669709_671140_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	32.7
WP_167871787.1\|671240_672281_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.4e-65	42.0
WP_024715843.1\|672277_672883_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.2e-27	39.9

DBSCAN-SWA_2

1144430 : 1178458

Planktothrix_phage(20.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167872094.1\|1144430_1145423_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_024714109.1\|1146166_1147807_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_167872095.1\|1147901_1148837_+	oligopeptide ABC transporter permease OppB	NA	NA	NA	NA
WP_024714111.1\|1148840_1149758_+	oligopeptide ABC transporter permease OppC	NA	NA	NA	NA
WP_081719799.1\|1149762_1150839_+	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	3.5e-17	30.4
WP_024714113.1\|1150840_1151758_+	oligopeptide ABC transporter ATP-binding protein OppF	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
WP_167873833.1\|1151863_1153081_+	MFS transporter	NA	NA	NA	NA
WP_024714115.1\|1153254_1153833_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003224599.1\|1154013_1154409_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_167872096.1\|1154567_1155227_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	2.9e-30	38.0
WP_141770187.1\|1155395_1155536_+	hypothetical protein	NA	NA	NA	NA
WP_167872097.1\|1155502_1156159_+	adaptor protein MecA	NA	NA	NA	NA
WP_167872098.1\|1156316_1157468_+	competence protein CoiA	NA	NA	NA	NA
WP_167872099.1\|1157696_1159526_+	oligoendopeptidase F	NA	NA	NA	NA
WP_019713977.1\|1159564_1159732_-	hypothetical protein	NA	NA	NA	NA
WP_024714120.1\|1160045_1160945_-	adaptor protein SpxH	NA	NA	NA	NA
WP_003224612.1\|1160941_1161340_-	group 2 truncated hemoglobin YjbI	NA	NA	NA	NA
WP_167873834.1\|1161594_1162140_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	2.5e-40	72.0
WP_167872100.1\|1162343_1162916_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_167872101.1\|1163039_1163408_+	hypothetical protein	NA	NA	NA	NA
WP_024714124.1\|1163436_1164072_+	GTP diphosphokinase	NA	NA	NA	NA
WP_024714125.1\|1164090_1164891_+	NAD kinase	NA	NA	NA	NA
WP_024714126.1\|1164905_1165805_+	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_167872102.1\|1165817_1166552_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	S4TNS0	Salmonella_phage	3.8e-07	21.4
WP_167872103.1\|1166784_1168629_+	sodium:proton antiporter	NA	NA	NA	NA
WP_024714129.1\|1168878_1169592_+	thiaminase II	NA	NA	NA	NA
WP_167872104.1\|1169566_1170184_+	thiazole tautomerase TenI	NA	NA	NA	NA
WP_167872105.1\|1170167_1171277_+	glycine oxidase ThiO	NA	NA	NA	NA
WP_167873835.1\|1171276_1171477_+	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_167872106.1\|1171473_1172244_+	thiazole synthase	NA	NA	NA	NA
WP_167872107.1\|1172240_1173251_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
WP_167872108.1\|1173269_1174085_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_024714136.1\|1174221_1174998_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_167872109.1\|1175099_1175777_+\|coat	spore coat protein	NA	NA	NA	NA
WP_024714138.1\|1175869_1176319_-\|coat	spore coat protein CotZ	NA	NA	NA	NA
WP_024714139.1\|1176446_1176935_-\|coat	spore coat protein CotY	NA	NA	NA	NA
WP_167872110.1\|1177087_1177609_-\|coat	spore coat protein	NA	NA	NA	NA
WP_167872111.1\|1177703_1178030_-\|coat	spore coat protein	NA	NA	NA	NA
WP_167872112.1\|1178071_1178458_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_3

1200297 : 1264252

Bacillus_phage(30.77%)

portal,plate,tail,terminase,holin,tRNA,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024716442.1\|1200297_1200597_-\|coat	spore coat protein	NA	NA	NA	NA
WP_024716441.1\|1200615_1200810_-	hypothetical protein	NA	NA	NA	NA
WP_167872126.1\|1200827_1201964_-	glutathione-dependent formaldehyde dehydrogenase	E3SJ82	Synechococcus_phage	9.1e-16	28.2
WP_167872127.1\|1201982_1202351_-\|coat	spore coat protein	NA	NA	NA	NA
WP_167872128.1\|1202367_1202613_-	spore gernimation protein GerQ	NA	NA	NA	NA
WP_167871450.1\|1203049_1203223_-	hypothetical protein	NA	NA	NA	NA
WP_167872129.1\|1203381_1204545_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.0e-43	29.3
WP_024716435.1\|1204762_1205065_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_167872130.1\|1205282_1205681_-	hypothetical protein	NA	NA	NA	NA
WP_024716433.1\|1205870_1206353_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_167872131.1\|1206409_1206604_-	DUF4177 domain-containing protein	NA	NA	NA	NA
WP_167871451.1\|1207682_1207877_+	hypothetical protein	NA	NA	NA	NA
WP_167871594.1\|1207919_1209070_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	2.7e-39	61.9
WP_167872132.1\|1209186_1210176_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_167872133.1\|1210297_1210510_-\|coat	spore coat protein	NA	NA	NA	NA
WP_167872134.1\|1210759_1212160_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_167872135.1\|1212210_1212684_-	YjfA family protein	NA	NA	NA	NA
WP_032682202.1\|1212812_1212980_-	putative motility protein	NA	NA	NA	NA
WP_167872136.1\|1213105_1214005_+	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_024716425.1\|1214014_1214413_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_167872137.1\|1214513_1215086_-	YjgB family protein	NA	NA	NA	NA
WP_167872138.1\|1215234_1218192_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
WP_024716422.1\|1218184_1218745_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_024716421.1\|1218942_1219584_+	DUF4352 domain-containing protein	NA	NA	NA	NA
WP_167872139.1\|1219659_1220286_+	NUDIX hydrolase	NA	NA	NA	NA
WP_024716420.1\|1220318_1220597_-	hypothetical protein	NA	NA	NA	NA
WP_167872140.1\|1220988_1222185_+	cytochrome P450	NA	NA	NA	NA
WP_167872141.1\|1222204_1223383_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	6.1e-07	27.6
WP_003232781.1\|1223424_1223613_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.4e-21	77.6
WP_167872142.1\|1223779_1224592_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_167872143.1\|1224637_1225390_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_167872144.1\|1225389_1226142_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	7.6e-19	32.2
WP_167872145.1\|1226258_1227233_-	multidrug resistance efflux transporter family protein	NA	NA	NA	NA
WP_167872146.1\|1227363_1227861_+	cupin domain-containing protein	NA	NA	NA	NA
WP_024716413.1\|1228253_1228676_+	DUF1641 domain-containing protein	NA	NA	NA	NA
WP_167872147.1\|1228715_1229894_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_024716410.1\|1230405_1231170_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_024716409.1\|1231395_1231860_-	hypothetical protein	NA	NA	NA	NA
WP_167872148.1\|1232008_1233280_+	AAA family ATPase	A0A1V0SEI6	Indivirus	1.0e-15	38.6
WP_081719943.1\|1233424_1234561_+	response regulator aspartate phosphatase RapA	A0A1P8CWN8	Bacillus_phage	5.4e-93	46.8
WP_024716407.1\|1234550_1234688_+	PhrA family phosphatase inhibitor	NA	NA	NA	NA
WP_167872149.1\|1235085_1236039_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	3.1e-65	72.9
WP_167872150.1\|1236080_1236458_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.4e-16	44.4
WP_024716404.1\|1236564_1237167_+	poly-gamma-glutamate hydrolase family protein	A0A0Y0AJU6	Bacillus_phage	1.3e-42	47.8
WP_167872151.1\|1237948_1238545_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	1.6e-40	52.3
WP_003232719.1\|1238705_1239047_-	helix-turn-helix transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
WP_167872152.1\|1239224_1239404_+	hypothetical protein	NA	NA	NA	NA
WP_167872153.1\|1239390_1240227_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.4e-21	28.3
WP_167872154.1\|1240126_1240927_+	ATP-binding protein	A6XMI1	Bacillus_virus	7.7e-62	52.2
WP_032682200.1\|1240926_1241094_+	hypothetical protein	NA	NA	NA	NA
WP_167872155.1\|1241178_1241538_+\|portal	phage portal protein	NA	NA	NA	NA
WP_167872156.1\|1241524_1241731_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	4.2e-12	50.0
WP_024716395.1\|1241845_1242355_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	1.0e-22	40.4
WP_167872157.1\|1242472_1243270_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	8.0e-59	49.8
WP_167872158.1\|1243266_1244568_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.2e-154	60.5
WP_167873837.1\|1244571_1246059_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	1.3e-139	55.7
WP_167872159.1\|1246078_1246906_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
WP_024716390.1\|1246930_1247866_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.5e-104	63.8
WP_167872160.1\|1247887_1248271_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	3.7e-14	41.4
WP_167872161.1\|1248267_1248624_+	DUF3599 family protein	NA	NA	NA	NA
WP_167872162.1\|1248620_1249106_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	1.1e-37	45.6
WP_167872163.1\|1249118_1249559_+\|portal	phage portal protein	NA	NA	NA	NA
WP_167872164.1\|1249562_1249781_+	hypothetical protein	NA	NA	NA	NA
WP_167872165.1\|1249777_1251178_+\|tail	phage tail sheath protein	A0A0A7RTT5	Clostridium_phage	6.5e-80	39.8
WP_024716383.1\|1251179_1251623_+\|tail	phage tail tube protein	A0A0K2CNG3	Brevibacillus_phage	8.4e-26	45.2
WP_003232676.1\|1251716_1252163_+	phage-like element PBSX protein XkdN	A0A249XXA9	Clostridium_phage	7.5e-14	33.6
WP_081719940.1\|1252192_1252342_+	hypothetical protein	NA	NA	NA	NA
WP_167873838.1\|1252343_1256348_+	transglycosylase SLT domain-containing protein	A0A1L2JY60	Aeribacillus_phage	9.6e-44	45.3
WP_167872166.1\|1256340_1257000_+	LysM peptidoglycan-binding domain-containing protein	A0A090DBR9	Clostridium_phage	8.1e-25	34.0
WP_167873839.1\|1257015_1257993_+\|portal	phage portal protein	H7BV96	unidentified_phage	3.9e-39	33.1
WP_024716379.1\|1257992_1258259_+	DUF2577 family protein	S6C459	Thermus_phage	2.2e-05	37.5
WP_167872167.1\|1258318_1258744_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	7.3e-11	35.9
WP_167873840.1\|1258736_1259783_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.6e-70	43.2
WP_167872168.1\|1259766_1260345_+	YmfQ family protein	A0A2H4J717	uncultured_Caudovirales_phage	8.7e-15	33.1
WP_167872169.1\|1260341_1260614_+	hypothetical protein	NA	NA	NA	NA
WP_167872170.1\|1260616_1262092_+	hypothetical protein	M4ZRP1	Bacillus_phage	2.1e-20	59.4
WP_167872171.1\|1262104_1262545_+	hypothetical protein	NA	NA	NA	NA
WP_167872172.1\|1262534_1262726_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	4.0e-17	62.3
WP_167872173.1\|1262788_1263067_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	3.7e-27	68.1
WP_167872174.1\|1263079_1263343_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	65.5
WP_167872175.1\|1263355_1264252_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.1e-80	68.3

DBSCAN-SWA_4

1702312 : 1708550

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024715969.1\|1702312_1702705_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	1.2e-28	57.4
WP_024715968.1\|1702664_1704767_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	87.0
WP_014113879.1\|1704784_1705774_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.1e-155	84.1
WP_167872404.1\|1705823_1706444_+	hypothetical protein	A0A127AYS1	Bacillus_phage	5.4e-47	48.8
WP_167872405.1\|1706504_1707272_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.0e-50	48.2
WP_167872406.1\|1707908_1708550_+	AAA family ATPase	G3MAX6	Bacillus_virus	1.1e-26	41.9

DBSCAN-SWA_5

1712905 : 1719602

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167872411.1\|1712905_1713796_-	thermonuclease family protein	O64020	Bacillus_phage	6.3e-105	91.2
WP_167872412.1\|1714291_1714849_+	SMI1/KNR4 family protein	O64022	Bacillus_phage	1.7e-100	94.6
WP_167872413.1\|1714948_1716859_+	ribonuclease YeeF family protein	A0A1P8CWI7	Bacillus_phage	1.4e-210	89.7
WP_167872414.1\|1716865_1717354_+	antitoxin YezG family protein	NA	NA	NA	NA
WP_167873848.1\|1717454_1717931_+	SMI1/KNR4 family protein	A0A1P8CWM6	Bacillus_phage	1.1e-60	65.8
WP_167872415.1\|1718035_1718488_+	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	3.6e-72	89.3
WP_167872416.1\|1718534_1718960_+	selenium binding protein	NA	NA	NA	NA
WP_167872417.1\|1719485_1719602_-	type I toxin-antitoxin system toxin BsrG	Q96209	Bacillus_phage	9.8e-11	97.4

DBSCAN-SWA_6

1723045 : 1764458

Bacillus_phage(88.24%)

holin,integrase,tail

attL 1737154:1737170|attR 1763123:1763139

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167872420.1\|1723045_1723378_+	YolD-like family protein	A0A1P8CWP2	Bacillus_phage	3.0e-52	93.6
WP_167873849.1\|1723756_1724365_+	DNA repair protein	A0A1P8CWP4	Bacillus_phage	1.7e-109	95.5
WP_167873850.1\|1724434_1724623_+	hypothetical protein	A0A1P8CWP4	Bacillus_phage	1.7e-23	88.7
WP_167872421.1\|1724750_1726592_+	methyltransferase domain-containing protein	A0A1V0SCZ9	Indivirus	3.5e-09	32.0
WP_167872422.1\|1726581_1727310_+	carboxy-S-adenosyl-L-methionine synthase CmoA	H9YRL8	environmental_Halophage	2.8e-18	30.0
WP_167872423.1\|1727465_1728689_+	MFS transporter	NA	NA	NA	NA
WP_167872424.1\|1728713_1730420_+	hypothetical protein	E3SL71	Synechococcus_phage	1.4e-60	32.9
WP_153801665.1\|1730759_1730903_-	hypothetical protein	NA	NA	NA	NA
WP_167872425.1\|1730892_1732023_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	3.5e-100	50.0
WP_167872426.1\|1732156_1732408_-\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	3.9e-36	94.0
WP_167872427.1\|1732428_1732821_-	hypothetical protein	A0A1P8CWP1	Bacillus_phage	3.2e-61	98.5
WP_167872428.1\|1732937_1733984_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A1J0MS59	Bacillus_phage	2.7e-83	52.0
WP_167872429.1\|1734212_1734350_-	XkdX family protein	NA	NA	NA	NA
WP_167872430.1\|1734350_1734716_-	hypothetical protein	O64053	Bacillus_phage	7.0e-18	44.1
WP_167873851.1\|1736529_1737348_-	hypothetical protein	A0A1P8CWP7	Bacillus_phage	7.3e-100	66.1
1737154:1737170	attL	NA	NA	NA	NA
WP_167872431.1\|1737363_1740006_-	hypothetical protein	A0A1P8CWQ0	Bacillus_phage	0.0e+00	92.5
WP_167872432.1\|1740019_1740781_-\|tail	phage tail protein	A0A1P8CWP8	Bacillus_phage	2.9e-127	95.3
WP_167872433.1\|1740821_1747715_-\|tail	phage tail tape measure protein	A0A1P8CWQ1	Bacillus_phage	0.0e+00	80.6
WP_167872434.1\|1747912_1748905_-	hypothetical protein	O64047	Bacillus_phage	8.0e-16	37.1
WP_167872435.1\|1749037_1750045_-\|integrase	tyrosine-type recombinase/integrase	A0A0H3V0P2	Geobacillus_virus	9.9e-123	65.7
WP_167872436.1\|1750058_1750478_-	hypothetical protein	A0A1P8CWQ4	Bacillus_phage	1.9e-59	84.2
WP_167872437.1\|1750477_1750966_-	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	3.7e-59	73.6
WP_167872438.1\|1751051_1752386_-	hypothetical protein	A0A1P8CWR7	Bacillus_phage	1.8e-42	27.7
WP_167872439.1\|1752385_1752742_-	hypothetical protein	O64055	Bacillus_phage	4.1e-55	94.1
WP_167872440.1\|1752816_1753284_-	hypothetical protein	NA	NA	NA	NA
WP_167872441.1\|1753303_1754095_-	hypothetical protein	A0A1P8CWR0	Bacillus_phage	2.5e-20	39.2
WP_167872442.1\|1754131_1754860_-	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	3.5e-45	42.6
WP_167872443.1\|1754856_1755363_-	hypothetical protein	O64060	Bacillus_phage	1.3e-78	84.5
WP_167872444.1\|1755359_1756010_-	hypothetical protein	A0A1P8CWR8	Bacillus_phage	1.4e-117	97.2
WP_167872445.1\|1755993_1756248_-	hypothetical protein	A0A1P8CWS7	Bacillus_phage	1.8e-36	95.2
WP_167872446.1\|1756244_1756640_-	hypothetical protein	A0A1P8CWR5	Bacillus_phage	3.7e-65	93.9
WP_167872447.1\|1756654_1757125_-	hypothetical protein	A0A1P8CWS5	Bacillus_phage	3.3e-81	98.7
WP_014472029.1\|1757160_1758177_-	hypothetical protein	A0A1P8CWR9	Bacillus_phage	4.6e-184	97.9
WP_010328108.1\|1758215_1758752_-	hypothetical protein	A0A1P8CWS2	Bacillus_phage	1.4e-94	99.4
WP_167872448.1\|1758776_1760213_-	hypothetical protein	A0A1P8CWR1	Bacillus_phage	5.2e-258	95.8
WP_167872449.1\|1760243_1761764_-	hypothetical protein	O64068	Bacillus_phage	2.0e-276	97.0
WP_167872450.1\|1761781_1763551_-	hypothetical protein	O64069	Bacillus_phage	0.0e+00	99.7
1763123:1763139	attR	NA	NA	NA	NA
WP_167872451.1\|1763537_1764458_-	hypothetical protein	A0A1P8CWS6	Bacillus_phage	1.5e-173	97.7

DBSCAN-SWA_7

1769544 : 1809563

Bacillus_phage(88.64%)

integrase

attL 1774147:1774168|attR 1796214:1796235

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167872457.1\|1769544_1769820_-	HU family DNA-binding protein	A0A1P8CWT5	Bacillus_phage	3.5e-38	95.6
WP_167872458.1\|1770076_1770700_-	hypothetical protein	O64076	Bacillus_phage	1.8e-82	73.5
WP_167872459.1\|1770921_1771824_-	GIY-YIG nuclease family protein	G3MAX5	Bacillus_virus	1.4e-06	36.1
WP_167872460.1\|1772005_1773883_-	hypothetical protein	A0A1P8CWS8	Bacillus_phage	0.0e+00	99.0
WP_167872461.1\|1773922_1774117_-	hypothetical protein	O64077	Bacillus_phage	8.2e-26	92.2
1774147:1774168	attL	NA	NA	NA	NA
WP_032721653.1\|1775141_1775318_+	hypothetical protein	O64080	Bacillus_phage	2.0e-10	97.4
WP_167872462.1\|1775336_1775588_+	hypothetical protein	A0A1P8CWU4	Bacillus_phage	7.1e-30	95.8
WP_167872463.1\|1775632_1775794_+	hypothetical protein	O64081	Bacillus_phage	4.0e-18	96.1
WP_167872464.1\|1775904_1777137_+	hypothetical protein	O64082	Bacillus_phage	4.5e-234	98.0
WP_167872465.1\|1777475_1779344_+	hypothetical protein	NA	NA	NA	NA
WP_167872466.1\|1779392_1780994_+	DUF4942 domain-containing protein	A0A2I7RNS1	Vibrio_phage	1.9e-14	31.7
WP_167872467.1\|1781204_1781465_+	hypothetical protein	NA	NA	NA	NA
WP_167872468.1\|1781515_1781797_+	hypothetical protein	NA	NA	NA	NA
WP_167872469.1\|1781873_1782113_+	hypothetical protein	NA	NA	NA	NA
WP_167872470.1\|1782171_1782507_+	hypothetical protein	NA	NA	NA	NA
WP_167872471.1\|1782570_1782972_+	UPF0715 family protein	NA	NA	NA	NA
WP_167872472.1\|1783162_1783390_+	helix-turn-helix transcriptional regulator	O64085	Bacillus_phage	1.1e-32	90.7
WP_167872473.1\|1783709_1784693_+	DUF4062 domain-containing protein	NA	NA	NA	NA
WP_167872474.1\|1784728_1785559_+	HNH endonuclease	NA	NA	NA	NA
WP_116315615.1\|1785601_1785823_+	hypothetical protein	NA	NA	NA	NA
WP_167872475.1\|1785867_1786269_+	UPF0715 family protein	O64087	Bacillus_phage	7.6e-50	83.6
WP_167872476.1\|1786280_1786511_-	hypothetical protein	NA	NA	NA	NA
WP_167872477.1\|1786624_1786849_+	hypothetical protein	NA	NA	NA	NA
WP_167872478.1\|1787122_1787374_+	hypothetical protein	A0A1P8CWV6	Bacillus_phage	3.5e-37	98.8
WP_167872479.1\|1787377_1787593_+	hypothetical protein	O64089	Bacillus_phage	8.2e-27	87.3
WP_167872480.1\|1787603_1787738_+	hypothetical protein	O64090	Bacillus_phage	1.8e-19	100.0
WP_167873852.1\|1787893_1788427_+	hypothetical protein	NA	NA	NA	NA
WP_072692929.1\|1788503_1788920_+	hypothetical protein	O64093	Bacillus_phage	6.0e-66	92.0
WP_167872481.1\|1789095_1790256_+	hypothetical protein	NA	NA	NA	NA
WP_009967508.1\|1790269_1790395_+	lysogeny pheromone AimP family peptide	NA	NA	NA	NA
WP_167872482.1\|1790727_1790928_+	hypothetical protein	O64096	Bacillus_phage	1.2e-27	98.5
WP_167873853.1\|1790930_1791248_+	hypothetical protein	NA	NA	NA	NA
WP_144453792.1\|1791296_1791509_+	helix-turn-helix transcriptional regulator	O64098	Bacillus_phage	2.1e-27	95.7
WP_167872483.1\|1791498_1792575_+\|integrase	site-specific integrase	O64099	Bacillus_phage	8.5e-197	98.9
WP_167872484.1\|1792681_1794064_+	hypothetical protein	O64100	Bacillus_phage	3.1e-260	99.1
WP_167872485.1\|1794087_1795065_+	hypothetical protein	O64101	Bacillus_phage	4.4e-176	99.4
WP_004399410.1\|1795253_1795478_-	helix-turn-helix transcriptional regulator	O64102	Bacillus_phage	1.9e-34	100.0
WP_003231034.1\|1795659_1795878_+	YopT family protein	O64103	Bacillus_phage	6.6e-32	100.0
WP_010330351.1\|1795947_1796145_+	hypothetical protein	O64104	Bacillus_phage	1.2e-27	96.9
WP_161986113.1\|1796256_1796451_+	hypothetical protein	O64105	Bacillus_phage	2.2e-26	95.3
1796214:1796235	attR	NA	NA	NA	NA
WP_167872486.1\|1796819_1797218_+	hypothetical protein	M4ZRL6	Bacillus_phage	9.2e-32	52.8
WP_167872487.1\|1797214_1797397_+	hypothetical protein	NA	NA	NA	NA
WP_167872488.1\|1797456_1798212_+	phage regulatory protein/antirepressor Ant	A0A1P8CWY0	Bacillus_phage	3.6e-109	80.5
WP_167872489.1\|1798266_1798488_+	hypothetical protein	NA	NA	NA	NA
WP_167872490.1\|1798651_1799104_+	hypothetical protein	O64117	Bacillus_phage	2.5e-65	82.0
WP_069323063.1\|1799165_1799426_+	hypothetical protein	A0A1P8CWY6	Bacillus_phage	1.9e-41	97.7
WP_167873854.1\|1800135_1800318_+	hypothetical protein	O64120	Bacillus_phage	2.4e-27	96.6
WP_167872491.1\|1800354_1800543_+	hypothetical protein	NA	NA	NA	NA
WP_167872492.1\|1800693_1800909_+	hypothetical protein	A0A1P8CX01	Bacillus_phage	8.8e-29	90.1
WP_167872493.1\|1800927_1801302_-	hypothetical protein	A0A1P8CWZ2	Bacillus_phage	1.0e-56	93.5
WP_167872494.1\|1801425_1801827_+	hypothetical protein	K4JWE2	Caulobacter_phage	4.1e-19	39.1
WP_167872495.1\|1801918_1802296_-	DUF2513 domain-containing protein	A0A2I7SCV0	Paenibacillus_phage	4.8e-22	46.0
WP_167872496.1\|1802442_1802856_+	hypothetical protein	A0A1P8CWZ8	Bacillus_phage	1.8e-75	96.4
WP_167872497.1\|1802921_1803734_-	ATP-dependent DNA ligase	O64130	Bacillus_phage	1.9e-148	94.4
WP_167872498.1\|1803803_1804478_-	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	1.6e-76	96.5
WP_167872499.1\|1804548_1804770_+	hypothetical protein	A0A1P8CWZ6	Bacillus_phage	7.9e-33	94.5
WP_167872500.1\|1804820_1805708_+	hypothetical protein	A0A1P8CWZ3	Bacillus_phage	7.8e-164	96.3
WP_072589242.1\|1805697_1805970_+	hypothetical protein	A0A1P8CWZ5	Bacillus_phage	2.7e-43	93.3
WP_167872501.1\|1806000_1806177_-	hypothetical protein	NA	NA	NA	NA
WP_167872502.1\|1806444_1806741_+	hypothetical protein	O64136	Bacillus_phage	8.6e-35	78.7
WP_167872503.1\|1806806_1807187_+	hypothetical protein	A0A1P8CX06	Bacillus_phage	5.1e-64	93.7
WP_167872504.1\|1807260_1807614_+	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_167872505.1\|1807828_1808200_+	hypothetical protein	O64139	Bacillus_phage	3.0e-61	94.3
WP_167872506.1\|1808222_1809563_+	hypothetical protein	A0A0K2FMB7	Brevibacillus_phage	1.3e-05	23.8

DBSCAN-SWA_8

1812962 : 1845997

Bacillus_phage(95.83%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003231078.1\|1812962_1814027_+	hypothetical protein	A0A218KBY7	Bacillus_phage	1.1e-63	38.9
WP_167872509.1\|1814038_1815727_+	single-stranded DNA endonuclease	A0A1P8CX07	Bacillus_phage	4.4e-123	43.5
WP_167872510.1\|1815744_1818036_+	DNA polymerase I	A0A0K0N6N8	Gordonia_phage	1.3e-05	28.0
WP_167873855.1\|1818061_1818778_+	hypothetical protein	O64147	Bacillus_phage	8.4e-108	84.0
WP_004399415.1\|1818895_1819045_+	hypothetical protein	O64148	Bacillus_phage	7.9e-21	100.0
WP_087960917.1\|1819080_1819278_+	hypothetical protein	O64149	Bacillus_phage	1.5e-27	92.2
WP_167873856.1\|1819310_1819526_+	YorP family protein	O64150	Bacillus_phage	3.3e-36	95.8
WP_167872511.1\|1819518_1819674_+	hypothetical protein	A0A1P8CX36	Bacillus_phage	2.8e-21	92.2
WP_167872512.1\|1819673_1820171_+	deoxynucleoside kinase	A0A1P8CX28	Bacillus_phage	1.5e-79	90.3
WP_106294053.1\|1820210_1820558_-	hypothetical protein	NA	NA	NA	NA
WP_167872513.1\|1820682_1820949_+	hypothetical protein	NA	NA	NA	NA
WP_167872514.1\|1821035_1821632_+	hypothetical protein	NA	NA	NA	NA
WP_167872515.1\|1821683_1821902_+	hypothetical protein	A0A1P8CX26	Bacillus_phage	4.0e-29	94.4
WP_167873857.1\|1821924_1822269_+	hypothetical protein	O64156	Bacillus_phage	2.8e-53	90.4
WP_167872516.1\|1822308_1822536_+	hypothetical protein	A0A1P8CX31	Bacillus_phage	4.6e-28	81.3
WP_167872517.1\|1822935_1823694_+	hypothetical protein	NA	NA	NA	NA
WP_019712334.1\|1823983_1824196_+	hypothetical protein	O64159	Bacillus_phage	6.0e-30	87.1
WP_081719797.1\|1824312_1824399_-	YjcZ family sporulation protein	NA	NA	NA	NA
WP_167872518.1\|1824537_1824801_+	hypothetical protein	NA	NA	NA	NA
WP_167872519.1\|1824959_1825136_+	hypothetical protein	NA	NA	NA	NA
WP_167872520.1\|1825295_1825616_+	hypothetical protein	A0A1P8CX20	Bacillus_phage	5.3e-54	97.2
WP_167872521.1\|1825682_1826036_+	hypothetical protein	A0A1P8CX27	Bacillus_phage	1.2e-38	70.8
WP_167872522.1\|1826050_1826398_+	hypothetical protein	O64164	Bacillus_phage	7.7e-51	91.3
WP_167872523.1\|1826411_1826537_+	hypothetical protein	O64165	Bacillus_phage	1.3e-11	87.8
WP_167872524.1\|1826578_1826932_+	hypothetical protein	NA	NA	NA	NA
WP_041056314.1\|1826966_1827158_+	hypothetical protein	U5PY38	Bacillus_phage	6.2e-10	43.5
WP_167873858.1\|1827173_1827386_+	DUF1653 domain-containing protein	A0A1P8CX21	Bacillus_phage	1.3e-29	85.7
WP_166851988.1\|1827402_1827669_+	hypothetical protein	A0A1P8CX38	Bacillus_phage	1.4e-39	96.6
WP_167872525.1\|1827700_1827835_+	hypothetical protein	O64168	Bacillus_phage	1.6e-17	97.7
WP_167872526.1\|1827990_1828173_+	hypothetical protein	F8WPL1	Bacillus_phage	3.4e-18	66.7
WP_167872527.1\|1828245_1828608_+	hypothetical protein	A0A1P8CX44	Bacillus_phage	1.1e-52	89.2
WP_167872528.1\|1828607_1829003_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A1P8CX56	Bacillus_phage	5.3e-64	94.7
WP_167872529.1\|1828965_1831065_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A1P8CX40	Bacillus_phage	0.0e+00	61.1
WP_167872530.1\|1831351_1832350_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4JMU8	Bacillus_phage	1.1e-150	82.0
WP_167872531.1\|1832346_1832589_+	thioredoxin	A0A1P8CX24	Bacillus_phage	7.5e-37	95.0
WP_167872532.1\|1832631_1832994_+	hypothetical protein	A0A172JI43	Bacillus_phage	4.6e-14	41.3
WP_167872533.1\|1833065_1833494_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.4e-70	90.1
WP_017697107.1\|1833581_1833764_+	hypothetical protein	NA	NA	NA	NA
WP_041336532.1\|1834138_1834294_+	hypothetical protein	A0A1P8CX64	Bacillus_phage	3.2e-17	80.4
WP_167872534.1\|1834311_1834617_+	hypothetical protein	A0A1P8CX63	Bacillus_phage	4.0e-43	91.1
WP_167872535.1\|1834600_1834792_+	hypothetical protein	A0A1P8CX47	Bacillus_phage	1.5e-24	77.5
WP_167872536.1\|1834906_1835251_+	hypothetical protein	A0A1P8CX52	Bacillus_phage	9.7e-46	82.5
WP_167872537.1\|1835307_1836147_+	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.5e-159	95.0
WP_167872538.1\|1836203_1836941_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
WP_167872539.1\|1837097_1837451_+	hypothetical protein	A0A1P8CX43	Bacillus_phage	6.0e-51	91.5
WP_167872540.1\|1837463_1837718_+	hypothetical protein	A0A1P8CX46	Bacillus_phage	6.3e-34	89.6
WP_134983294.1\|1838491_1838692_+	hypothetical protein	A0A1P8CX75	Bacillus_phage	3.6e-08	56.1
WP_134983293.1\|1838725_1838944_-	acid-soluble spore protein SspC	Q77YX0	Bacillus_phage	1.0e-29	95.8
WP_167872541.1\|1839061_1839889_+	metallophosphoesterase	O64184	Bacillus_phage	2.8e-155	90.2
WP_167872542.1\|1839898_1840117_+	hypothetical protein	NA	NA	NA	NA
WP_167872543.1\|1840138_1840507_+	hypothetical protein	NA	NA	NA	NA
WP_167872544.1\|1840543_1840789_+	hypothetical protein	R4JF03	Bacillus_phage	2.3e-17	57.3
WP_167872545.1\|1840829_1841243_+	hypothetical protein	NA	NA	NA	NA
WP_167872546.1\|1841217_1841637_+	hypothetical protein	A0A1P8CX53	Bacillus_phage	1.1e-38	73.5
WP_167872547.1\|1841644_1841809_+	hypothetical protein	O64190	Bacillus_phage	3.2e-07	56.4
WP_167872548.1\|1841805_1842069_+	hypothetical protein	NA	NA	NA	NA
WP_167872549.1\|1842275_1842488_+	hypothetical protein	O64192	Bacillus_phage	3.4e-33	97.1
WP_167873859.1\|1842571_1842757_+	hypothetical protein	O64193	Bacillus_phage	4.3e-24	91.8
WP_167872550.1\|1842761_1843001_-	helix-turn-helix transcriptional regulator	O64194	Bacillus_phage	2.6e-37	96.2
WP_167872551.1\|1843074_1843674_+	hypothetical protein	O64195	Bacillus_phage	1.2e-91	88.2
WP_167872552.1\|1843670_1843817_+	hypothetical protein	NA	NA	NA	NA
WP_167872553.1\|1843905_1845606_+	recombinase family protein	W8CYE4	Bacillus_phage	1.8e-15	23.7
WP_167872554.1\|1845586_1845997_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.1e-17	39.9

DBSCAN-SWA_9

2297436 : 2303544

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167872794.1\|2297436_2298030_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
WP_167873870.1\|2298019_2298775_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.2e-08	24.9
WP_167872795.1\|2299067_2299592_+	DUF309 domain-containing protein	NA	NA	NA	NA
WP_024715198.1\|2299605_2299980_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
WP_003223915.1\|2300092_2300557_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
WP_024715197.1\|2300589_2301786_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.6e-114	54.7
WP_167872796.1\|2301800_2302448_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	3.2e-42	47.2
WP_167872797.1\|2302458_2303544_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.3e-56	36.1

DBSCAN-SWA_10

3664723 : 3710772

Staphylococcus_phage(25.0%)

coat,protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167873560.1\|3664723_3666394_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_167873561.1\|3666390_3666819_-	DUF1934 domain-containing protein	NA	NA	NA	NA
WP_024713849.1\|3667130_3667262_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
WP_167873562.1\|3667395_3668742_+	subtilosin maturase AlbA	NA	NA	NA	NA
WP_024713851.1\|3668754_3668916_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
WP_167873563.1\|3668912_3669632_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-20	28.1
WP_167873564.1\|3669624_3670935_+\|bacteriocin	bacteriocin biosynthesis protein AlbD	NA	NA	NA	NA
WP_167873923.1\|3670924_3672085_+	insulinase family protein	NA	NA	NA	NA
WP_167873565.1\|3672089_3673373_+	insulinase family protein	NA	NA	NA	NA
WP_167873566.1\|3673369_3674071_+\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
WP_167873567.1\|3674076_3675471_-	YncE family protein	NA	NA	NA	NA
WP_024713858.1\|3675467_3675698_-	hypothetical protein	NA	NA	NA	NA
WP_024713859.1\|3675700_3676846_+	response regulator aspartate phosphatase RapF	A0A1P8CWN8	Bacillus_phage	5.5e-77	43.8
WP_024713860.1\|3676829_3676949_+	PhrC/PhrF family phosphatase-inhibitory pheromone	NA	NA	NA	NA
WP_167873568.1\|3677478_3678267_+	hypothetical protein	NA	NA	NA	NA
WP_167873569.1\|3678253_3678928_+	hypothetical protein	NA	NA	NA	NA
WP_167873570.1\|3678928_3679735_+	hypothetical protein	NA	NA	NA	NA
WP_167873571.1\|3679737_3680385_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.2e-27	39.5
WP_167873572.1\|3680377_3680938_+	hypothetical protein	NA	NA	NA	NA
WP_024713867.1\|3680983_3681856_-	agmatinase	NA	NA	NA	NA
WP_024713868.1\|3681916_3682747_-	spermidine synthase	NA	NA	NA	NA
WP_167873573.1\|3682948_3685024_+	penicillin-binding protein	NA	NA	NA	NA
WP_167873924.1\|3685051_3685474_-	hypothetical protein	NA	NA	NA	NA
WP_024713871.1\|3685612_3686131_-	hypothetical protein	NA	NA	NA	NA
WP_024713872.1\|3686143_3686803_-\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_003222038.1\|3686912_3687101_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
WP_167873574.1\|3687144_3687564_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_167873575.1\|3687683_3689600_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.1e-141	42.5
WP_167873576.1\|3690429_3691839_-	MFS transporter	NA	NA	NA	NA
WP_024713095.1\|3691835_3692309_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_167873577.1\|3692423_3692924_-	YwgA family protein	NA	NA	NA	NA
WP_167873578.1\|3692959_3694261_-	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
WP_003222050.1\|3694422_3694647_-	DUF1450 domain-containing protein	NA	NA	NA	NA
WP_167873579.1\|3694859_3695639_+	prespore-specific transcription regulator RsfA	A0A1D6X8E5	Bacillus_phage	7.7e-06	50.0
WP_167873580.1\|3695781_3696672_-	DMT family transporter	NA	NA	NA	NA
WP_024713101.1\|3696842_3697688_-	octanoyl-[GcvH]:protein N-octanoyltransferase	NA	NA	NA	NA
WP_024713102.1\|3697735_3698635_-	cysJI operon transcriptional regulator CysL	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
WP_024713103.1\|3698779_3699751_-	phosphate acetyltransferase	NA	NA	NA	NA
WP_003235942.1\|3700021_3700786_+	heme-dependent peroxidase	NA	NA	NA	NA
WP_167873581.1\|3700917_3701697_+	NADPH-dependent reductase BacG	NA	NA	NA	NA
WP_024713105.1\|3701710_3702910_-	transaminase BacF	NA	NA	NA	NA
WP_167873582.1\|3702910_3704095_-	bacilysin exporter BacE	NA	NA	NA	NA
WP_167873583.1\|3704091_3705510_-	alanine--anticapsin ligase	NA	NA	NA	NA
WP_167873584.1\|3705528_3706290_-	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	6.7e-23	31.7
WP_167873585.1\|3706292_3707000_-	3-((4R)-4-hydroxycyclohexa-1, 5-dien-1-yl)-2-oxopropanoate isomerase	NA	NA	NA	NA
WP_024713110.1\|3706989_3707604_-	prephenate decarboxylase	NA	NA	NA	NA
WP_167873586.1\|3707755_3708994_-	MFS transporter	NA	NA	NA	NA
WP_024713112.1\|3709537_3710002_-	hypothetical protein	NA	NA	NA	NA
WP_167873587.1\|3710316_3710772_-\|coat	spore coat protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP048852

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection