CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP050975	Streptomyces sp. RPA4-2 chromosome, complete genome	11 crisprs	WYL,csa3,casR,DEDDh,cas4,Cas9_archaeal,cas3,DinG,c2c10_CAS-V-U3,Cas14u_CAS-V,c2c9_V-U4,RT	1	3	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050975_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_1

282600-282794

Orphan

Consensus_repeat	Method
GACNACATCGGCTGGCCCAAG	CRT

4 spacers

The CRISPR arrays of NZ_CP050975_1

>merge|NZ_CP050975|1|282600-282794|CRT
GACAGCATCGGCTGGCCCAAGACGGCCACCACCGTCGCGGCCACGGACGACATCGGCTGGCCCAAGGCCGCCTACGCCACGGCCGACGACAACATCGGCTGGCCCAAGACGGTCACCGTCTCCGCCGACGACAGCAACATCGGCTGGCCCAAGGCAGTCACCGTCGCGGCCACGGACGACATCGGCTGGCCCCTC

>NZ_CP050975|1|1|282600-282794|CRT
GACAGCATCGGCTGGCCCAAG	ACGGCCACCACCGTCGCGGCCACG
GACGACATCGGCTGGCCCAAG	GCCGCCTACGCCACGGCCGAC
GACAACATCGGCTGGCCCAAG	ACGGTCACCGTCTCCGCCGACGAC
AGCAACATCGGCTGGCCCAAG	GCAGTCACCGTCGCGGCCACG
GACGACATCGGCTGGCCCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168525263.1\|291034_291778_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341282
NZ_CP050975.1\|WP_168525254.1\|283514_285710_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|376807
NZ_CP050975.1\|WP_168525252.1\|283056_283323_+\|acyl-carrier-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525257.1\|286364_287252_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369647
NZ_CP050975.1\|WP_168533177.1\|270807_271620_+\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	unknown	unknown	gnl\|CDD\|274422
NZ_CP050975.1\|WP_168533181.1\|276857_277745_-\|DMT-family-transporter	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525265.1\|291758_293807_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341253
NZ_CP050975.1\|WP_168525242.1\|274855_276742_-\|glycoside-hydrolase-family-15-protein	unknown	unknown	gnl\|CDD\|225922
NZ_CP050975.1\|WP_168525246.1\|279657_280647_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182183
NZ_CP050975.1\|WP_168533179.1\|272548_273919_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP050975.1\|WP_168525244.1\|278140_279412_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP050975.1\|WP_168533183.1\|280684_281839_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223594
NZ_CP050975.1\|WP_168525240.1\|274094_274832_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP050975.1\|WP_168525261.1\|289851_290448_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP050975.1\|WP_168525238.1\|271644_272181_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525259.1\|287248_288094_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|369647
NZ_CP050975.1\|WP_168533185.1\|289077_289491_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413
NZ_CP050975.1\|WP_168500444.1\|288206_288344_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525256.1\|285825_286368_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP050975.1\|WP_168525248.1\|282429_282573_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168525263.1\|291034_291778_+\|AMP-binding-protein	gnl\|CDD\|341282	cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and, in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the adenylation domain of the Bacillus subtilis termination module (Surfactin domain, SrfA-C) which recognizes a specific amino acid building block, which is then activated and transferred to the terminal thiol of the 4'-phosphopantetheine (Ppan) arm of the downstream peptidyl carrier protein (PCP) domain.	1.17144e-83
NZ_CP050975.1\|WP_168525254.1\|283514_285710_-\|MFS-transporter	gnl\|CDD\|376807	pfam02522, Antibiotic_NAT, Aminoglycoside 3-N-acetyltransferase. This family consists of bacterial aminoglycoside 3-N-acetyltransferases EC:2.3.1.81, these catalyze the reaction: Acetyl-Co + a 2-deoxystreptamine antibiotic <=> CoA + N3'-acetyl-2-deoxystreptamine antibiotic. The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others.	8.08646e-75
NZ_CP050975.1\|WP_168525257.1\|286364_287252_-\|hypothetical-protein	gnl\|CDD\|369647	pfam08007, Cupin_4, Cupin superfamily protein. This family contains many hypothetical proteins that belong to the cupin superfamily.	1.0701e-16
NZ_CP050975.1\|WP_168533177.1\|270807_271620_+\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	gnl\|CDD\|274422	TIGR03083, TIGR03083, uncharacterized Actinobacterial protein TIGR03083. This protein family pulls together several groups of proteins, each very different from the others. They share in common three conserved regions. The first is a region of about 38 amino acids, nearly always at the N-terminus of a protein. This region has a bulky hydrophobic residue, usually Trp, at position 29, and a His residue at position 37 that is invariant, so far, in over 150 instances. The second conserved region has a motif [DE]xxxHxxD. The third conserved region contains a hydrophobic patch and a well-conserved Arg residue. Most examples are found in the Actinobacteria, including the genera Mycobacterium, Corynebacterium, Streptomyces, Nocardia, Frankia, etc. The pattern of near-invariant residues against a backdrop of extreme sequence divergence suggests enzymatic activity and conservation of active site residues.	8.87292e-13
NZ_CP050975.1\|WP_168525256.1\|285825_286368_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.65378e-20
NZ_CP050975.1\|WP_168525242.1\|274855_276742_-\|glycoside-hydrolase-family-15-protein	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	7.78559e-124
NZ_CP050975.1\|WP_168525246.1\|279657_280647_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182183	PRK09986, PRK09986, LysR family transcriptional regulator.	2.58917e-27
NZ_CP050975.1\|WP_168533179.1\|272548_273919_-\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.77427e-59
NZ_CP050975.1\|WP_168525244.1\|278140_279412_-\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	4.48252e-55
NZ_CP050975.1\|WP_168533183.1\|280684_281839_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	5.95623e-38
NZ_CP050975.1\|WP_168525240.1\|274094_274832_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.5254e-06
NZ_CP050975.1\|WP_168525261.1\|289851_290448_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.41326e-08
NZ_CP050975.1\|WP_168525259.1\|287248_288094_-\|hypothetical-protein	gnl\|CDD\|369647	pfam08007, Cupin_4, Cupin superfamily protein. This family contains many hypothetical proteins that belong to the cupin superfamily.	1.42179e-25
NZ_CP050975.1\|WP_168533185.1\|289077_289491_-\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	8.07631e-15
NZ_CP050975.1\|WP_168525265.1\|291758_293807_+\|AMP-binding-protein	gnl\|CDD\|341253	cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.	6.05042e-46

>NZ_CP050975.1|WP_168525248.1|282429_282573_+|hypothetical-protein
MKNIARIAVTTAAVASAVLTAAGVSAATQSIGRPQSAGTTASSAIGW
>NZ_CP050975.1|WP_168533183.1|280684_281839_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MPAAVRALVADCAAREDRYGPHELEEHLAHVLRTEIHDRLGALLGVPAADTAVVTDAATAFDALVRGLGPGRGDRIWTTPYEGVANLTALYALRDRTRCRLEVVPLREDGDLDLEWMARHIDDDVALVSVVHVPSGRGIVNPVETIGRILAPHRCLYAVDASYAVGQLSVDAARTGCHLLTGDGWRFLRGPHDVGFAYLAPRLRDMFEEAAAHRPPPQNAAVAGLNAALAHHTATLTGPAGHDGLRLLPALRAAVEETPGTELITPGLVQSGILAFRHRELPASLVRRQLAARGVALWKTVAQEIPLLDHPAGTALRASLHHDTTPDDITRFGHALQAVVREERPHPAGPRPAARHTAPAPPVPARTAVPRPPTRRHLTLCPTP
>NZ_CP050975.1|WP_168525246.1|279657_280647_-|LysR-family-transcriptional-regulator
MRHDINPRLLRAFVAVAEELHFTRAAARLFVAQQALSRDIRHLERVWGRALFERDTRHVALTREGQRLLPVVRHVLTAQEQLGRELEQPPAGESARPLIVDVALHGSTGPRVLAAAREAAPGLEFVSRFHSGLTRAAAEMADGRLDVSFGRVAGLPRAVRAGLEHRLIRYDRLAVHLPPEHRLAALPRVPLAALAGETVYAAAGNEDTTEWTDYARALFAGRGIGLAPPFPKIEGEAEFRRVMRKHGWSVLANVDFADVPEMALRPLTDPVPLSPVSLVWRRGLRHPGVRALADAAQALGTAEGWLERPPDSWLPDADRTLAAEPSHSF
>NZ_CP050975.1|WP_168525244.1|278140_279412_-|serine-hydrolase
MTHSGTRLRRGAVTAAVVGALIAAAAGCTARGTTATASVPAAADATHATASPSPSGPATGGVRTLTPAVTRQLDASVRQVMGEAGVPGVTVGLWTHGQGTYVRSFGAADRSDGRKMSPDLYTRIGSETKTFTVTALLKLVDEGRVGLDDPIGRYVGGVPGGDGITLRDLAGMRSGLFNYTDDPAFFKALTSDPQRPFTPPQLLSYAFGHRPLFPPGRKFSYSNTNLILLGMVVERAGGMPAADYIRENVLAPAGMDHTLLPADAAFPAPHAQGYTDQTASGAVEETAGWNPSWAWTAGAMISNLDDLHTWARTVATGVLPDGTTLIGSTTQKQRLTTLPTTIPGAGYGLGIFDVQGWIGHNGSMPGYESLTVYLPSAQATLVVLLNTDISHDGAEPSTLVGEAVTKIVSPGHVFDLPAQHAAR
>NZ_CP050975.1|WP_168533181.1|276857_277745_-|DMT-family-transporter
MVVSVVFALLAAASNATATVLQRRAAQDVPLSEGFRARLFVDLLHRPAWLGGMAAVMAAACFQALALVNGALAVVQPIFVLELPFALLIGGLVLRRRVTRRGWTAVVCIAAGLGVALAAAAPSAGTGQAAAGGWVVAIVCCVGVMTAAVRIALRLPAGRARAACFGSAAAIGYALTAALIKDATHAWQTGGVTGFFLAWQTYAFAAAGVCALFLLQNAVQSGPLVASQPALTLGDALVSLALGVTLYAEEVRTGWWLVPEIAGAGLILYGVVQLARIPLAQTLVSAPPARHRGRT
>NZ_CP050975.1|WP_168525242.1|274855_276742_-|glycoside-hydrolase-family-15-protein
MAEATTDTGATEGPRPGPGAPGPRADTPAYLPIAEHGLIGDLRSAALVGTNGTIDWYCCARFDAPSVFASILDAERGGSFELAADVPARTKQFYFPDTNVLITRFFAEDGVGEIQDFMPVVDDSREADRHRLIRRVVCVRGTLPFRARVAPRFDYGCEPHTVHPYDGQVVFKSASLHLALTSTVPIEVDGPDVWSLFKLHEGESAVFTIDRIGGEVAPRFCAVAEAEREFNATVRYWRHWLSQSRYRGRWREMVHRSALTLKLLTYAPTGAIIAAPTTSLPEQIGGERNWDYRYVWVRDAAFCVYALLRLGFIDEAEAFMGFLTETVGLESVSASQAEGPLQIMYGIDGRRDLSERELPHLEGYRGSAPVRVGNAAVGQLQLDIYGALLDSFYLYDKWGKPISSGHWDSICELVDWVCDHWDQPDEGVWETRGGRKPFLYSRLMCWVAIERAIRLARHRGLPADIVRWGGARDAIYRRIMSHGWSAERRAFVQYENSSILDASLLMMPLAKFISPTDPKWLATLDALGEDLVSDSLVYRYDPQASPDGLQGEEGTFSICSFWYVEALTRAGRLDEARLAFEKMLTYANHLGLYAEEIGHTGEQQGNFPQAFTHLALISAAFNLDRRLG
>NZ_CP050975.1|WP_168525240.1|274094_274832_+|TetR-family-transcriptional-regulator
MSPTPEQRRAARHQLGTGSSAPAARRGPSGGRKKPITVDAIISTAFAIVEAEGYDALTMRRVAAALETGPSSLYAHVVNKEDLDELLIGRLCAGIDLPEPDPAAWRQQIAGVCTQLRDQYLRYPGISRAAFAAAPSNLDTLRVGEGMLAILLAGGIDPQTAAWALDSLSLYVNAYSLEVSLANSRIGRGDDGWVVSRDELLRRFAALPDTFPRTKRYAVELTAGTVHDRFDFTIGLMIDGLPGSR
>NZ_CP050975.1|WP_168533179.1|272548_273919_-|DHA2-family-efflux-MFS-transporter-permease-subunit
MVMADVMDLIDSSIATLAGPSIHADLGGGQSTVQWVLSAYTAAFALGLVTSGRLGDLLGRRRLFLLGMAGFTLTSLACGLAPDPVFLIVARTLQGLCGSVMIPQGLALVKVVFPPQHLRRALTPVGPLMGLTMVGGPILAGWLLHLNLFGSQWRSIFLVNVPLGVVAAVLARRVLPHRGGEDPAARLDLTGVGLLTAASALLIVPLIQGRDLGWPAWTYVMMGASAVLLALFVVSQRHSRHPVITPSLFRKRSFVVGLVIVAGFYASLSAFVLVINLLLQQGMHWTPLHTGLTLIPWALGTAVAVLLAGAVLAEKLGRASLHLGLAIAVIGLLALWWSLAHFGAGITVWKLAPALLLTGFGSGLVFVPLVDFIIGDATAEEVGTGAGLLNAVQQFAGAIGVAALGTVFFARAGHPSPSSCLAAAELVFAIAAGLNLLTLLLVGLLPQHAQRAHGQA
>NZ_CP050975.1|WP_168525238.1|271644_272181_-|hypothetical-protein
MPSELSPVISASARWLLSAFPAYVASLNHALAEAQAQHAVTIAAALRYPTPLDAELLSLLGPGGSGRLDYVTGADVHTPTGAEYLWRTWVDETVVSWAACLLADADLAAVATACLAATHHGTDGIGSARRLTVPSPRDHRAAPLLRHPDLLDPIADLHRETLLGLLDATPAVSAPGPR
>NZ_CP050975.1|WP_168533177.1|270807_271620_+|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme
MVGQDVGNALPEGLDAAIRETAREIAALLRRDTDMDVPVPGSRWSVGEAAAHLAQANELMAQLAAGQVRGYGDGTPQSLAAANERALAAFGERRAQPLAAMIEAQAEAYLKAWDAGAARGTLVTPLGPMGADVLGSYLLTHMLGHGYDLARALGRPHMIDRARVELTVPFLLTAMPRVTDTARAAGLSARYTIRLRGGTRFGVTVADGVVQVDPRPPARPDCTILTEPVTFLLMALGRRGQWSAIGRGGITVWGRRPWLAPRFPGLFEAP
>NZ_CP050975.1|WP_168525252.1|283056_283323_+|acyl-carrier-protein
MAHVPWNAKFEDVLRQGLPGLGKDKEPAADVPMEAYGLDSMALIGIVGALESVFRVSLAGQVVIPVHTLTAGQLWGILSAALQPAWDE
>NZ_CP050975.1|WP_168525254.1|283514_285710_-|MFS-transporter
MPLFPASLNGPARQLAVLHGIDGIGVGLYMAGSAVYLTQVTGLSPAQIGMALSAAGLTGLLASVLFGMVADRTGARPLLTWLLIGLGCGYLALPAVHSAWQFVVLAVAVGALQFGTGPSFMSLIAELVPGQDRVNARAAIRSVGNASMGLGTLAAAVLLAVGTRGALQVIPLANGVTFVVAGLLVHRLPAAAARPAPPAAGRFTALRDGPFLRVVAVNAALSLHDSVLAVAIPLWIVVGTGLPTVLTPLLIGLNTVLCVLLQVRAARGSDDLPGAARLARRAGLAGAASCLLLIPTGHLGTLTAGFLVCAAFVVMTGAELWHAAGSFGIGIGLAPEDRRGEYLGAFQLHHGLQSILGPLILTAFIGHGSGLGWTAAAVLFTAAALLVQPAVRAASAASAAWAGVLKHPGPPRTSPPWTEPEDTTDTTAPQTPQIPEARMLHPAADARTPGPYSGRELARDLRALGVERGDVVMVHTSLSALGWTVGGPVALLRALREAVGASGTLVVPAFTTYLTDPATWVQRPVPPTWWPHIRASLPPFDPDVHPVQPRLGRFPEFVRTLPGTHRSTHPLYSLAASGPAAPALLAAHPLPYGLGARSPLTALGGAAAKVLLIGVGWDKCTVLHLAEHLTPYPGRRVHRMRVPRAGADGATVWQDSDQLVMYEGDYARIGDRAARAGLVREGPLAAAGALLCPVAALVDLACGWLERHRDLSAWGVAPNMTGVREAPATAL
>NZ_CP050975.1|WP_168525256.1|285825_286368_-|GNAT-family-N-acetyltransferase
MRPVLRPATVLRPVTSADLDRFDTEFAGPDSPGPYQWFGHTPTLRLRRLLDERGLLGGDENMLSVTVDDTLAGRVEWFRRAWGRVETSACWEIAIGLFAAHRGQGIGTQAQRLLVDYLFTHTRAERVQVCTDADNLAEQRAAEKAGFELEGRVRRAQWRAGTWHDQLLYSALRPLGPPAP
>NZ_CP050975.1|WP_168525257.1|286364_287252_-|hypothetical-protein
MTTTRITLKDLVGDTDAFFRDHWATQPAVFRASADLTGLITEQEMWEEVDCGLLIRPYFTAFDEGVRTAVSEMTRSRTIVGHHVPGYINPGQIKADFAAGGTFKFSQPEHWHPRLRALVQALAPEFRAELESFVFLSPPGKTAIAAHMDGSHVLVLQIAGVKDWVVGRLDETSTSDSDRYTGGVIPYDRRMEVTLRPGDVLYMPHGTPHSATARIGTSLHIAVTIEEPTPQDLANVFLAELLGLPEFEALTRHHHELSPAERLTRLRALLTRTLGAADGTQVLKQAVRLKAGHLG
>NZ_CP050975.1|WP_168525259.1|287248_288094_-|hypothetical-protein
MDTLRGEGIFADAWNKEFRILRGAVDPAGHLSSAFIEQKLDASLLRWPYFSVLRHGAVPPESAYTRSRDVIGHQRPGFPDAAAVRRLMSAGGTLKLNQLSDWHRPTRTVVEELQAAAPVAVASYVFWTPPESRGMLPHRDASHVVALQLEGRKEWQLYAGSQQVRADAGLDVDAAHPTHTFVLEPGDVLYLPHGWPHDAVARDGDSLHLTFTLTEPTPDDLLEALGRHLLDADPGLAHRFHTTTLEQRTEHVRTALLAHTRHLDDDTWAHAALTAMREVTG
>NZ_CP050975.1|WP_168500444.1|288206_288344_-|hypothetical-protein
MGIRDTKNAIDNSENPEELAQTNISAEEEDAFDSPKTIMNQISNA
>NZ_CP050975.1|WP_168533185.1|289077_289491_-|ATP-binding-protein
MRPLDAPRARATAWDASWPLPRELTSVRRARRLATAQLSEWNLEDLADTAELLVSELVTNALRHTRGPLRLNLYARGSDLRCEVEDTDSTGPVRRVVDADAEGGRGTELLDLLTETWGSTRTATGKTMWFEISTRTP
>NZ_CP050975.1|WP_168525261.1|289851_290448_+|TetR-family-transcriptional-regulator
MARPPDPAKRRDLLDRVREYMIHNGVADLSLRPLARALGTSDRMLLYYFGSKERMVTEALTVYERRPLLRAQSLFNAADSPRDAAGVRRFMEETWQQFNNPDLRATLPLYLEVLAAGLLHPERYGPVVRDVLSEWTRLLTSVFRDLGMTEARAATEASLLVDASFGLLLAPLTDGDWDRADAAFHTLLDRLEPGWQDL
>NZ_CP050975.1|WP_168525263.1|291034_291778_+|AMP-binding-protein
MRDSAARAVLTEGSGAGEYAGLDAVAVDLDADAGLIAARPGVLPAVRPGPGDAAYVCYTSGTTGTPKGVVVPHRAVLDLVTSTDYVRLTPDDVVAQAANPAFDAVTFEIWSTLAAGARLVGLAKDTVIDPARFAAAVREHGVSTVFLTTALFHQIARERPDAFAPLRTVLFGGEACDPRRVRQVLAAGGPERLLHVYGPTETTTFATWHEVTGVAKDARTVPIGRPLGATVAVVVAADGLSRAGWQR
>NZ_CP050975.1|WP_168525265.1|291758_293807_+|AMP-binding-protein
MPGGSGELLLGGPGLATGYLDRPELTAQRFVEDRFTPGGGRLYRTGDLVRLREDGEMEFTGRVDNQVKLRGFRIELGEIESVLTAHPAVSEAVVSVHTTPENTANTENTANTDSAESTESAESAAGGERRLVAHVVPAAHRAAARESEQLTEWKEIYETLYDDAAGAAYGENFAGWNSSYDARPIPLEQMRQWRAATVERVRELGGRRVLEIGVGTGLLMARLAGAPECEEYWATDFSASVIEALRAQTGADERLRGKVRLSCRAADELDGLPAGHFDTVVVNSVVQYFPHLAYLRSVVEGVLPLLAPGGSVLLGDVRNLDLAPCLQTGVELASRAGQPLPGDGADVWRAVEQRVALETELLLSPALFAAWARELPAVRAVDVRVKRGGAHNELTRYRYEAVLSTAAPALDLSPAPRLVWGRDAASAAGVEAYLRTRRPAAVRLAGVPNRRVHGEWTAMRALRDGAAGLAAAAAHLGDSGSAPDPEELCTAGERVGYRALPTWSAEEGRLLDIVFVDPAQVPAGPLTGVYAGPEVPAGACANTPTAFGSTVDIEVVLRAYLQEQLPDYMIPSALMTLAALPLNANGKVDRAALPAPAFSADRPGTPPGTPLQEIVRDLFAEVIGVPRRTVHADSDFFRIGGHSLAAARLLARARAVLGADPGSRALYEAPTPALFAALAGDR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_2

356494-356597

Orphan

Consensus_repeat	Method
CGGGGCGTGCCTGCGGGCTCCGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_2

>merge|NZ_CP050975|2|356494-356597|CRISPRCasFinder
CGGGGCGTGCCTGCGGGCTCCGGGGCGGCGGGAGTCGGGGCGGCGGGGGCTGGGGTCGGGCGGGAGACGGCGGCGGGAGTCGGGGCGTGCCTGCGGGGCTCCGG

>NZ_CP050975|2|1|356494-356597|CRISPRCasFinder
CGGGGCGTGCCTGCGGGCTCCGGG	GCGGCGGGAGTCGGGGCGGCGGGGGCTGGGGTCGGGCGGGAGACGGCGGCGGGAGT
CGGGGCGTGCCTGCGGGGCTCCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168525349.1\|357185_358007_+\|AfsR/SARP-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|276938
NZ_CP050975.1\|WP_168525345.1\|353213_354038_-\|AfsR/SARP-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|276938
NZ_CP050975.1\|WP_168525351.1\|358620_360354_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380465
NZ_CP050975.1\|WP_168533194.1\|348580_349438_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	unknown	unknown	gnl\|CDD\|225002
NZ_CP050975.1\|WP_168525332.1\|340167_341391_-\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|168661
NZ_CP050975.1\|WP_168525336.1\|342735_343947_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP050975.1\|WP_168525334.1\|341624_342098_+\|DUF1772-domain-containing-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525357.1\|362612_363797_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525365.1\|368268_368958_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP050975.1\|WP_168525338.1\|344537_345422_+\|DUF817-family-protein	unknown	unknown	gnl\|CDD\|377545
NZ_CP050975.1\|WP_168525340.1\|350198_350435_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525343.1\|351270_351585_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214836
NZ_CP050975.1\|WP_168533196.1\|354426_356010_-\|acyl-CoA-carboxylase-subunit-beta	unknown	unknown	gnl\|CDD\|227136
NZ_CP050975.1\|WP_168525347.1\|356043_356241_-\|acyl-CoA-carboxylase-subunit-epsilon	unknown	unknown	gnl\|CDD\|379386
NZ_CP050975.1\|WP_168525361.1\|365499_366363_-\|AfsR/SARP-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|276938
NZ_CP050975.1\|WP_168525355.1\|362231_362579_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525353.1\|360407_360764_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168525359.1\|363819_364764_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176870
NZ_CP050975.1\|WP_168525363.1\|367182_367713_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP050975.1\|WP_168525367.1\|375359_376079_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235914

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168525349.1\|357185_358007_+\|AfsR/SARP-family-transcriptional-regulator	gnl\|CDD\|276938	cd15831, BTAD, Bacterial Transcriptional Activation (BTA) domain. The Bacterial Transcriptional Activation (BTA) domain is present in the putative transcriptional regulator Mycobacterium EmbR and the related Streptomyces antibiotic regulatory protein (SARP) family of transcription factors, which includes DnrI and AfsR, among others. Members of this family contain an N-terminal DNA-binding domain, followed by the BTA domain, and many have diverse domains at the C-terminus. EmbR contains an C-terminal forkhead-associated (FHA) domain, which mediates binding to threonine-phosphorylated sites in a sequence-specific manner. The BTA domain of EmbR contains three Tetratricopeptide repeats (TPRs) and two C-terminal helices. The TPR motif typically contains 34 amino acids, and 5 or 6 tandem repeats of the motif generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein.	9.08731e-60
NZ_CP050975.1\|WP_168525345.1\|353213_354038_-\|AfsR/SARP-family-transcriptional-regulator	gnl\|CDD\|276938	cd15831, BTAD, Bacterial Transcriptional Activation (BTA) domain. The Bacterial Transcriptional Activation (BTA) domain is present in the putative transcriptional regulator Mycobacterium EmbR and the related Streptomyces antibiotic regulatory protein (SARP) family of transcription factors, which includes DnrI and AfsR, among others. Members of this family contain an N-terminal DNA-binding domain, followed by the BTA domain, and many have diverse domains at the C-terminus. EmbR contains an C-terminal forkhead-associated (FHA) domain, which mediates binding to threonine-phosphorylated sites in a sequence-specific manner. The BTA domain of EmbR contains three Tetratricopeptide repeats (TPRs) and two C-terminal helices. The TPR motif typically contains 34 amino acids, and 5 or 6 tandem repeats of the motif generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein.	3.35827e-48
NZ_CP050975.1\|WP_168525351.1\|358620_360354_-\|hypothetical-protein	gnl\|CDD\|380465	cd19543, DCL_NRPS, DCL-type Condensation domain of nonribosomal peptide synthetases (NRPSs), which catalyzes the condensation between a D-aminoacyl/peptidyl-PCP donor and a L-aminoacyl-PCP acceptor. The DCL-type Condensation (C) domain catalyzes the condensation between a D-aminoacyl/peptidyl-PCP donor and a L-aminoacyl-PCP acceptor. This domain is D-specific for the peptidyl donor and L-specific for the aminoacyl acceptor ((D)C(L)); this is in contrast with the standard LCL domains which catalyze peptide bond formation between two L-amino acids, and the restriction of ribosomes to use only L-amino acids. C domains of nonribosomal peptide synthetases (NRPSs) catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains in addition to the LCL- and DCL-types such as starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity.	3.33187e-50
NZ_CP050975.1\|WP_168533194.1\|348580_349438_-\|4'-phosphopantetheinyl-transferase-superfamily-protein	gnl\|CDD\|225002	COG2091, Sfp, Phosphopantetheinyl transferase [Coenzyme metabolism].	1.19049e-24
NZ_CP050975.1\|WP_168525332.1\|340167_341391_-\|NAD(P)-binding-protein	gnl\|CDD\|168661	PRK06753, PRK06753, hypothetical protein; Provisional.	1.39563e-69
NZ_CP050975.1\|WP_168525336.1\|342735_343947_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.16099e-09
NZ_CP050975.1\|WP_168525365.1\|368268_368958_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	8.42308e-13
NZ_CP050975.1\|WP_168525338.1\|344537_345422_+\|DUF817-family-protein	gnl\|CDD\|377545	pfam05675, DUF817, Protein of unknown function (DUF817). This family consists of several bacterial proteins of unknown function.	1.22558e-110
NZ_CP050975.1\|WP_168525343.1\|351270_351585_-\|hypothetical-protein	gnl\|CDD\|214836	smart00825, PKS_KS, Beta-ketoacyl synthase. The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.	4.01538e-08
NZ_CP050975.1\|WP_168533196.1\|354426_356010_-\|acyl-CoA-carboxylase-subunit-beta	gnl\|CDD\|227136	COG4799, COG4799, Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism].	0
NZ_CP050975.1\|WP_168525347.1\|356043_356241_-\|acyl-CoA-carboxylase-subunit-epsilon	gnl\|CDD\|379386	pfam13822, ACC_epsilon, Acyl-CoA carboxylase epsilon subunit. This family includes the epsilon subunits of propionyl-CoA carboxylase, EC:6.4.1.3, and acetyl-CoA carboxylase, EC:6.4.1.2. These enzymes are involved in the biosynthesis of long-chain fatty acids. The epsilon subunit is necessary for an efficient interaction between the alpha and beta subunits of these enzymes.	4.56839e-07
NZ_CP050975.1\|WP_168525361.1\|365499_366363_-\|AfsR/SARP-family-transcriptional-regulator	gnl\|CDD\|276938	cd15831, BTAD, Bacterial Transcriptional Activation (BTA) domain. The Bacterial Transcriptional Activation (BTA) domain is present in the putative transcriptional regulator Mycobacterium EmbR and the related Streptomyces antibiotic regulatory protein (SARP) family of transcription factors, which includes DnrI and AfsR, among others. Members of this family contain an N-terminal DNA-binding domain, followed by the BTA domain, and many have diverse domains at the C-terminus. EmbR contains an C-terminal forkhead-associated (FHA) domain, which mediates binding to threonine-phosphorylated sites in a sequence-specific manner. The BTA domain of EmbR contains three Tetratricopeptide repeats (TPRs) and two C-terminal helices. The TPR motif typically contains 34 amino acids, and 5 or 6 tandem repeats of the motif generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein.	2.19536e-53
NZ_CP050975.1\|WP_168525359.1\|363819_364764_-\|hypothetical-protein	gnl\|CDD\|176870	cd08861, OtcD1_ARO-CYC_like, N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains. This family includes the N- and C- terminal aromatase/cyclase (ARO/CYC) domains of Streptomyces rimosus OtcD1 and related domains. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. ARO/CYC domains participate in the diversification of aromatic polyketides by promoting polyketide cyclization. They occur in two architectural forms, didomain and monodomain. Didomain aromatase/cyclases (ARO/CYCs), contain two ARO/CYC domains, and are associated with C7-C12 first ring cyclized polyketides. Streptomyces rimosus OtcD1 is a didomain ARO/CYC. The polyketide Oxytetracycline (OTC) is a broad spectrum antibiotic made by Streptomyces rimosus. The gene encoding OtcD1 is part of oxytetracycline (OTC) gene cluster. Disruption of this gene results in the production of novel polyketides having shorter chain lengths (by up to 10 carbons) than OTC. Monodomain ARO/CYCs have a single ARO/CYC domain, and are often associated with C9-C14 first ring cyclizations, these latter domains belong to a different subfamily in the SRPBCC superfamily.	7.7727e-22
NZ_CP050975.1\|WP_168525363.1\|367182_367713_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	3.25431e-09
NZ_CP050975.1\|WP_168525367.1\|375359_376079_+\|SDR-family-oxidoreductase	gnl\|CDD\|235914	PRK07041, PRK07041, SDR family oxidoreductase.	6.4366e-57

>NZ_CP050975.1|WP_168525347.1|356043_356241_-|acyl-CoA-carboxylase-subunit-epsilon
MGTPDQYEPVLRVERGRASEEELAALTVVLLALGAGGAPARRGRPVNGSRWWRRPRAYRGPRGWQ
>NZ_CP050975.1|WP_168533196.1|354426_356010_-|acyl-CoA-carboxylase-subunit-beta
MTTAPAPVEPGPTDIRGRVAELHAIREAARLGPSEKATAAQHAKGKLTARERIALLLDENSFQEVEQLRRHRATGFGLEAKKPYTDGVITGWGTVEGRTVFVYAHDFRIFGGALGEAHATKIHKIMDMAIAAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTKASGVIPQISVMLGPCAGGAAYSPALTDFVFMVRETSQMFITGPDVVKAVTGEEISQNGLGGADVHAETSGVAHFAYDDEETCLAEVRYLLSMLPQNNRENPPHTTAHDPAYCSEILLDLVPADGNRPYDMTKVIEELVDDGDHLEVHERWARNIICALARLDGQVVGIVANQPQTLAGVLDIEASEKAARFVQMCDAFNIPILTLLDVPGFLPGVDQEHGGIIRHGAKLLYAYCNATVPRISLILRKAYGGAYIVMDSQSIGADLTYAWPTNEIAVMGAEGAANVIFRRQIADAADPEAMRARMVKEYKAELMHPYYAAERGLVDDVIDPAETREVLIRSLAMLHAKHADLPSRKHGNPPQ
>NZ_CP050975.1|WP_168525345.1|353213_354038_-|AfsR/SARP-family-transcriptional-regulator
MDIDVLGALAVRENGVSITPTAPKPRQVLALLALRADQVVPVAALIEELWGNSPPRSARTTLQTYVLQLRELIAQALEHGRSGAKDVLMTLPGGYLLVSGGGSSDVREFERLAGEGYRAMDQGAFAEAARTLAGALQLWTGAAFADVQAGAQLAMETRRLEESRLCALDQRIEADLRLGRHRELLPELTVLTSRYRTHENLHAQFMLALHRSGRRSESLSVYHQLRATLVNDLGLEPSPRLRRLQHSIQTAAPETAAMPAPFDGAGPAAPARAR
>NZ_CP050975.1|WP_168525343.1|351270_351585_-|hypothetical-protein
MQGCFPYAGDLEAFWRHALQQHAPTASPPRGGDRFTDGTREFDAGLLALFGLDAAGAAALDCRERLLARSAWQTLESAGYAGARTDRLTGPDRTGRSVGVYIAA
>NZ_CP050975.1|WP_168525340.1|350198_350435_-|hypothetical-protein
MPRRAPGRRVRAADADAVLVVEEAPAAHRPPVRPPPRPTRHPAHAELVLLSAATPRQLAATAGQFARWLVSAAQHGGA
>NZ_CP050975.1|WP_168533194.1|348580_349438_-|4'-phosphopantetheinyl-transferase-superfamily-protein
MAPVPASAAVPVAGADAGTDEPVKLWLCPNDGLPPAVAGLLAAHWLDAQEQKTASRFLFERDRRQYLLAHTLVRRALALEAGLAEAELVIWRSARGRPFLRPAPGELPRGGAQLDFNLSHAGGYSLLGIVRRHRIGVDVERLEDRDERAITTIVRTFAAPEREWVERAAPGPDRDRRALRVWTLKEAYSKARGLGLGLPFDAFVFTLDDERGVRAFTPPADDTARPWRFVELEPVPGVLVAVAVPADAAQDPVLHLGYGFPWSRSELRSFPLPRPVGGHLAAVPA
>NZ_CP050975.1|WP_168525338.1|344537_345422_+|DUF817-family-protein
MDRIGYRSGTHLRQLAGFAWVQARCCAFSCALLGALAISVLLPPLPVARYDLLLAYGVVLTGVGFALGWETSREVAVVAVCHVLGLAFELVKVRAGSWSYPQPALTKVAGVPLYGGFMYAAVGSYVCRSWRLLDLALTGYRARVTAVLAGGLYLNFLTRHWLLDVRWLLGGLLLAATAGVRVHFTVGAHRHRMPLALSFVLIGFFLWLAENIATYFGAWRYPYQLHGWEPVSASKWISWALLISVTFVICRARHPARPGDPAQNQTSKLTPGPGLRAGQARGRAAGGRRPDSKA
>NZ_CP050975.1|WP_168525336.1|342735_343947_-|helix-turn-helix-domain-containing-protein
MLRQPAFGNRLKKLRTARGLSQTALAGEGMSTGYLSRLESGARQPTDRAVAYLADRLGLKAADFEEPVTGSLAHALTLASSTGSADAIEALRSALAAEGHESAVLRWQALWLLARAARLQGDHAAERAHLGHLVALGDEVGLAELRVRGLTRLARCLRSLGEITPALDAAVAAHRLALGEDLGVEDRAAALLALVSVQAEAGQVPEARVHADELTALVEGRSDALWAEAMWTAAAVRVRQGDHTGAQHCLDEALERFSSQEDLVLWLRLRLAAGRLHLQKLPADPAQAQRCAEQAEAALAFVGTPALRQDLTALKADLAFATGRYDDARALLGGLAGDEPRMTYRDRVRLEILRQQLLILGGDVSGVDGLRTLAQQAQADANIDLAAEIWRTLADALTPAPPA
>NZ_CP050975.1|WP_168525334.1|341624_342098_+|DUF1772-domain-containing-protein
MEALVQTLAVVATMANAVVYGTDVFSAIVQRPALAHVDDAVLTSTMGQIHRFGDRRMPVPGVFGLVATVATAVAAGFGGRTAPAVAAGVAALALVVWLAVYNKVSAPVNKELTGAALDCRTAPDARGLQRTWDSVINARVVLQAVALGAMCVALVTS
>NZ_CP050975.1|WP_168525332.1|340167_341391_-|NAD(P)-binding-protein
MAIGRARRVLIAGGGIGGLAAALALQRSGVECVVFERAEELRDGGAGLHIWTNGVLALDCLGVAGQVLETAPAQQVAHFSTDRGEVLGAWPVGDFVERYGAPTIAVERSVLHGVLRDALEGSVVRTGAHVVGFDQDEDGVTVRFADGGSERGDLLIGADGIHGTVRDCLFGPADNRYSGYIAWRGRSPLQHPGIPPGTFNAMFGRGVRFTYYDVAPGLVHWMSVANGPAGGRDEPGVREMLLRRHRGWGGPVADILAATPEEGIIRGDVEGRRPERRWGHGRVTLLGDAAHPITFNIGQGACQALEDALVLAEHLEHAGSDPVAALRRYEKERRARTAPLQRIAWRIGRMGAVEHPLLIRAREAFMRKNWNTKAFAAAEKGQVAYGTRWARGTRPTGPVPAPRTTVD
>NZ_CP050975.1|WP_168525349.1|357185_358007_+|AfsR/SARP-family-transcriptional-regulator
MRIQVLGPLSAEVNGGSIVPSAGKPRQILSLLALYPGRVMPVPTLMEEIWATQPPQSALTTLQTYILQLRRRLGTAMGPGAPGGAKEVLATRHGGYLLQIPPDSVDVHQYDRLTREGQTAFESGDDEVSAARFREALGLWEGPALVDVRLGPVLEIEVVRLEESRLVTVERRIDADLRLGRHAELIAELIELTARHPQHEGLHSQAMVALYRSGRQASALEVYRRLRVRLIEDLGVEPSPQLQRLHQAVLTVDPQLDVLAGPRHSSTYDLFTA
>NZ_CP050975.1|WP_168525351.1|358620_360354_-|hypothetical-protein
MDSTGGMDGTGGADSADGAGGAGGGGGTGGAGGGGGHLEQLYWDWSGPLDVARFAAAWQSVVDRESVLRACFDWVASPRLVLHARADADIAVHSRTAVTWAQLLRRDRARGFALHRPGLLRLTLLRGASSATALTCPRVLLTYHPALLDERGVHLLLREFYRAYAAGGVLPGGERRPDLRDHARWLAGQNTDAARQFWARAAPPRHAATRPGKPGGKTGQHGPGLLHTRLRAAQTFRLRSWAALRGVAESSALHLVWALLLYRAADARGPLPVSFGVQLSGRDIALPGAAGIPGPLDGPLPMTVTVDPDASLTGLLHQVRDTLLDLAAYPWAGAESIRAWSGGAPSPSASRSGLFTDTFTDPCADTLVRFEGPFLLPQALRGELAAQGIDVQSPRTRPRPALTLTARHDTEGGLALSAVHDRARLADEDAAALHAQCVRLLRALPGYRDAAATAGQLLDVLARAAVPRMARPAPPPPRPALSVLRPGHPHADVICLVVVPGVPGGSYDLFVRGHRGPERIVAVHAEGAPGAPQAVLHQARGPGRAAGAVRVRSRRAGGLRTRPAPAVCRRTPLRPWS
>NZ_CP050975.1|WP_168525353.1|360407_360764_-|hypothetical-protein
MSSRYAPRGAVLAVVHEPGTPAPGGPLVLELCGPLGPADAETVAARLAQRHRAFDVALDSHRPGRHILRLTPPAAAPDGVPLPAELLADVLAPPPPGGEVLPVTGHQQTLLTAALAPA
>NZ_CP050975.1|WP_168525355.1|362231_362579_-|hypothetical-protein
MARRLLSEQRALRRPCRAAGLDGPDGPAVRALADRQALLWLAAAVLGVQEAADEGRGLFLGGPHWALLALSGITERLGVPLPAPAADPREQVWAELAGRVRHGVDCDIYATRVLW
>NZ_CP050975.1|WP_168525357.1|362612_363797_-|hypothetical-protein
MAVTRPAPRPVPAALPTGPAPAPGPGPGPGPGRGSGSGSGAVVPKPRRAVAHRYAALPPPLEVALAALRLEALLGDPRDAANPYGLPALTTSRTTTGSITGRAGGVGGAGEDRAGLLAAAGLGRIRAADQLVRALRPVLRRDVALGHACARPRAMPGARRAAGPCGTAGRHRYGAAPGRADRGLSRCHGEPALRQWRPVLATVFADLLACESLTSVALRRPAGPASGALLPAVAGYVVPTVVADVLAQLDLVLTECGHGPAGLEGRMLAKLAYDLPRLSVDAAAAGSWQTHLVRALLKTGPKPRPATHRPPGPVPARRPRPRPRPRPRSCRRSRLRYRPPSRLRFRPRVRRHAAAPGANRQHGQHGLDGLDGDGESGAGTVWCCRGCRVPPSVR
>NZ_CP050975.1|WP_168525359.1|363819_364764_-|hypothetical-protein
MEVAAPAGVVYGLLADAVRWPVFLPSHVHVERLDFDGTQERLLVWEVAEEAGAPGGHVRSWHTRRVLRPQDRSVVFEEEDQARPGMVTSGVWTVRPAGETRCVLSLRQERVLPVLLAAGDSRLRGDAAADVQRRLGQVRGAAEQWEELDELLLSFEDRIRVEGPAELVYDFLYRVEDWPERLPHVEGTRVREDAPGIQVVLVDTCAAEGAGTVTTRAVRLCFPHAGRIVFKETRPPRLLAAHSGEWSLLPDASGVTVVAAHRVMLRQDAVAGELGENTSLLEARRHVHGWLSRADRQALGLAKWHAESTVRRLR
>NZ_CP050975.1|WP_168525361.1|365499_366363_-|AfsR/SARP-family-transcriptional-regulator
MDTDILGTLAVREKGISITPTAPKPRQVLALLVLHADQMVPVGMLSEELWGAQPPRSARPTLQTYILQLRELITAALEGDPGGHRSAKDVLLTAPGGYLLKSGEGSSDVREFERLAGLGYRAMDGADFPGAARHLRAALALWSGPPLADVQAGPHLATQVKRLEESRLCALDQRIEADLRLGRHRELLAELTVLVSRYPTHESLCGQYMLALYRSGRRGEALDAYQRLRATLVRGLGLEPSAALGKLQRSILMARPDGSPATTTAGAAPAAPGTGPAGSGRLAAPVG
>NZ_CP050975.1|WP_168525363.1|367182_367713_-|TetR-family-transcriptional-regulator
MVKQVRAARTRQALVRAAAEVFADDGYALASLLTISKRAGVSTGALHFHFPSKDLLAREVEAAATVSLQRLAARRDAPPGRAAGGPAGTGGAGAGLQLLVDVSRELVLGLSSDPVLRAGFGLGGDPSRKSGEGPGRWWSEWVHALLREAHGAGELAEGVSPEAAAVAVIAATLGLA
>NZ_CP050975.1|WP_168525365.1|368268_368958_-|TetR-family-transcriptional-regulator
MVRQERAIRTRRAILNAAASVFDERGYEAATIGEVLTRAGVTKGALYFHFPSKQALAEGVLAEQFSGFTLAPRASKLQELVDMGLSLAYRMRRNPVVSASARLSLGQEMGAIFGTWTITTWLDATEKVLREAREQGELLPHVDPAESAWVFSAAWTGVQVYSHTLAGREDLERRVSALFEHLLPSIAVPAVLGKLVTDPARAAEVAAEGERLAAEAGELGDLDEVAAPA
>NZ_CP050975.1|WP_168525367.1|375359_376079_+|SDR-family-oxidoreductase
MTGPLKGTTALVVGRAGGIARAIVIAARDAGADVVAAGRDQKTLADAYAGEPGITTESVDLTDEASVAALGERLGTVDHVVSTASARARGRVADLDRDAVRLSFDTKVIGPLMLAKHLAPRIPASGSFTLFSGVAAAKIAVGTLAVAITNGAAEVLARSLALELAPIRVNAISPGVIDTGAWDGFGEEGKAEYFAGIRARNPARRIGTTDDVASAVLFAMTSTFLTGETVHIDGGEPLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_3

2283962-2284075

Orphan

Consensus_repeat	Method
GTCGTCACGACGCGGGCCGCTCGGCCGGTCGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_3

>merge|NZ_CP050975|3|2283962-2284075|CRISPRCasFinder
GTCGTCACGACGCGGGCCGCTCGGCCGGTCGTCGCGGTTGAAGGAGGGACGGTCGCCGTCCCGGCGGAAGCCACCGCCGCGGTCGTCACGGCGCGGGCCGCTCGGCCGGTCGTC

>NZ_CP050975|3|2|2283962-2284075|CRISPRCasFinder
GTCGTCACGACGCGGGCCGCTCGGCCGGTCGTC	GCGGTTGAAGGAGGGACGGTCGCCGTCCCGGCGGAAGCCACCGCCGCG
GTCGTCACGGCGCGGGCCGCTCGGCCGGTCGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168527410.1\|2274857_2275673_-\|TlyA-family-rRNA-(cytidine-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|224110
NZ_CP050975.1\|WP_168527418.1\|2290371_2291013_-\|DNA-3-methyladenine-glycosylase	unknown	unknown	gnl\|CDD\|376746
NZ_CP050975.1\|WP_168527425.1\|2297318_2297564_-\|DUF320-domain-containing-protein	unknown	unknown	gnl\|CDD\|367652
NZ_CP050975.1\|WP_168533484.1\|2265282_2267085_+\|glycoside-hydrolase-family-15-protein	unknown	unknown	gnl\|CDD\|225922
NZ_CP050975.1\|WP_168527422.1\|2293314_2294250_-\|SPFH/Band-7/PHB-domain-protein	unknown	unknown	gnl\|CDD\|223407
NZ_CP050975.1\|WP_168527414.1\|2277315_2278359_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|227119
NZ_CP050975.1\|WP_168527411.1\|2275728_2276046_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527423.1\|2294944_2295736_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224044
NZ_CP050975.1\|WP_168527426.1\|2297712_2298354_-\|response-regulator	unknown	unknown	gnl\|CDD\|225107
NZ_CP050975.1\|WP_168527412.1\|2276088_2276436_+\|sterol-binding-protein	unknown	unknown	gnl\|CDD\|379708
NZ_CP050975.1\|WP_168527416.1\|2280674_2281967_+\|DUF1015-family-protein	unknown	unknown	gnl\|CDD\|377633
NZ_CP050975.1\|WP_168527421.1\|2292715_2293222_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|224321
NZ_CP050975.1\|WP_168527420.1\|2292023_2292557_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|182339
NZ_CP050975.1\|WP_168527409.1\|2273955_2274861_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|235121
NZ_CP050975.1\|WP_168527415.1\|2278355_2279399_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|182464
NZ_CP050975.1\|WP_168527417.1\|2282032_2282857_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|235640
NZ_CP050975.1\|WP_168527413.1\|2276440_2277304_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP050975.1\|WP_168527419.1\|2291198_2291984_+\|sporulation-protein	unknown	unknown	gnl\|CDD\|369195
NZ_CP050975.1\|WP_168527427.1\|2298346_2299492_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|226951
NZ_CP050975.1\|WP_168527424.1\|2296873_2297113_-\|DUF320-domain-containing-protein	unknown	unknown	gnl\|CDD\|367652

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168527410.1\|2274857_2275673_-\|TlyA-family-rRNA-(cytidine-2'-O)-methyltransferase	gnl\|CDD\|224110	COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis].	7.30707e-102
NZ_CP050975.1\|WP_168527418.1\|2290371_2291013_-\|DNA-3-methyladenine-glycosylase	gnl\|CDD\|376746	pfam02245, Pur_DNA_glyco, Methylpurine-DNA glycosylase (MPG). Methylpurine-DNA glycosylase is a base excision-repair protein. It is responsible for the hydrolysis of the deoxyribose N-glycosidic bond, excising 3-methyladenine and 3-methylguanine from damaged DNA.	1.55325e-90
NZ_CP050975.1\|WP_168527425.1\|2297318_2297564_-\|DUF320-domain-containing-protein	gnl\|CDD\|367652	pfam03777, DUF320, Small secreted domain (DUF320). Small domain found in a family of secreted streptomyces proteins. It occurs singly or as a pair. Many of the domains have two cysteines that may form a disulphide bridge.	1.36164e-16
NZ_CP050975.1\|WP_168533484.1\|2265282_2267085_+\|glycoside-hydrolase-family-15-protein	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	1.23925e-134
NZ_CP050975.1\|WP_168527422.1\|2293314_2294250_-\|SPFH/Band-7/PHB-domain-protein	gnl\|CDD\|223407	COG0330, HflC, Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones].	8.97396e-68
NZ_CP050975.1\|WP_168527414.1\|2277315_2278359_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|227119	COG4779, FepG, ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism].	3.37769e-109
NZ_CP050975.1\|WP_168527423.1\|2294944_2295736_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224044	COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism].	2.4211e-93
NZ_CP050975.1\|WP_168527426.1\|2297712_2298354_-\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.63219e-81
NZ_CP050975.1\|WP_168527419.1\|2291198_2291984_+\|sporulation-protein	gnl\|CDD\|369195	pfam07070, Spo0M, SpoOM protein. This family consists of several bacterial SpoOM proteins which are thought to control sporulation in Bacillus subtilis.Spo0M exerts certain negative effects on sporulation and its gene expression is controlled by sigmaH.	4.18283e-107
NZ_CP050975.1\|WP_168527416.1\|2280674_2281967_+\|DUF1015-family-protein	gnl\|CDD\|377633	pfam06245, DUF1015, Protein of unknown function (DUF1015). Family of proteins with unknown function found in archaea and bacteria.	6.91916e-123
NZ_CP050975.1\|WP_168527421.1\|2292715_2293222_+\|HNH-endonuclease	gnl\|CDD\|224321	COG1403, McrA, Restriction endonuclease [Defense mechanisms].	8.32953e-17
NZ_CP050975.1\|WP_168527420.1\|2292023_2292557_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|182339	PRK10257, PRK10257, putative kinase inhibitor protein; Provisional.	6.1523e-61
NZ_CP050975.1\|WP_168527409.1\|2273955_2274861_-\|NAD-kinase	gnl\|CDD\|235121	PRK03372, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	7.66806e-171
NZ_CP050975.1\|WP_168527415.1\|2278355_2279399_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|182464	PRK10441, PRK10441, Fe(3+)-siderophore ABC transporter permease.	2.43609e-91
NZ_CP050975.1\|WP_168527417.1\|2282032_2282857_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|235640	PRK05901, PRK05901, RNA polymerase sigma factor; Provisional.	6.627e-07
NZ_CP050975.1\|WP_168527413.1\|2276440_2277304_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.88903e-135
NZ_CP050975.1\|WP_168527412.1\|2276088_2276436_+\|sterol-binding-protein	gnl\|CDD\|379708	pfam14864, Alkyl_sulf_C, Alkyl sulfatase C-terminal. This domain is found at the C-terminus of alkyl sulfatases. Together with the N-terminal catalytic domain, this domain forms a hydrophobic chute and may recruit hydrophobic substrates.	6.09599e-06
NZ_CP050975.1\|WP_168527427.1\|2298346_2299492_-\|GAF-domain-containing-protein	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	5.57258e-52
NZ_CP050975.1\|WP_168527424.1\|2296873_2297113_-\|DUF320-domain-containing-protein	gnl\|CDD\|367652	pfam03777, DUF320, Small secreted domain (DUF320). Small domain found in a family of secreted streptomyces proteins. It occurs singly or as a pair. Many of the domains have two cysteines that may form a disulphide bridge.	5.54163e-15

>NZ_CP050975.1|WP_168527417.1|2282032_2282857_-|tetratricopeptide-repeat-protein
MVARLIDEDPEGAYAYSRIALRLASRVAAVREAAGFAAYASQKYSEALAEFRAARRMTGNVDLWPVMADCERGMGRPEKALDMAGAPDVQKLDKAGQVEMRLVAAGARRDMGQLDAAIVTLQSPELASHSVQPWTPRLRYAYADALLAAGREDEAREWFAKAVESDKDGSTDASDRLAELDGVEFVDALVEDESESEADSGTGAEPTSVREADRVIQAEIDEVDEVDEIDDVDDEDLADDDLDDAEDERDEERNEEREDEGDDDDGHDEGAPRG
>NZ_CP050975.1|WP_168527416.1|2280674_2281967_+|DUF1015-family-protein
MNTAGPAEETPVRSGLELAPFRGVRYDPDRVGSLAAVTSPPYDVIVRPDGLLHLESADPHNIVRLILPQDATPHARNRQAADTLHAWLSKGVLTTDPEPGLYVYEQRDDDMLQRGIIGTLRLSEPADGVVLPHEDVMPHIVADRAALMRATSANLEPLLLTYRGTGSRVGTAAVIERTAEREPLLSTTTEDGLSHRLWAITDAADLAEIQTDLGHHQALIADGHHRWATYLRLRSEHPSPSPWDFGLVLLVDTARYPLRVRAIHRLLHGLPVSEALAALTDSFRVRHLDVPLAKALEALASAAAESNAFLLAGDGSFHLVDRPDPDLLTRTIPADHPEAWRTLDATVLHATLLAHVWGIPEDSPAHIAYIHDTEATVAKAELDGGTAVLLHPVHEEVVRDLARQGVTMPRKSTSFGPKPASGLVLRALAD
>NZ_CP050975.1|WP_168527415.1|2278355_2279399_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MLVDSPPQQRAETAPAPPNRWAIRAVGLVVSAAVLVLVALASIAIGAKALPLDQVWHGLFHDSGTYADVVVGDRLSRTVLGLLVGAALGLSGAVLQALTRNPLADPGLLGINAGASAAVVTAITYFGVTSLSGYVWFAFFGAAAVGALVWFLGGSRGATPVRLALAGTAISAALYGYLQAVMIMDDAALGKMRFWTVGSLASATDSTIRQVLPFLVAGTVLALGLARPLNAMAMGDDTARALGANLNRTRALSMAAATVLCGAATAACGPIVFVGLMVPHVVRSFTGPDLRWILPYATVLSPVLLLGADVLGRIIARPAELQVGIVTAVLGGPVFIYLVRRRRTAQL
>NZ_CP050975.1|WP_168527414.1|2277315_2278359_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MSTTRTRSLRARGGLSVRFDVRALVVVVLLLVAALAASVVLIGTGDFPIPAADVLRTLAGDGNAGQEFIVNELRLPRVLVGLLVGASLGLGGAIFQSVSRNPLGSPDVLGLGQGATAGALIMIVLFSGTANQVALGAFVGGLVTGVAIYLLAWKRGVHGYRLVLVGIGVSAIVTAVNGYLLTKADLVDAARAVVWMTGSLNGRDWAQVWPLLAMCAVLVPLVLGNARGLRMMEMGDDVSYALGVRVERVRLLLMLSAVLLTAGATAAAGPVGFVALTAPQLARRLTRSPGPNLVPSMCMGAALLIVADWASQRAFGADQLPVGVVTGVLGGIYLLWLLVTERKAGRI
>NZ_CP050975.1|WP_168527413.1|2276440_2277304_-|ATP-binding-cassette-domain-containing-protein
MSGPNMSAPANEKPQRSTVNRLSADNVTLGYDQRVIAEKLSVEIPDHSFTVIVGPNACGKSTLLRALSRMLKPSEGRVLLDGQVIQSMPAKKVARTLGLLPQSSIAPDGITVGDLVGRGRYPHQGLLRQWSTQDERVVRESMASTGVAELADRYVDELSGGQRQRVWIAMALAQQTPLLLLDEPTTYLDIQHQIDVLDLCAELHEERGRTLVAVLHDLNHAARYATHLIALREGRVVAEGAPRDIVTAELVEEVFGLRCQVIDDPETGTPLVVPAARRARVAVTEGS
>NZ_CP050975.1|WP_168527412.1|2276088_2276436_+|sterol-binding-protein
MATTEECRAALDKLSDNLAGAEGDVRSAAALDRSLSCRITDLDITFVGRLADGRIEVLDTVAGPPREKAQIRLTMSGDDLVAMVNGNLHFAKAWGSGRVKLEAGLLDLFRLRSLL
>NZ_CP050975.1|WP_168527411.1|2275728_2276046_-|hypothetical-protein
MNESVPESGAVPEAEAGVLPEDARDAIELSYDPAAPAPLDVERVPTGSAEVDAQLDRLGDADHLATDGHLEVYEDVHRGLRDALTELDARPGPPVPTRHPTTAPQ
>NZ_CP050975.1|WP_168527410.1|2274857_2275673_-|TlyA-family-rRNA-(cytidine-2'-O)-methyltransferase
MAGVARRRLDAELVRRKLARSREHAGQLIAAGRVTVGKTLATKPATQVETAAAIVVTRDDNDPDYVSRGGHKLAGALAAFVPRGLRVEGRRALDAGASTGGFTDVLLRAGAAHVVAVDVGYGQLAWSLQSDERVTVKDRTNVRELTLEAIDGEPVDLVVGDLSFIPLGLVLPALVRCAAPDADLVMMVKPQFEVGKERLGSGGVVRSPELRAEAVRGVAGRAAELGLGVEGVTASPLPGPSGNVEYFLWLRAGSPELDPADVDRAVAEGPR
>NZ_CP050975.1|WP_168527409.1|2273955_2274861_-|NAD-kinase
MTQTRARTVFLLAHTGRPAAIRSAELVVQGLLRSGLGVRVLEAEAADLPLPPEVELVREATPQCLDGCELLIVLGGDGTLLRGAEFARASGVPMLGVNLGSVGFLAEAERDDLDKVVDRVVTRAYEVEERMTVDVVVHRNGDIVHTDWALNEAAVQKVSAEKLLEVILEIDGRPVTGFGCDGIVCATPTGSTAYAFSAGGPVVWPEVEALLMVPISAHALFAKPLVTSPDSVLAVEVLPHIPPGVLWCDGRRTVELPPGARVEVRRGAVPVRLARLHHASFTDRLVAKFALPVAGWRGAPH
>NZ_CP050975.1|WP_168533484.1|2265282_2267085_+|glycoside-hydrolase-family-15-protein
MAGRIEDYALIGDMQTAALVCRDGTVDWLCLPRFDSHAIFAGLLGTEEHGFWRLGPAHAADAEPPMAARRSYRGDSLILESEWDTPRGTVRVTDFMPPRDGAPQLIRIVEGVTGRVPMRSALRMRFSYGRVVPWVHKHEGRTVAVAGPDSVWFDTPCETYGKALTTYADFTVAPGDRIAFTISWEPSHKRPPALPEPEQALEATEEFWRDWVDQCTYHGPYREAVVRSLITLKALTYAPTGGIVAAPTTSLPEEIGGVRNWDYRYTWLRDAAITLSSLLRTGYREEARAWREWLLRAVAGDPENLQIMYGIAGERELGEAELDWLPGYENSGPVRVGNGAAHQLQLDVYGEVTEALHLAHMTGLSRNDYASLLQLKLIRYLEDHWDQPDEGIWEVRGPRRHFVHSKVMAWVAVDRTIKLIESGDADGPLEKWRELRDDIHRDVCEKGYDKERNTFTQSYGSRELDASLLLIPQMGFLPPDDKRVIGTIEAIQRELSTSDGFILRYPTSGEDAGVDGLEGDEGAFLACSFWMADDLAMIGRVDEARKLFERLLALRNDLGLLAEEWDPRLQRQVGNFPQAFSHVPLIDTALRLTASGAYGG
>NZ_CP050975.1|WP_168527418.1|2290371_2291013_-|DNA-3-methyladenine-glycosylase
MIAAPDRTPLTREFFDRPVLEVAPDLLGRVLVRTTPDGPIELRLTEVEAYDGPDDPGSHAYRGRTARNGVMFGPPGHVYVYFTYGMWFCMNLVCGPAGRPSGVLLRAGEVVEGAELARKRRLSARNDKELAKGPARLATALDVDRSLDGTDACAPEGGPLTMLTGAPVSSDQVRSGPRTGVSGDGGVHPWRFWVANDPTVSPYRAHTPRRRST
>NZ_CP050975.1|WP_168527419.1|2291198_2291984_+|sporulation-protein
MGFKRLLASLGAGGASVETVLTEVNVVPGGVVQGEVRIQGGSVNQAIEGLSVGLQAKVEVEGHDDQEYKQDIEFAKLRLGGAFELQAGAVHAVPFGLDIPWETPITTIDGQSLRGMHIGVTTELEIARAVDSGDLDPINVHPLPAQQAILNAFIQLGFRFKNADMERGHIRGTRQKLPFYQEIEFFPPSQYRGLNQVELSFVADDRAMDVILEMDKKPGLFSEGSDSYRSFEVGLHDFQGTDWAAYLNQWLSEVGSKRSWF
>NZ_CP050975.1|WP_168527420.1|2292023_2292557_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MTELKRAPLPHDFHPPVPAFTVTSEDVASGAVLKDAQVYAAGNTSPQLSWEGFPAGTKSFAVTCFDPDAPTGSGFWHWVVFDIPASVTELTTGAGSGKFEGLPEGAVQVRNDYGTKDFGGAAPPAGDPAHRYLFTVYAVDQEKLGPDADASPAYVGFNLRFHTLARAHLMGEYAAPA
>NZ_CP050975.1|WP_168527421.1|2292715_2293222_+|HNH-endonuclease
MRDTLVLNASFEPLSTVTLNRAVVLVLQDKAVVEQAHPELRMRGAALDIPVPRVIRLCRYVRVPFRRQAPWSRRGVLVRDRHRCAYCGRRATTVDHVVPRAQGGQDSWLNTVASCAEDNHRKAARTPEQAGMPLLRQPFEPTPADAMLLTLDRDDLDALPQWLVQPAA
>NZ_CP050975.1|WP_168527422.1|2293314_2294250_-|SPFH/Band-7/PHB-domain-protein
MAPIIIVLIILVVLVFIALIKTIQVIPQASAAIVERFGRYTRTLNAGLNIVVPFIDSIRNRIDLREQVVPFPPQPVITQDNLVVNIDTVIYYQVTDARAATYEVASYIQAIEQLTVTTLRNIIGGMDLERTLTSREEINAALRGVLDEATGKWGIRVNRVELKAIEPPTSIQDSMEKQMRADRDKRAAILTAEGIRQSQILTAEGEKQSAILRAEGEAKAAALRAEGEAQAIRTVFESIHAGDADQKLLAYQYLQMLPKIAEGDANKLWIVPSEIGDALKGLSGAMGNFGPMGGGSGSGGSERREKPSVTD
>NZ_CP050975.1|WP_168527423.1|2294944_2295736_-|ATP-binding-cassette-domain-containing-protein
MSDVLELEDVSVVREGRALVDQVSWSVKEGERWVILGPNGAGKTTLLNLASSYLFPSQGTATILGETLGKVDVFELRPRIGVAGIAMAEKLPKRQTVLQTVLTAAYGMTAGWHEDYEDIDEQRARAFLDRLGMSDYLDRRFGTLSEGERKRTLIARALMTDPELLLLDEPAAGLDLGGREDLVRRLGRLARDPIAPSMIMVTHHVEEIAPGFTHVLMIRQGKVLAAGPLELELTSRNLSRCFGLPLVVEQVGERWTAQGLPMA
>NZ_CP050975.1|WP_168527424.1|2296873_2297113_-|DUF320-domain-containing-protein
MNIAKKAAMALTVAGIAAGASAGAAVADAGAQGGAAQSPGVVSGNVIQAPIHIPVNVVGDSVNVVGLLNPAFGDRGANG
>NZ_CP050975.1|WP_168527425.1|2297318_2297564_-|DUF320-domain-containing-protein
MKNLKKATAVAMVAGGLVAAGAGMASATDGSWAGGQAAGSPGVVSGNVIQAPIHIPVNAVGNSVNVIGVLNPAFGNLGLNH
>NZ_CP050975.1|WP_168527426.1|2297712_2298354_-|response-regulator
MAEAIKVLLVDDHQVVRRGLRTFLEVQDDIEVVGEASDGAEGVARAEELKPDVVLMDVKMPGMDGIDALRRLRELANPARVLIVTSFTEQRTVIPALRAGAAGYVYKDVDPDALAGAIRSVHAGHILLQPEVAGVLLSQEEANSGQGRGGSLTEREREVLGLIADGRSNREIARALVLSEKTVKTHVSNILMKLDLADRTQAALWAVRHGAAG
>NZ_CP050975.1|WP_168527427.1|2298346_2299492_-|GAF-domain-containing-protein
MSQGPRSGLYAVSSALLAMSRHLEVRDVLKTIVASARELLDAQYAALGVPDDHGGFAQFVVDGVSDAQWKAIGPLPRQHGILAAMLHEARPERLADVRRDPRFEGWPAAHPDMSDFLGLPVRDGDETIAALFLANKNGTRPDGGCGFTEDDEELLTILAQHAAIALTNARLYERSRELTIAEERSRLAHELHDAVSQKLFSLRLTAQAAAALVDRDPARAKGELHQVAALAAEATEELRAAVIELRPAALDEDGLVATLRTQIQVLDRAHSAHVTFTGRGVRALPAAQEEAMLRVAQEALHNALRHSGAARVDVLLEKRGPGAVLRVTDDGDGFDPTAIRTAGRHLGLVSMRDRSSGVGGTLTVESAPGKGTTIEMEVPGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_4

2733155-2733333

Orphan

Consensus_repeat	Method
GGGGTCCTGCGCAGTTCCCCGCGCCCCTGAGGAG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP050975_4

>merge|NZ_CP050975|4|2733155-2733333|PILER-CR
GGGGTTCTGCGCAGTTCCCCGCGCCCCTGAGGAGGGGGTGGGGGCCACTGTGCGCGGGAATGTGCGGGAGCGCTGTGGCTGAGCGCGCGGTTCCCCGCGCCCCTGAGGAGTCGACGGGGCGGCCGTGAATGCGTGCGGGGCGCCGGGGGTCCTGCGCCGTTCCCCGCGCCCCTGAGGGG

>NZ_CP050975|4|1|2733155-2733333|PILER-CR
GGGGTTCTGCGCAGTTCCCCGCGCCCCTGAGGAG	GGGGTGGGGGCCACTGTGCGCGGGAATGTGCGGGAGCGCTGTGGCTGAGC
GCGCGGTTCCCCGCGCCCCTGAGGAGTCGACGGG	GCGGCCGTGAATGCGTGCGGGGCGCCGGGGGTCCT
GCGCCGTTCCCCGCGCCCCTGAGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168527742.1\|2739845_2741195_-\|RNA-binding-protein	unknown	unknown	gnl\|CDD\|377585
NZ_CP050975.1\|WP_168527740.1\|2737126_2738158_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366353
NZ_CP050975.1\|WP_168527739.1\|2735897_2737094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527738.1\|2734632_2735865_+\|DUF2029-domain-containing-protein	unknown	unknown	gnl\|CDD\|378217
NZ_CP050975.1\|WP_168527737.1\|2733338_2734481_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340831
NZ_CP050975.1\|WP_168527735.1\|2729571_2731368_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341233
NZ_CP050975.1\|WP_168527733.1\|2727923_2728370_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176861
NZ_CP050975.1\|WP_168533542.1\|2741599_2742331_+\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|366759
NZ_CP050975.1\|WP_168527741.1\|2738382_2739423_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366353
NZ_CP050975.1\|WP_168527734.1\|2728477_2729275_-\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277338
NZ_CP050975.1\|WP_168527730.1\|2723885_2724638_-\|endonuclease	unknown	unknown	gnl\|CDD\|226098
NZ_CP050975.1\|WP_168527732.1\|2726029_2726500_-\|DUF5304-family-protein	unknown	unknown	gnl\|CDD\|375065
NZ_CP050975.1\|WP_168527744.1\|2744680_2745745_-\|anthranilate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234682
NZ_CP050975.1\|WP_168527729.1\|2723060_2723765_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239486
NZ_CP050975.1\|WP_168533540.1\|2721263_2722043_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP050975.1\|WP_168527743.1\|2741229_2741469_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527731.1\|2725021_2725975_-\|ROK-family-glucokinase	unknown	unknown	gnl\|CDD\|273246
NZ_CP050975.1\|WP_148013620.1\|2742327_2742609_+\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366431
NZ_CP050975.1\|WP_168527736.1\|2731407_2732991_-\|GMC-family-oxidoreductase	unknown	unknown	gnl\|CDD\|225186
NZ_CP050975.1\|WP_168527728.1\|2722258_2723068_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224561

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168527742.1\|2739845_2741195_-\|RNA-binding-protein	gnl\|CDD\|377585	pfam05991, NYN_YacP, YacP-like NYN domain. This family consists of bacterial proteins related to YacP. This family is uncharacterized functionally, but it has been suggested that these proteins are nucleases due to them containing a NYN domain. NYN (for N4BP1, YacP-like Nuclease) domains were discovered by Anantharaman and Aravind. Based on gene neighborhoods it was suggested that the bacterial YacP proteins interact with the Ribonuclease III and TrmH methylase in a processome complex that catalyzes the maturation of rRNA and tRNA.	5.7122e-14
NZ_CP050975.1\|WP_168527740.1\|2737126_2738158_-\|hypothetical-protein	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	1.02953e-31
NZ_CP050975.1\|WP_168527738.1\|2734632_2735865_+\|DUF2029-domain-containing-protein	gnl\|CDD\|378217	pfam09594, GT87, Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.	1.16818e-05
NZ_CP050975.1\|WP_168527737.1\|2733338_2734481_-\|glycosyltransferase	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	3.51135e-68
NZ_CP050975.1\|WP_168527735.1\|2729571_2731368_+\|AMP-binding-protein	gnl\|CDD\|341233	cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases. This family includes long-chain fatty acid (C12-C20) CoA synthetases and Bubblegum-like very long-chain (>C20) fatty acid CoA synthetases. FACS catalyzes the formation of fatty acyl-CoA in a two-step reaction: the formation of a fatty acyl-AMP molecule as an intermediate, and the formation of a fatty acyl-CoA. Eukaryotes generally have multiple isoforms of LC-FACS genes with multiple splice variants. For example, nine genes are found in Arabidopsis and six genes are expressed in mammalian cells. Drosophila melanogaster mutant bubblegum (BGM) have elevated levels of very-long-chain fatty acids (VLCFA) caused by a defective gene later named bubblegum. The human homolog (hsBG) of bubblegum has been characterized as a very long chain fatty acid CoA synthetase that functions specifically in the brain; hsBG may play a central role in brain VLCFA metabolism and myelinogenesis. Free fatty acids must be "activated" to their CoA thioesters before participating in most catabolic and anabolic reactions.	0
NZ_CP050975.1\|WP_168527733.1\|2727923_2728370_-\|SRPBCC-family-protein	gnl\|CDD\|176861	cd07819, SRPBCC_2, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	1.63e-54
NZ_CP050975.1\|WP_168533542.1\|2741599_2742331_+\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|366759	pfam01694, Rhomboid, Rhomboid family. This family contains integral membrane proteins that are related to Drosophila rhomboid protein. Members of this family are found in bacteria and eukaryotes. Rhomboid promotes the cleavage of the membrane-anchored TGF-alpha-like growth factor Spitz, allowing it to activate the Drosophila EGF receptor. Analysis has shown that Rhomboid-1 is an intramembrane serine protease (EC:3.4.21.105). Parasite-encoded rhomboid enzymes are also important for invasion of host cells by Toxoplasma and the malaria parasite.	4.50887e-28
NZ_CP050975.1\|WP_168527741.1\|2738382_2739423_-\|hypothetical-protein	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	5.78822e-32
NZ_CP050975.1\|WP_168527734.1\|2728477_2729275_-\|metallophosphoesterase	gnl\|CDD\|277338	cd07392, MPP_PAE1087, Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain. PAE1087 is an uncharacterized Pyrobaculum aerophilum protein with a metallophosphatase domain. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.78009e-17
NZ_CP050975.1\|WP_168527730.1\|2723885_2724638_-\|endonuclease	gnl\|CDD\|226098	COG3568, ElsH, Metal-dependent hydrolase [General function prediction only].	1.18196e-19
NZ_CP050975.1\|WP_168527732.1\|2726029_2726500_-\|DUF5304-family-protein	gnl\|CDD\|375065	pfam17230, DUF5304, Family of unknown function (DUF5304). This family of unknown function is found in Actinobacteria.	1.28958e-64
NZ_CP050975.1\|WP_168527744.1\|2744680_2745745_-\|anthranilate-phosphoribosyltransferase	gnl\|CDD\|234682	PRK00188, trpD, anthranilate phosphoribosyltransferase; Provisional.	4.25819e-167
NZ_CP050975.1\|WP_168527729.1\|2723060_2723765_+\|hypothetical-protein	gnl\|CDD\|239486	cd03392, PAP2_like_2, PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase.	0.0066711
NZ_CP050975.1\|WP_168533540.1\|2721263_2722043_-\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	3.90183e-49
NZ_CP050975.1\|WP_168527731.1\|2725021_2725975_-\|ROK-family-glucokinase	gnl\|CDD\|273246	TIGR00744, Glucokinase_Glucose_kinase., ROK family protein (putative glucokinase). This model models one branch of the ROK superfamily of proteins. The three members of the seed alignment for this model all have experimental evidence for activity as glucokinase, but the set of related proteins is crowded with paralogs of different or unknown function. Proteins scoring above the trusted_cutoff will show strong similarity to at least one known glucokinase and may be designated as putative glucokinases. However, definitive identification of glucokinases should be done only with extreme caution. [Unknown function, General].	1.21137e-158
NZ_CP050975.1\|WP_148013620.1\|2742327_2742609_+\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|366431	pfam01037, AsnC_trans_reg, Lrp/AsnC ligand binding domain. The l-leucine-responsive regulatory protein (Lrp/AsnC) family is a family of similar bacterial transcription regulatory proteins. The family is named after two E. coli proteins involved in regulating amino acid metabolism. This entry corresponds to the usually C-terminal regulatory ligand binding domain. Structurally this domain has a dimeric alpha/beta barrel fold.	5.13296e-14
NZ_CP050975.1\|WP_168527736.1\|2731407_2732991_-\|GMC-family-oxidoreductase	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	3.14622e-11
NZ_CP050975.1\|WP_168527728.1\|2722258_2723068_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|224561	COG1647, COG1647, Esterase/lipase [General function prediction only].	4.30984e-38

>NZ_CP050975.1|WP_168527736.1|2731407_2732991_-|GMC-family-oxidoreductase
MVALQTAATVGLTRIGLQSAHAAEPAAVDNAPAIVIGSGYGAAVAALRLGQAGIRTLVIEMGRLWNTAGSDGKVFCSTSAPDQRSMWFRTRTEAPLATFLWLDLVNKDIGRYPGVLDRVHYDHMSVYVGRGVGGGSLVNGGMAVTPPQSYFSEQFPGVDATEMYNTYFPRARTMLGVNTVDPTWFESTEWYKFTRTSRKAAANAGLKTTFVPNVYDFAYMQREAAGTATKSALAGEVIYGNNYGKKSLDKTYLAAALGTGNVTIHTLERVRAVQRAADGTYTLTADRIDVTGAVVETKQYSCTYLFLGGGSLGTTELLVRARETGALPALDASVGTGWGTNGNVMTGRANHIWDTVGANQATMPVMGIDDWANTSNPVFAEIAPLPMGLEHWISLYLAITKNPERASFTYDAATDSAKLGWTAAQSAVSVSMAKKLFDRINAANATIYRYDLFGGNKTFADDFCYHPLGGCVLGRATDNYGRVKGYPHLYITDGSLVPGSIGVNPFVTITALAERGMARILAEDTAP
>NZ_CP050975.1|WP_168527735.1|2729571_2731368_+|AMP-binding-protein
MREFSLPALYEVPADGNLTDIVRRNAAQHPDVAVIARKVGGTWTDVTATVFLAEVRAAAKGLIASGVQPGDRVGLMSRTRYEWTLLDFAIWSAGAVTVPVYETSSAEQVQWILGDSGATACIVELPVHAASVESVRERLPALKHVWQIEAGGVEELGRAGQDVSDATVEERSSLAKADDPATIVYTSGTTGRPKGCVLTHRAFFAECGNIVERLRPLFRTGECSVLLFLPLAHVFGRLVQVAPMMAPIKLGCVPDIKNLTDELAAFRPTLILGVPRVFEKVYNSARAKAQADGKGKIFDKAADTAIAYSRALDTPSGPSLGLKIKYRTFDKLVYSKLRAVLGGRGEYAISGGAPLGERLGHFFRGIGFTVLEGYGLTESCAATAFNPWDRTKIGTVGQPLPGSVIRIADDGEVLLHGEHLFKGYWNNEAATAEALADGWFHTGDIGTLDEDGYLRITGRKKEIIVTAGGKNVAPAVIEDRIRAHALVAECMVVGDGRPFVGALITVDEEFLGRWCAEHGKPAGSTAASLRDDPDLVRTIQDAVDDGNAAVSKAESVRKFRILSSQFSEESGHLTPSLKLKRNVVAKDYADEIEAIYRG
>NZ_CP050975.1|WP_168527734.1|2728477_2729275_-|metallophosphoesterase
MAPTPGGNRRTRIHVVSDVHGNARDLARAGDGADALICLGDLVLFLDYADHSRGIFPDLFGTENADRLVELRTARRFTEAREFGARLWAGVGMDRLGVIEKAVRKQYAELFAAFPTPTYATYGNVDMPPLWAEYAGPGTTVLDGERVEIGGRVFGFVGGGLRTPMRTPYEISDEEYAAKVEAVGEVDVLCTHIPPDVPDLVYDTVARRFERGSRALLDAIRRTRPRYALFGHVHQPLVRRMRIGATECVNVGHFAGSGRPWALEW
>NZ_CP050975.1|WP_168527733.1|2727923_2728370_-|SRPBCC-family-protein
MAEHTSSSITIEAAPADVMAVIADFARYPDWTGEVKEAEVLGTDGQGRAEQVRLVMDAGAIKDDQTLGYTWTGDHEVSWTLVKSQMLRSLDGSYLLEPAGTGATEVTYRLTVDVKIPMLGMIKRKAEKVIIDRALAGLKKRVESGDAV
>NZ_CP050975.1|WP_168527732.1|2726029_2726500_-|DUF5304-family-protein
MSEERTTSDDAQHEAVDEARVSDADAWAKACAEDLAAEKARRRTQYGPPPGSASEELRKLVDAVTDKLSGLNSPLFGAIASGTAQQMVSQVVQQARAAVEPVMERNPDVFDHLAAAGSELLAAYRSAVEAQERRWTTRDTGPRDEGTGPGERIDLD
>NZ_CP050975.1|WP_168527731.1|2725021_2725975_-|ROK-family-glucokinase
MGLTIGVDIGGTKIAAGVVDEEGNILSTHKVPTPTTPQAIVDAIAAAVEGARAGHDIVGVGIGAAGYVNRQRSTVYFAPNIDWRQEPLKAEVEARVGLPVVVENDANAAAWGEYKFGAGKGHRNVICITLGTGLGGGIIIGNKLRRGHFGVAAEFGHIRMVPDGLLCGCGSQGCWEQYASGRALVRYAKQRANATPEHAEILLALGDGNPDGIEGKHISMAARQGDPVAVDSYRELARWAGAGLADLASLFDPSAFIVGGGLSDEGELVLDPIRKSYKRWLVGGNWRPVADVIAAQLGNKAGLVGAADLAREPDPIM
>NZ_CP050975.1|WP_168527730.1|2723885_2724638_-|endonuclease
MATTPLPDSHTEPDGSAVIRVLSYNIRSMRDDTDALARVISACAPDLVLIQEAPRFFRWRKKLARLAAASGQMILSGGAPAAGPALLCSLRATVERTEDVLLPLTPGQFRRGFATAVVRFGGARLGVLSCHLSLDADERHEQGAMLLDRVAALGTPHVVAGGDLNDLPDGRTFERLAASLQDGWATRPWGAEHTWIRDAPHRRIDAVFATKGIEVLGCGVPLGHPGVTERDLRAATDHLPVLAALRVPAS
>NZ_CP050975.1|WP_168527729.1|2723060_2723765_+|hypothetical-protein
MAEQDAERGEPDEKGVPVGGPPGDEQSVPFDEDAAWQAIVEGYGEEPKDPPGANPFKSVEDLALLDPETNGTPTGRGGRSGQRAKGDANDTEKAGKADKADAADKADGSDEGGDGPSAAQALGSSVSFAPGVGGPRDYRTAEPAEEDFDEDDEGHFVPPEPPPLPAADTTAKFAWLAVIGGPIVLLLAILLGWDMTWWLATVGIGGFLGGFATLVMRMNPDDEDEDDPGRGAVV
>NZ_CP050975.1|WP_168527728.1|2722258_2723068_+|alpha/beta-fold-hydrolase
MPVLPGAEPFRHEGGEVGVLLCHGFTGSPQSLRPWAEFLAERGLTVALPLLPGHGTRWEDMQLTGWQDWYAEVDRELRALRERCTRVFVFGLSLGGALALRLAAKHGDEVSGVVVVNPANRVHGAAAYALPVLRHFVPTVGGIASDIAKEGVTELGYDRVPLRAAHSMRNFYRIVDGELPQVTQPLLLLRSPQDHVVPPVDSARVLSRVSSTDVTEILLEQSYHVATLDHDADRVFEESYAFIGRLAPGVGERSDAVQAGQQEGTATGG
>NZ_CP050975.1|WP_168533540.1|2721263_2722043_-|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MYGAMKFSIGGPLKLAFRPWVEGLENIPAEGPAILASNHLSFSDSFFLPAVLDRKVTFIAKAEYFTTPGVKGRMTAAFFKGVGQLPVDRSGARGAGEAAVKSGIDVIERGELFGIYPEGTRSPDGRLYRGKPGGLARVALATGAPVIPVAMIDTEKIQPPGKVMPKLMRPGIRIGKPLDFGRYAGMEHDRFVLRAVTDEVMYEIMKLSGQEYVDIYATAAKRQITDAAKAEKQAQKEAEQAQKEAAKAAETEEGRAGGS
>NZ_CP050975.1|WP_168527737.1|2733338_2734481_-|glycosyltransferase
MDKTLIVTNDFPPRPGGIQAFLHNMALRLDPEQLVVYASTWKRGREGAEATAAFDAEQPFTVVRDRTTMLLPTPDVTRRAVGLLREHGCTSVWFGAAAPLGLMAPALRRAGAGRLVATTHGHEAGWAQLPAARGMLRRIGDSVDTVTYLGEYTRSRIASALSPAAAARMVQLPPGVDEKTFHPGSGGAEVRARLGLADRPVVVCVSRLVPRKGQDTLILAMPRILAAEPAAVLLIVGGGPYEKELRRLAYRTGVADAVRFTGALPWSELPAHFGAGDVFAMPCRTRRGGLDVEGLGIVYLEASATGLPVVAGDSGGAPDAVLDGETGWVVRGGSPEDSADRIVTLLADPELRRRMGERGREWVEEKWRWDLLAEKLKTLL
>NZ_CP050975.1|WP_168527738.1|2734632_2735865_+|DUF2029-domain-containing-protein
MTGARGARFPYGLLGAWILTRLVLLFFVLRVFVLPGPDVTSDVSVIYQGWYEILRTGTFPLDDVTWQYPPAASLAILSPGLLPFLDYPSAFFVLALLADLVVFALLRYAGVRPGRTLRGAWVWVAGLPLLGPTVYARYDVMVTAVAVAALLAGARHPRVMGALAGFGALLKVWPVLLLAGAVKRRAWTAAAVTGGGIALLFWAAVPGAFSFLAFQRGRGTEVESLGSLVFHVARHFGWSGQVLLNYGSVEFLGPYVGVVSAAALTLTAAALAWLLLWRLRTGRMRSHTLADAAFVAVLMFTATSRVISPQYMVWLVGIGAVCLCFRGSRMTPPVAMVVGACAATVLEFPVWFSHVVISDWLGVTLLFARDGLLVAAALVAARELWWGTVTHPAPTLPAQAARAREPLSPS
>NZ_CP050975.1|WP_168527739.1|2735897_2737094_-|hypothetical-protein
MAGRGRASRAGCSLVLLLGVLAGCGGPPATDTAAAEVQRVLDRRATAVLDRDEAAYRATEEPSGSVTEFRRLRAVPLAAWAYHLTDLRRSGDRATADAELRYRVEGYDRAPVTVARTLRLVHDDGRWRVASDAPAKKAGQQLWEQGAVTAVRGAHSLVLGVGQSGERLRAYAALADRAVPAVSEAWGTDWPGHVVVLVPKSLEGMAGLLGASASGYRGIAAVTTGEAGGSAKAPADRIIVNPEAYGVLGDLGKQVVLTHETTHVATRAHTTAATPLWLSEGYADWVGYRGSGRTAAQVAPELQRAVLDGHPPAALPADGDFGFTGDAARLARAYEGGWMACRLIADRWGEVRLNDFYRAVGDHGKRAGAVEGALRDVLGTTPEKFTGQWRTYLRTRLG
>NZ_CP050975.1|WP_168527740.1|2737126_2738158_-|hypothetical-protein
MGSHRRRAPSGSDRGAGTAGIAGITVTVMSVAAAALGAVPAAAAPQDDTRAEVDRLYTQAEKATEAFNKAGERAGALRKEVRTAQDRIARQQERINTMRDALGSLAVAQYRAGGLDPSLALIFSDNPAEYLDKAAVLDRITAHQAGELEDLQLAMRDLAQEREEATGKLAELERSSRAVAHHKRTVEQKLTEARRLLNALPDAMRAAYDRASRSGRPGFPDLGSAVPSSGRAAAALAAARSALGRPYVWGASGPGGFDCSGLMQWSYARAGVGLPRTSQEQRYAGHQVPLSQARPGDLVTYRSDASHVAMYAGNGQVIHAPYPGAAVRYDPVGMMPISSVTRV
>NZ_CP050975.1|WP_168527741.1|2738382_2739423_-|hypothetical-protein
MASHRRPKQPSRTRVTVLTTAAAAAVALSANAANAAPSEKPSKDEVKAKVDALYQDAEQATEKLDGAKEKQDKLEKQISALQDNVARGQEDLNQLRDGLGSMASAQYRTGGIDPSVALFLSSNPDDYLDKASAMDQLSSQQVEALKKVQGKQRELAQQRQEASEKLKDLSDTRAELKKKKQEVQGKLASAQKLLNSLTAKEKAALDEQQSRASRASERTVLGSPGKAASGRAGAAFAAGQSKIGTPYVYGATGPGSFDCSGFTSWSYAQAGVSIPRTSESQATIGTRIYSQSDLQVGDLVFFFGDLHHVGLYAGGGQVLHAPRTGTVVRYESMSTIGGAFQFGVRV
>NZ_CP050975.1|WP_168527742.1|2739845_2741195_-|RNA-binding-protein
MAETTGGEPDDGAAEVLDRPLPDGVRRRVVQIVSDGFGGLTVAELPVQLRQYARFAPNRRAKFAGNAMAAALETDPLFRQRIAEKLREAQPELVGALDSGAPPPAADPLDVAAAAYVLRPTGWVKLVTAAGEEALRADAERADEESRAELERLREELAEARTHTRTETERLRTELESAKKESESLHRKLRGALSDVKRGEAALRRLQGEMDIARAEGQAQVSAAESESRRLKTRLSEAEAALEATRKAAREGRSVEDMRVRLLLDTVLDAAQGLRRELALPPVSVRPAETVDAVEPGRMTPKDIAARALSENDPAILDQLLALPQAHLVVDGYNVTKTGYPQMPLEKQRLRLLGQLSQLAAQTGAEVTCVFDGAELAAPVLLAPPRGVRVLFSKAGVTADELIRQLVRAEPPGRPVIVVSTDREVADGIAKAGARPVASVVLLKRFSRG
>NZ_CP050975.1|WP_168527743.1|2741229_2741469_-|hypothetical-protein
MTVPLPTADTRWRCTLCGNLTRFDVTRSSKVVEYVHLDLAGEPSVEEREVVSETIESVRCRWCNAVDQVELVDRPGVGS
>NZ_CP050975.1|WP_168533542.1|2741599_2742331_+|rhomboid-family-intramembrane-serine-protease
MIGNWSTTVGRTVRAQSAPVTYGLIVLCCVIFVIGPASGFNPTYGTGDELLVAQRAYFRRWGVVPADLLSGTPGALLTPATALFIHGSWLHLLGNMLFFYVFGAMAEERMGHFEFALFYVGCGYLALVGYAIANSTSEQTLVGASGAISAVLGAFLYLFPKARVTSLFPFLFFLPLRFPAWIVLPFWAALQWLAAGRSPSGPGVAYLAHLVGFSVGFLYAWVRFRQPTRVKVPAAAPEGENQP
>NZ_CP050975.1|WP_148013620.1|2742327_2742609_+|Lrp/AsnC-family-transcriptional-regulator
MITAIVLIKTSVDRIPEIAESIAALDSVSEVFSVTGTYDLIAMVRVKAHDDLADVIPGSISKIPGVEGTDTHVAFRTYSQHDLEAAFAIGLDS
>NZ_CP050975.1|WP_168527744.1|2744680_2745745_-|anthranilate-phosphoribosyltransferase
MSAVTPAGGDIAAGRSWPAVLNGLLDGRDQSADDTAWAMDRIMSGEATDAQIAGFVVALRAKGETVEEITGLVRTMYEHAKVIEVPGETVDIVGTGGDGAKTVNISTMSSIVVAGTGTKVVKHGNRAASSASGASDVLGKLGVNLELTPKRVAEVAEEAGITFCFAVKFHPALRHVAAARGQLGIRTVFNFLGPLTNPARVRAQAVGVADARMAPIMAGVFAERGNSSLVFRGDDGLDELTTTAPSKVWVVRDGKVTEERFDPRDVGLDLVPVEALRGADASYNAEVARRVLDGERGPVRDAVVLNAAAALVALSPTDASLVDQLSAAMVKTARAIDSGAARAALDRWVTATNA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_5

2790146-2790245

Orphan

Consensus_repeat	Method
CCGGAACGTTCCAGCGCAGGCCCG	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of NZ_CP050975_5

>merge|NZ_CP050975|5|2790146-2790245|CRISPRCasFinder
CCGGAACGTTCCAGCGCAGGCCCGGATCGCCAGCCCCGCCGGAACGTTCCAGCGCAAGCCCGCATCCCCAGCCCCGCCGGAACGTTCCAGCGCAAGCCCG

>NZ_CP050975|5|3|2790146-2790245|CRISPRCasFinder
CCGGAACGTTCCAGCGCAGGCCCG	GATCGCCAGCCCCGCCGGAACGTTCCAGCGCAAGCCCGCATCCCCAGCCCCG
CCGGAACGTTCCAGCGCAAGCCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_148013661.1\|2800197_2800395_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168533544.1\|2789458_2789977_+\|DUF4240-domain-containing-protein	unknown	unknown	gnl\|CDD\|379426
NZ_CP050975.1\|WP_168527781.1\|2798913_2799879_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|235493
NZ_CP050975.1\|WP_168527768.1\|2774715_2776512_+\|DUF2156-domain-containing-protein	unknown	unknown	gnl\|CDD\|235095
NZ_CP050975.1\|WP_168527775.1\|2788371_2789343_+\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP050975.1\|WP_168527780.1\|2797911_2798706_+\|lipoyl(octanoyl)-transferase-LipB	unknown	unknown	gnl\|CDD\|184638
NZ_CP050975.1\|WP_168527776.1\|2790431_2791448_-\|peptidoglycan-recognition-protein	unknown	unknown	gnl\|CDD\|128941
NZ_CP050975.1\|WP_168527782.1\|2800507_2801209_+\|DUF4191-family-protein	unknown	unknown	gnl\|CDD\|379389
NZ_CP050975.1\|WP_168527773.1\|2784682_2785306_+\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|224715
NZ_CP050975.1\|WP_168527771.1\|2779303_2780833_+\|leucyl-aminopeptidase	unknown	unknown	gnl\|CDD\|234863
NZ_CP050975.1\|WP_168527783.1\|2801515_2801983_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP050975.1\|WP_168527772.1\|2781123_2782512_+\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP050975.1\|WP_168527784.1\|2802183_2803593_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP050975.1\|WP_168527769.1\|2777164_2777932_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527767.1\|2773346_2774453_+\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234636
NZ_CP050975.1\|WP_168527779.1\|2793416_2794334_+\|TIGR01777-family-protein	unknown	unknown	gnl\|CDD\|273800
NZ_CP050975.1\|WP_168527778.1\|2792856_2793354_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP050975.1\|WP_168527774.1\|2785565_2788268_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	unknown	unknown	gnl\|CDD\|236500
NZ_CP050975.1\|WP_168527770.1\|2778006_2778789_+\|adenosylcobinamide-GDP-ribazoletransferase	unknown	unknown	gnl\|CDD\|234697
NZ_CP050975.1\|WP_168527777.1\|2791635_2792820_+\|MarP-family-serine-protease	unknown	unknown	gnl\|CDD\|379142

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168533544.1\|2789458_2789977_+\|DUF4240-domain-containing-protein	gnl\|CDD\|379426	pfam14024, DUF4240, Protein of unknown function (DUF4240). This presumed domain is functionally uncharacterized. This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 169 and 263 amino acids in length. This domain is often associated with the WGR domain pfam05406.	3.3572e-48
NZ_CP050975.1\|WP_168527781.1\|2798913_2799879_+\|lipoyl-synthase	gnl\|CDD\|235493	PRK05481, PRK05481, lipoyl synthase; Provisional.	0
NZ_CP050975.1\|WP_168527768.1\|2774715_2776512_+\|DUF2156-domain-containing-protein	gnl\|CDD\|235095	PRK02983, lysS, bifunctional lysylphosphatidylglycerol synthetase/lysine--tRNA ligase LysX.	0
NZ_CP050975.1\|WP_168527775.1\|2788371_2789343_+\|WYL-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	5.13035e-39
NZ_CP050975.1\|WP_168527780.1\|2797911_2798706_+\|lipoyl(octanoyl)-transferase-LipB	gnl\|CDD\|184638	PRK14345, PRK14345, lipoyl(octanoyl) transferase LipB.	2.94133e-109
NZ_CP050975.1\|WP_168527776.1\|2790431_2791448_-\|peptidoglycan-recognition-protein	gnl\|CDD\|128941	smart00701, PGRP, Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme. The bacteriophage molecule, but not its moth homologue, has been shown to have N-acetylmuramoyl-L-alanine amidase activity. One member of this family, Tag7, is a cytokine.	1.04953e-45
NZ_CP050975.1\|WP_168527782.1\|2800507_2801209_+\|DUF4191-family-protein	gnl\|CDD\|379389	pfam13829, DUF4191, Domain of unknown function (DUF4191).	6.8141e-106
NZ_CP050975.1\|WP_168527773.1\|2784682_2785306_+\|FCD-domain-containing-protein	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.65617e-34
NZ_CP050975.1\|WP_168527771.1\|2779303_2780833_+\|leucyl-aminopeptidase	gnl\|CDD\|234863	PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional.	0
NZ_CP050975.1\|WP_168527783.1\|2801515_2801983_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	5.54284e-11
NZ_CP050975.1\|WP_168527772.1\|2781123_2782512_+\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP050975.1\|WP_168527784.1\|2802183_2803593_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP050975.1\|WP_168527767.1\|2773346_2774453_+\|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase	gnl\|CDD\|234636	PRK00105, cobT, nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase; Reviewed.	2.9345e-131
NZ_CP050975.1\|WP_168527779.1\|2793416_2794334_+\|TIGR01777-family-protein	gnl\|CDD\|273800	TIGR01777, Hypothetical_UPF0105_protein_Rv2216/MT2273/Mb2239., TIGR01777 family protein. This model represents a clade of proteins of unknown function including the E. coli yfcH protein. [Hypothetical proteins, Conserved].	4.629e-129
NZ_CP050975.1\|WP_168527778.1\|2792856_2793354_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.74023e-19
NZ_CP050975.1\|WP_168527774.1\|2785565_2788268_+\|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type	gnl\|CDD\|236500	PRK09405, aceE, pyruvate dehydrogenase subunit E1; Reviewed.	0
NZ_CP050975.1\|WP_168527770.1\|2778006_2778789_+\|adenosylcobinamide-GDP-ribazoletransferase	gnl\|CDD\|234697	PRK00235, cobS, cobalamin synthase; Reviewed.	3.32816e-41
NZ_CP050975.1\|WP_168527777.1\|2791635_2792820_+\|MarP-family-serine-protease	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	9.94351e-17

>NZ_CP050975.1|WP_168533544.1|2789458_2789977_+|DUF4240-domain-containing-protein
MDETEFWELVDTTREAVEGDPEDHADLIVERLVQRDPDVVLDFARHFEARYNRAYRWDLWGAAWVLLDGASDDAFDFFRCWLIGQGREVFEGAMHDPDTLAELLDDFDEDLDGDGEELGYAADEAYEQLTGVVAPDLGIPPASPEPEGTPLDFENEGVLAERYPKLWERFRG
>NZ_CP050975.1|WP_168527775.1|2788371_2789343_+|WYL-domain-containing-protein
MRAARLIKMVLLLQSRASMTAAELARELEVSERTVARDAQALSEAGVPVYADRGRAGGYRLIGGYRTRLTGLARGEAEALFLSGVPGALREMGLEDTASAARLKVSAALLPSLRDASRTAAQRFHLDAPAWFSEPRAPELLPPVADAVWDDRPVVARYGRDGAEVERTLEPYGLVLKAGVWYLCARVPEAGTFRVYRIDRFTAVGLGEERFRRDEGFDLPGFWEERAEQFARSILRAEAVVRLSPDGVRRLPYAVDPTAARAALDGCGAPDDRGWVTVTLPVESEEVAHTQLTGLGPEVEVLSPAALRERFAADAARSAALYA
>NZ_CP050975.1|WP_168527774.1|2785565_2788268_+|pyruvate-dehydrogenase-(acetyl-transferring),-homodimeric-type
MTDPTAIQPSELDQLPDRDPEETAEWQASLDAVTKAAGPHRAAYLMRRTLERAEGNGLALPKLLETDYVNTIPTAAEPVVDGDEAMERRITAWNRWNAAAMVTRGAKHGVGGHIATFASAAWLYETGFNHFFKGKEGDGSGDQLYIQGHASPGIYARAFLDGRLSETQLDNFRQEAGGNGLPSYPHPRRLPWLWEFPTVSMGLGPLSAIYQARFNRYLTSRGIKDVSQSHVWAFLGDGEMDEPESTAALALAAREGLDNLTFVINCNLQRLDGPVRANFKIVQELEAQFRGAGWNVVKSLWGNAWDELFRLDTTGALVRRLREVPDAQVQTYQTRDAAYIRQDFFGADPALVEMAKLLSDDKITECFHLSRGGHESRKVYAAYRAALAHKGGPTVILAQTVKGFTLGTGFASKNANHQMKKLSTDEFKQMRDLLELPISDSQFVDGVVPYGHPGADAPEVRYLQERRAALGGPAPARRTHPLAPLPAPADKAFASFDKGSGTQNVATTMAFVRLVKDLVRDKQSGKRWVPIVPDEARTFGMESLFPSLGIYSPKGQTYEPVDRDQLMYYKEAKDGQILNEGITEAGSMADFIAASTAYATHGEAMIPFYIFYSMFGWQRTADQMWQLGDQLGRGFLVGATAGRTTLTGEGLQHADGHSPVIAATNPAALSYDPAFAYEVAAIVKDGLRRMYGETAPGEDPNVFYYLTVYNEPIPQPAKPAGLGVDEGIVKGLYRFNTAESAGLSPAANAARVQLLASGTAIHWTLEAQRLLAEEWGVAADVWSATSWTELRRDALEADAALLRGEERVPFVRQALHGAEGPVLAVSDYMRQVPDQIAQWVEQDWSSLGADGFGLSDTRVAARRHFGVDAQSIVVAALAQLARRGEVKTSAVKEARERYGL
>NZ_CP050975.1|WP_168527773.1|2784682_2785306_+|FCD-domain-containing-protein
MTAPVVHSLREQIREHIVEGIVSGRWKPGERIVERRIATELEVSQTPVREALRELESLRLIESAPNKGVRVRNLTAADLEESYPVRAGLEAIAAELAAERLAQDCSALEPHVTALYEADRLSDGTGQVRHTVAFHRELVRAAGNSVLLHTWEGLGIEVFTALSIRWLGTVQQSYAEEHEALVDAFRRRDPLIAELVKAHVLGCAPRP
>NZ_CP050975.1|WP_168527772.1|2781123_2782512_+|dihydrolipoyl-dehydrogenase
MANDASTVFDLVILGGGSGGYAAALRGAQLGLDVALIEKDKVGGTCLHRGCIPTKALLHAGEIADQARESEQFGVKATFEGIDVPAVHKYKDEVITGLYKGLQGLIASRKVTYIEGEGRLSSPTSVDVNGQRVQGRHVLLATGSVPKSLPGLEIDGNRIISSDHALVLDRVPQSAIVLGGGVIGVEFASAWKSFGTDITIIEGLKHLAPLEDENSSKLLERAFRKRGIKFNLGTFFSKAEYTQNGVKVTLADGKEFEAEVLLVAVGRGPVSAGLGYEEQGVAMDRGYVLVDEYMRTNVPTISAVGDLVPTLQLAHVGFAEGILVAERLAGLKTVPIDYDGVPRVTYCHPEVASVGITEAKAKEIYGADKVVALKYNLAGNGKSKILKTAGEIKLVQVKDGAVVGVHMVGDRMGEQVGEAQLIYNWEALPAEVAQLIHAHPTQNEALGEAHLALAGKPLHSHD
>NZ_CP050975.1|WP_168527771.1|2779303_2780833_+|leucyl-aminopeptidase
MTALTLSTAAASGLRADAIVVGVAKGAKGPVLAPGAEAVDKGYDGALAGILETLGASGGEGEVTKLPAPSGFKAPVVVAVGLGAVPDKDEAFGAEVLRRAAGVAARALAGAKKAVLALPITDAADVGALAEGAALGAYAFDAYKETGRSGSAAKNGKAPLVEVALLGGKPRDAAHKAALARATAVTEELNRARDLINTPPNDLTPEAFAAVATAAGKEHGIKVQVLDEKALEKGGYGGILGVGAGSAAAPRLVKLSYTSPKAAKHLAFVGKGITYDSGGISLKPAGHNETMKCDMSGAAAVFAAVVAAARLGLQVNVTGWLALAENMPSGSATRPGDVLRMYSGKTVEVLNTDAEGRLVLADALWKASEEKPDAIIDVATLTGAMVLALGNRTFGVMANDDAFRASIVEAAEEVGEESWPMPLPEHLRKGMDSPTADIANMGERMGGGLVAGLFLKEFVGEGITWAHLDIAGPAFNESGPFGYTPKGGTGSAVRTLVRLAELTAAGDLG
>NZ_CP050975.1|WP_168527770.1|2778006_2778789_+|adenosylcobinamide-GDP-ribazoletransferase
MSPTPVSHGLRFAFGTLTVLPVEVTRWDREAARAGMLCAPMAGLVVGAGAALVGVALLALGGGPLLAAVATAAVPAALTRGLHLDGLADTADGLGSGKPAQDALRIMKQSDIGPFGVVTLLFVLLAQVAALHQAYESSWARGVLAAVVSATAARLALTLAARTGVPPARPEGLGAAVAGTVPVRGALLVALAVVAAAAGAGALLGTYDLVRAAVAVAAARAAAELLLRHCTRRFGGVTGDVFGGLAETAATTALVVFCLG
>NZ_CP050975.1|WP_168527769.1|2777164_2777932_-|hypothetical-protein
MGHWLHRNIIEPGKLPLLLALGSFVLTFVITRVIVRLIRAGKGPFGNVKAGGLHIHHVVPGVVLTVVGGFGAVASVRPGFGASAFAVVFGMGAGLVLDEFALILHLDDVYWTEEGRKSVEVVLITAALVGLVLGGFLPFGVNDLSQQEVQDRGGVIVSVAVNFLFALLALGKGKARMAIFGVIVPFLALIGAVRLARPSSPWARRFYRARPRARARSMLRAYHHDRRWAGPRRRLQDLIGGKPDPLPARLPPGRR
>NZ_CP050975.1|WP_168527768.1|2774715_2776512_+|DUF2156-domain-containing-protein
MGDARIAVAQERPPARQGEGDRGSTGASRRAAGFTVWYLRAVTFINFLSAAWLTLGQDVRRHNTENLFTPYLLTAGFASGVFTMFLAITMRRRKRAAWILNFVLGGLFLLLFAVAMAFPEIRRYAQNWISLALTAAFVASLVVGRREFYAKGDRSNPKLAAAVATGGLLVCSLLAALLVTVTNSAHDASRSTFPERWRYGTLRLVSVAANDSRFHGLEIANWVNVAINVLSTLLVLAVFYAAFRSRRAVDPLTEDDEKRLRVLLDKNGDRDSLGYFALRREKSVVWSPTGKAAVAYRVVGGVSLASGDPLGDPEAWPGAIEPWLAEARAHGWIPAVMGASEEAGTIYSRHGLDALELGDEAIVETAEFTLEGRAMRTVRQAYNRVKRAGYRVRIRRHDDIPADEMAYLLERADDWRDGATERGFSMALGRLGDPDDGQCVMLECTDGEGELRALLSFVPWGPRGLSLDLMRRDRDSENGLMEFMVIELLRRARDIGITQVSLNFAMFRSVFERGARLGAGPVLRLWRSLLSFFSRWWQIESLYRANAKYRPIWEPRFLLFEKSADLLRIGVASARAEGFLEAPGLPKWLHRKHLESHR
>NZ_CP050975.1|WP_168527767.1|2773346_2774453_+|nicotinate-nucleotide--dimethylbenzimidazole-phosphoribosyltransferase
MSSLNLDDFTDLIERPDGGVRRDAEARRERQTVPPGALGRLDDLGEWLAAAQGAVPVRPIERPRVVLFAGDHGIAGLGVSARPAGTADQLVRAVLEGASPAAVLARRLGVPVRVVDMALDCDPAELPAEVVRHRVRRGSGRIDVEDALTAEEAEAAFLAGVAVADEEADSGTDLVVLGDVSVGGTTAAAVLVAALCGTDASVVTGRGGRAIDDLAWMRKCAAVRDALRRARPVLGDQLQLLAVVGGADLAAMTGFLLQSAVRKMPVVLDGVVSAACALVGQRVAFRAPDWWLAGQNSGEAQAKALDRMALEPLLDHGVTVGEGAGALLALPSSSPRPHSPRSFLTPEPTPEADPERAPEPEPVPSGEE
>NZ_CP050975.1|WP_168527776.1|2790431_2791448_-|peptidoglycan-recognition-protein
MRVVRRARGASRESGGERLRHALEWVPLWLRWWLPRRPVWTGNWWAWWVTCRPAWDRSATWRAVCVRARSVTWRPVWSGPLRGRWATRPTLIVLGCVSGLLAVLALVLCALGVDGAVGRSRTAAPPAAVRPAVHTAVRPTIVPRSRWLDARTAHGQPPPRYDDRVVAVFVHHTDSPNAYDCADVPRIIRYLYAGQTGARNWDDIGYNFLVDRCGTIYEGRAGGVDRAVTGAHTQGFNHRTAGIAAIGTFTEGAVVPPAMTEAIAELAAWKLGLADVDPRGTVRLVSSNSLSRYAVGTAAVLPTLAGHNAGFMTTCPGAALTARLPAIRTRAAVLQGRR
>NZ_CP050975.1|WP_168527777.1|2791635_2792820_+|MarP-family-serine-protease
MDLLDILLMLVILAYAASGYRRGLVAGCVSLAGFVGGAVIGVWVLPWMMDLVTAGTSAATVTAVLTVLVPAVVGHELAGRLALKLRRELDRGPLRVADGIGGAAANTLAVLLVAWVAASVLGASSSTLITQSIRGSALLGAVQKTMPDTTPTWFSRATSALTEAGFPQVFNPFENEPTAGVAKPSGDSVTESASTAAKLSTVKIEGAAGTQGREGSGFAYAAQHVMTNAHVVAGIDNPTVRVGGVGRVYSARVVFFDPRKDVAVLYVPGLRAPVLRFDTSAARGDSAVVAGYPQDGGLDLQAATVANQINARGQNIYNTGTVTREIYSIRSTVRPGNSGGPLLTTEGRVYGVVFARSTSDNETGYVLTADEVSGDARRAARATAPVDTGDLVTS
>NZ_CP050975.1|WP_168527778.1|2792856_2793354_-|GNAT-family-N-acetyltransferase
MILMPVPHIRFATPDDEDALGRLDRATWSTQHAVMPRPQPPYEPFYNDRFGPRDHLVAELDGVLVGYVRLGHPTTLACNSHVRQIQGLAVSDAARGTGVGRALLRAVQDEARRQGARRISLRVLGHNTPARKLYESEGFVVEGVLPEEFLLDGEYVDDVFMGRGL
>NZ_CP050975.1|WP_168527779.1|2793416_2794334_+|TIGR01777-family-protein
MNDSPLAPGSRVVIAGASGLIGSALTRSLTTDGYEVVRLVRRAPRTPSEVRWDPEGRGVDAGALAGCAAVVNLAGAGVASQRWTESYKRTIRESRVRGTTVLAEAVASLDERPAVFVNGSAIGFYGDTGERAVDESAPAGEGFLPSVCVAWEGAAAAARQAGVRTVLARTGLVVAREGGAWGRLFPLFKAGLGGRMGDGRQYWSFISVHDEVAAIRHLMDTPSLSGPVNLTAPQPLTNREITAAMGRVMRRPTVLATPAGVLRVALGDMSGDILGSQRVLPGRLLESGFAFTFPSIEDTLRAALR
>NZ_CP050975.1|WP_168527780.1|2797911_2798706_+|lipoyl(octanoyl)-transferase-LipB
MSELRFVRMGFGADAVDYQEAWDEQRRVHNARFLDEIPDTCLLLEHPPVYTAGRRTADNERPLDGTPVVDVDRGGKITWHGPGQLVGYPIQKLPRPVDVVAHLRRLEDAMIRVCAEFGVETSRVEGRAGVWVLGDPVEQRPSGGLSLDFDPRLADEEFDPRLNGPQYAPSNAGQRREDRKICAMGIRVAKGVTMHGFALNVNPDTSSFDKIIPCGIRDAGVTSLAYELGRELTIDEVLPVVEKHLGDVLANADLRPREVERASA
>NZ_CP050975.1|WP_168527781.1|2798913_2799879_+|lipoyl-synthase
MSAVAPDGRKMLRLEVRNAQTPIERKPEWIKTRAKMGPEYTKMQSLVKSEGLHTVCQEAGCPNIYECWEDREATFLIGGDQCTRRCDFCQIDTGKPEALDRDEPRRVGESVVTMDLNYATITGVARDDLEDGGAWLYAETVRQIHAQTAERAEGRTKVELLAPDFNAEPAQLAEVFSSRPEVFAHNVETVPRIFKRIRPGFRYERSLKVITEARDYGLVTKSNLILGMGETREEVGEALRQLHEAGCELVTITQYLRPSVRHHPVERWVKPHEFVELKEEAEQIGFSGVMSGPLVRSSYRAGRLYRMAVEKRGAYVASQAV
>NZ_CP050975.1|WP_148013661.1|2800197_2800395_+|hypothetical-protein
MQAAPVRATAIPSFTDALRAVESLLMSSGQRTARRNAWTSVLEDRRRAKDRVEAQRVLESVATRP
>NZ_CP050975.1|WP_168527782.1|2800507_2801209_+|DUF4191-family-protein
MARKEPAADAANPGRLKQIVLTYKMTRKADSKIGLVLAAVGIVTLGVFLAIGFLIGHPVYLGILGLLLAFLATAIVFGRRAERAAFGQMEGQPGAAAAVLDNIGRGWTTTPAVAMNRSQDVVHRAVGKAGIVLVAEGNPNRVKSLLAAEKKKMARIVADVPVHDVLVGTGDGQVGLKKLRTTMLKFPRVLTGAQVTATNDRLRAMGDLMSNMPLPKGPMPKGMRMPRGGPKAR
>NZ_CP050975.1|WP_168527783.1|2801515_2801983_-|RDD-family-protein
MDNRQAIGSWLSGPRAAMEDSGAELGYRGEQLGLPETGPGSIARPGRRLGAIAVDWALCMVIAYGLLTDGYGQATGNWALLVFFALGVLTVGTVGFTPGKRLFGLRVVPEGGGRLNPLRALLRTALLCVAVPALIWDRDGRGLHDRLARTVEVRA
>NZ_CP050975.1|WP_168527784.1|2802183_2803593_+|type-I-glutamate--ammonia-ligase
MFQNADEAKKFIADEDVKFVDVRFCDLPGVMQHFTIPAEAFDPAEELAFDGSSIRGFQAIHESDMALRADLSTARVDPFRRDKTVNINFFIHDPITGEQYSRDPRNVAKKAEAYLASTGIADTAFFGPEAEFYVFDSVRFDTKANEAFYHIDSEAGAWNTGAVEDNRGYKVRYKGGYFPTPPVDHFADLRAEISLELAKSGLQVERQHHEVGTAGQAEINYKFNTLLAAADDLQLFKYIVKNVAWRNGKTATFMPKPIFGDNGSGMHVHQSLWANGDPLFYDEAGYAGLSDTARYYIGGILKHAPSLLAFTNPTVNSYHRLVPGFEAPVNLVYSQRNRSAAMRIPITGSNPKAKRVEFRAPDSSGNPYLAFSALLLAGLDGIKNKVEPAEPIDKDLYELAPEEHAGVAQVPTSLPAVLDRLEADHEFLLAGDVFTSDLIETWIDYKRTNEIAPLQLRPHPHEFELYYDV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_6

2942609-2942692

Orphan

Consensus_repeat	Method
CAGCCCTACGGCGGTCAGCCGCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_6

>merge|NZ_CP050975|6|2942609-2942692|CRISPRCasFinder
CAGCCCTACGGCGGTCAGCCGCAGGGTGGTTACGGGTACCCGGGTGCCCCGCAGCCGGGTCAGCCCTACGGCGGTCAGCCGCAG

>NZ_CP050975|6|4|2942609-2942692|CRISPRCasFinder
CAGCCCTACGGCGGTCAGCCGCAG	GGTGGTTACGGGTACCCGGGTGCCCCGCAGCCGGGT
CAGCCCTACGGCGGTCAGCCGCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168527877.1\|2932119_2932842_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP050975.1\|WP_168527888.1\|2949828_2950062_-\|ferredoxin	unknown	unknown	gnl\|CDD\|379145
NZ_CP050975.1\|WP_168533562.1\|2931238_2932120_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP050975.1\|WP_168527881.1\|2940295_2940946_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379276
NZ_CP050975.1\|WP_168527883.1\|2944137_2944710_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527879.1\|2936924_2938121_-\|lipid-transfer-protein	unknown	unknown	gnl\|CDD\|181327
NZ_CP050975.1\|WP_168527884.1\|2944855_2945149_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168527876.1\|2930037_2930922_-\|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|178455
NZ_CP050975.1\|WP_168533564.1\|2933036_2934389_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP050975.1\|WP_168533566.1\|2934457_2935090_+\|response-regulator	unknown	unknown	gnl\|CDD\|225107
NZ_CP050975.1\|WP_168527890.1\|2951713_2952751_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293811
NZ_CP050975.1\|WP_168533568.1\|2943080_2944115_+\|LLM-class-F420-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274647
NZ_CP050975.1\|WP_168527886.1\|2946302_2947049_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NZ_CP050975.1\|WP_168527891.1\|2952816_2953479_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270690
NZ_CP050975.1\|WP_168527885.1\|2945238_2946306_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|273702
NZ_CP050975.1\|WP_168527887.1\|2948739_2949372_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380056
NZ_CP050975.1\|WP_168527875.1\|2928930_2930007_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176240
NZ_CP050975.1\|WP_168527878.1\|2935988_2936528_-\|SigE-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132028
NZ_CP050975.1\|WP_168527889.1\|2950065_2951523_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143457
NZ_CP050975.1\|WP_168527880.1\|2938355_2940095_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341047

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168527877.1\|2932119_2932842_+\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	2.33496e-12
NZ_CP050975.1\|WP_168527888.1\|2949828_2950062_-\|ferredoxin	gnl\|CDD\|379145	pfam13370, Fer4_13, 4Fe-4S single cluster domain of Ferredoxin I. Fer4_13 is a ferredoxin I from sulfate-reducing bacteria. Chemical sequence analysis suggests that this characteristic [4Fe-4S] cluster sulfur environment is widely distributed among ferredoxins.	4.02107e-08
NZ_CP050975.1\|WP_168533562.1\|2931238_2932120_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.21015e-76
NZ_CP050975.1\|WP_168527881.1\|2940295_2940946_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379276	pfam13578, Methyltransf_24, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.41461e-20
NZ_CP050975.1\|WP_168527886.1\|2946302_2947049_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.09972e-26
NZ_CP050975.1\|WP_168527879.1\|2936924_2938121_-\|lipid-transfer-protein	gnl\|CDD\|181327	PRK08256, PRK08256, lipid-transfer protein; Provisional.	0
NZ_CP050975.1\|WP_168527876.1\|2930037_2930922_-\|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase	gnl\|CDD\|178455	PLN02864, PLN02864, enoyl-CoA hydratase.	4.83473e-68
NZ_CP050975.1\|WP_168533564.1\|2933036_2934389_+\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	6.50924e-47
NZ_CP050975.1\|WP_168533566.1\|2934457_2935090_+\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.33484e-63
NZ_CP050975.1\|WP_168527890.1\|2951713_2952751_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293811	cd07725, TTHA1429-like_MBL-fold, uncharacterized Thermus thermophilus TTHA1429 and related proteins; MBL-fold metallo hydrolase domain. Includes the MBL-fold metallo hydrolase domain of uncharacterized Thermus thermophilus TTHA1429 and related proteins. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	6.36389e-45
NZ_CP050975.1\|WP_168533568.1\|2943080_2944115_+\|LLM-class-F420-dependent-oxidoreductase	gnl\|CDD\|274647	TIGR03559, F420_Rv3520c, probable F420-dependent oxidoreductase, Rv3520c family. Members of this protein family are predicted to be oxidoreductases dependent on coenzyme F420. The family includes a single member in Mycobacterium tuberculosis (Rv3520c/MT3621) but four in Mycobacterium smegmatis. Prediction that this family is F420-dependent is based primarily on Partial Phylogenetic Profiling vs. F420 biosynthesis. [Unknown function, Enzymes of unknown specificity].	3.08726e-161
NZ_CP050975.1\|WP_168527891.1\|2952816_2953479_-\|phosphotransferase	gnl\|CDD\|270690	cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	4.1988e-12
NZ_CP050975.1\|WP_168527885.1\|2945238_2946306_-\|prenyltransferase	gnl\|CDD\|273702	TIGR01577, Uncharacterized_glycosyl_hydrolase_MJ1610, oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.	7.48064e-18
NZ_CP050975.1\|WP_168527887.1\|2948739_2949372_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380056	pfam17925, TetR_C_20, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present the transcriptional regulator KstR that regulates a large set of genes responsible for cholesterol catabolism. This is important for Mycobacterium tuberculosis during infection, both at an early stage in the macrophage phagosome and later within the necrotic granuloma.	1.14965e-39
NZ_CP050975.1\|WP_168527875.1\|2928930_2930007_-\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176240	cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	4.18648e-166
NZ_CP050975.1\|WP_168527878.1\|2935988_2936528_-\|SigE-family-RNA-polymerase-sigma-factor	gnl\|CDD\|132028	TIGR02983, putative_RNA_polymerase_ECF-subfamily_sigma_factor, RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.	1.25192e-50
NZ_CP050975.1\|WP_168527889.1\|2950065_2951523_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143457	cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like. The Mycobacterium tuberculosis NAD+-dependent, aldehyde dehydrogenase PDB structure, 3B4W, and the Mycobacterium tuberculosis H37Rv aldehyde dehydrogenase AldA (locus Rv0768) sequence, as well as the Rhodococcus rhodochrous ALDH involved in haloalkane catabolism, and other similar sequences, are included in this CD.	0
NZ_CP050975.1\|WP_168527880.1\|2938355_2940095_+\|MFS-transporter	gnl\|CDD\|341047	cd17504, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide)-like multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of putative multidrug resistance (MDR) transporters including Chlamydia trachomatis antiseptic resistance protein QacA_2, and Serratia sp. DD3 Bmr3. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. This subfamily belongs to the Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters (MMR-like MDR transporter) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.39952e-76

>NZ_CP050975.1|WP_168527881.1|2940295_2940946_+|class-I-SAM-dependent-methyltransferase
MPAAPKPEILAAFEAAKGFMPLDEGLALYDAAVEAGRLGLPLLEVGTYCGRSTILLADAARAAGVTAITVDHHRGSEEQQPGWEYHDPSTVDPEIGRMDTLPTFRRTLHGAGLEEQVVAIVGRSPQIAAFWGTPLGLVFIDGGHTDEHASGDYDGWAPHVAEGGLLLIHDVFPDPADEFTGQAPYRVYLRALGSGAFTEISATGSLRVLRRTGAGI
>NZ_CP050975.1|WP_168527880.1|2938355_2940095_+|MFS-transporter
MTHTTTQQPARRTSTAVVPVLAFAGIVVAVMQTLLVPVIKDLPKLLGTAPSNATWVLTSTLLAGAVATPIMGRLGDLFGKRRMLLTSLSVMVVGSLIAGFTSDLLVMIAGRALQGFAMGAIPLGIGLMRDMLPREKLGSAMALMSSSIGVGGGLALPLAAVVAQHADWHSLFFLAAGLGVVSIVLTLVAVPESPMRAEGTFDVLGAIGLSAGLVLFLLPITKGSDWGWSSGTTLGLFAASAVVLVLWGVMELRVKAPLVDLRTTVRRSVLFTNLASIMVGVSFYVVSLVLPQLLQLPKATGYGLGQSMVVAGLCVAPLGLTMMFTAPVYARISAKYGPKVTLILGMLIIGIGYGAGLGLMSAAWQTIVIAVVLGAGIGLAYSSLPALIVGSVPASETGAANGLNTLMRSIGTSVSSAVIGMVLANTANDVGGVAVPTMHGFRVSFMIATGAVAVGLVMALFLPRQRQATKPQLLASSAEDAALERAHEVLGGFRGRVLNTDGDPVARAKVTLIDRRGRQAGATLSGEDGSYTLAVPAQGAYVLAARAAGHGPLASSATHSGDDRPVDLDLALPGETVPA
>NZ_CP050975.1|WP_168527879.1|2936924_2938121_-|lipid-transfer-protein
MKAYVVGVGMTRFEKPETREWQYWDMAKEAGTHALRDAGIAYSDVRQVPVGHCFQASTAGQRAAYELGLTGVPVYNVNNNCATGASALMLARQFVEGGISDCVLALGFEKMKRGALGGGADGGDFATSPVARHYGIMAARHGFEMSPPTAQIFGDAAREHMERYGTTEAQLAAVGAKNHRHSAHNPYAQFQDVYGVDEVLASRAVHRPLTKLQCSPTSDGAAAAVVVSERFAEERGLGGRAVEIVAQAMTTDTEESFASGSCIDVVGQPMSREAARQVYERAGLGIHDVDVVELHDCFSINELLTYEALGMCGEGESGKLVESGATTYGGRWVVNPSGGLISKGHPLGATGIAQVAELVWQLRGEAGERQVADARVGLAHNIGLGGAAVVTLLRAARD
>NZ_CP050975.1|WP_168527878.1|2935988_2936528_-|SigE-family-RNA-polymerase-sigma-factor
MGDRKQARDEEFQGFVVGRWPRLLRTAFLLTGEQHAAEDLVQSTLEQVYVAWRRVDTADDPDAYVRRVMINAHARRHRRRLKEFLAPKDDSGLTHEVPEGGDRMAQADDRSALLKALAQLPPRQREAVVLRYWEDLSEARVAEAMGCSVGAVKSNAAKGIAKLRAVPGLADMVTYGGRK
>NZ_CP050975.1|WP_168533566.1|2934457_2935090_+|response-regulator
MPRDHRPVKCVRVLLAEDQGMMRGALALLLGMEEDLEVVAQVASGDAIVDAALLHRPDVALLDIELPGMSGLDAAAELRRQAPDCRVLILTTFGRPGYLRRAMEAGAAGFLVKDGPVEELAEAIRRVLTGERVIDPALAAAALSAGPSPLTARECDVLKASVDGATVADIAGRLHLSESTVRNYLSSAIGKTGTRNRMEAMREARQQGWL
>NZ_CP050975.1|WP_168533564.1|2933036_2934389_+|sensor-histidine-kinase
MTAWRESRRRWRADMARFKAERRTARRNGQPLPENPGPPPTGFALLPWLLLGMGAFSNLFQDRSSHPWIGAIGLFTFNSLYINVAFRAFVKEKREALSTRLALAAMGVLTCALAIGYGGNWLLFFPLLGLAVGATLRGPWLGRTGIGLAALAGGVSGVREGWDAINIAYGTFLSTMVTAAILSLAEAVRELRAAREELARRAVEKERLRFSRDLHDLLGHTLSVIVVKSEAARRLAPRDLEAALVQVADIESVGRQALTEIREAVTGYREGSLATELDRARSALSAVGVDPVVRQSGPPLVPRSEALLGWVLREAVTNVLRHSGATRCEISVSGTRDRVRLEVADDGDGVLSPSPVPGIGGTGLKGLTERLAAVSGSLQVSPSPRGGFTVTAELPVEGELPVEGDPVEGELPVEGGLSAAGGPAAGERPAQDRLPADPAELPLSRTPGAR
>NZ_CP050975.1|WP_168527877.1|2932119_2932842_+|ABC-transporter-permease
MLDYLRLEVRRTLRDTGFVIGGVAMPVMMYLLFTNLGGGGDDDGWKTGSMIGMAAYGAVGSALNTGGGVAEDRVTGWLRQLRVTPMTPREVVLGRALTGSVTVLPAIAAVLTAGGVVNGVRLAAWQWAAVAVLLWLGSVPFTLLGLGNGYRLTAQTTGVANMACNLGLSVVGGLWFPITLFPGWLQSVSVYTPANRFAELGMSVTDGRPPALGAVAVLVAWLLAFGSYAVVSYRRAGRAA
>NZ_CP050975.1|WP_168533562.1|2931238_2932120_+|ATP-binding-cassette-domain-containing-protein
MSFTGAVKAFGAVRAVDGVDLEIARGETVALLGRNGAGKSTTISLLLGLNEPDEGSVALFGGSPERAVRAGRVGAMLQESRPVPRATVRELVSFVAGRYPAPLPVDEALRLAGIAELAGRRADRLSGGQSQRVRFAVALAGNPALIVLDEPTAALDVEARQAFWASMRAYARRGHTVLFSTHYLDEADAHADRILVIDRGRIVADGTGEQLKRSVGGNLVSFDLAGAGTQGLTLLPGVVSVEVRGDRARLRTDDSDATVVALAQRGSIRGLEVTAASLDDAFLALTSSALEAV
>NZ_CP050975.1|WP_168527876.1|2930037_2930922_-|3-alpha,7-alpha,-12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA-hydratase
MPIDAAKALAAEPRIGEITWDRKDVQLYHLGLGAGANPDKRSPATDADELRYTLESRLHVLPSFATVAGAGSPGVISGLSMPGVDVDLTRVLHGGQRVVLHRPIPAEGRATATGRIAAVYDKGKAAILVMRTEVADAGGPLWTNDAQIFVRGEGGWGGDRGPSTRLDAPEGPPDRTVERPVREDQALLYRLSGDWNPLHADPDFAKLAGFERPILHGLCTYGVTLKAVVDTLLGGDVSRVRSYTTRFAGVVFPGETLRVRMWRGPAPDGGIRVSVTAADRDDAPVLADTVVEHA
>NZ_CP050975.1|WP_168527875.1|2928930_2930007_-|alcohol-dehydrogenase-catalytic-domain-containing-protein
MRAAVQHETGQDKLDVLDDVEAVGFGPGRVRIRVRATGLCHSDLSAMSGVLPQPAPFVPGHEGAGEVTEVGEGVTRLKPGDRVVVCWLPACGACPACKRGQTELCLAGFMNAGTPNFRRSGQDVFGFAGTGTFAEEVVVDAGCAVPIPDDVPFDIAALIGCGVTTGLGAALNTADVEAGSSVAVIGCGGVGISAIQGARLKGAAEIVAVDPVASRREAALRFGATRAVAPDGLADAKQSVTAGEGFDYVFEVVGRSATARTAYENTRRGGTLVVVGAGAMDDFLQLNMFELFFDEKRILPSMYGGGDVLRSYERTIALWRAGRIDLEGLITHRVPLSGINEALDQMRTGTALRTCIEI
>NZ_CP050975.1|WP_168533568.1|2943080_2944115_+|LLM-class-F420-dependent-oxidoreductase
MRLGLALGYWGRGPSADHLPLALEAERLGYHSVWTAESWGSDAFTPLTWIAAQTTRIRLGTAVAQMAARSPTTTAMHALTLDHLSGGRMMLGLGLSGPQVVEGWYGRPFPKSPLTATREYVDVVRQVLRREGPVRLDGRFHSHPYRGADGTGLGKALRPITHPLRADLPVLLGAEGPKNIAQTTRIADGWLPLYWSPTRPQAYEAALAELGDARAGAGAAPFLVAPMAHVRVCDDVAEGLLPVKAMLGFYIGGMGHSARNFHADLMTRMGYEEEARLIQELFLAGRRQEAVLAVPDAFADEISLVGPRERIAERLDLWRKGPVTDLLALSPDPHSLRVLADLNS
>NZ_CP050975.1|WP_168527883.1|2944137_2944710_-|hypothetical-protein
MPVSIRRLIVALTLSCALVAGATACSSSGSSARKDTAAVAAAVAATPSPSTTAEKQRLSKTRFVANASLAAGATYQWIVKPWKAGKFKKGVKGRKLALIKAGVAGAFAYNRLKAASKNAKGDPTLSKAIGPLTAGITALKGLPAKLRKGKSTDDTVGSFDDIINQVKDAGKSAGANVTDKVPSSAQLTHG
>NZ_CP050975.1|WP_168527884.1|2944855_2945149_+|hypothetical-protein
MSPRYRNGSNQAGTVIAIVADVMALILGLWILMYLLDANRANDLVQFVHNLASWLAGWSRDLFTFDDAWARVVAGYGLAAVVYLFIGHAIANRMHRH
>NZ_CP050975.1|WP_168527885.1|2945238_2946306_-|prenyltransferase
MTTPRTEHLVLPGVLTAEEAAVTVRAILGAQRPDGAIPWFRGHHLDPWDHTEAAMALDAAGEHEAAERAYAWLARHQNPDGSWYAAYADGDFEDVTDRGRETNFCAYIAVGVWHHYLATGDDAFLDRMWPSVYAAVEFVLGLQQPGGQIGWKREDDGTATNEALLTGSSSIHHALRCALAIADQREEPQPDWELALGLLRHAIRRHPERFLDKDRYSMDWYYPVLGGALTGVEAESRIAEGWERFVVPGLGVRCVVPNPWVTGGESAELALALWAVGESDRALEILQSIQHLRDPKTGLYWTGYVFDARAVWPEELTTWTAGSLLLAVAALGGDEPTCAVFGGERLPRGLDAECC
>NZ_CP050975.1|WP_168527886.1|2946302_2947049_-|methyltransferase-domain-containing-protein
MLTVDFSRFPLAPGDRVLDLGCGAGRHAFECYRRGARVVALDQNGEEIREVAKWFAAMKEAGEAPEGATATAMEGDALQLPFPDESFDVVIISEVMEHIPDDKGVLAEMVRVLKPGGRIAITVPRYGPEKVCWALSDAYHEVEGGHIRIYKADELLGRMKEAGLKPYGTHHAHALHSPYWWLKCAFGVDNDKVLPVRAYHKLLVWDIMKKPLATRVAENALNPLIGKSFVAYATKPHLPVAAAAVDAS
>NZ_CP050975.1|WP_168527887.1|2948739_2949372_+|TetR-family-transcriptional-regulator
MPAEVKVEAKSAQFASPRLTERQEARRRRILHASAQLAGRGGFDAVQMREVAESSQVALGTLYRYFPSKVHLLVATMQDQLDHMHGTLRKKPPAGETAAERVSETLMRAFRALQREPHLADAMVRALTFADRSVSPEVDQVSRQTTAIILDAMGLDDPSPAQLSAVRVIEHTWHSALITWLSGRASIAQVKIDIETVCRLIDLTDPGERS
>NZ_CP050975.1|WP_168527888.1|2949828_2950062_-|ferredoxin
MGDRWNIEVDRSLCIGSAQCVHLVPDAFRLDSAMQSHPAEPETDANERLLAAAEGCPVEAIMITLLGSGEPVFPPEE
>NZ_CP050975.1|WP_168527889.1|2950065_2951523_-|aldehyde-dehydrogenase-family-protein
MTELVEHGQLFIGGELTDPLGTGVIEVISPHTEEVIGRVPHASAEDVDRAVAVARRAFDEGPWPRMSPGERIAVVTRIKDAIGARHEEIARVISSENGSPYSWSVLAQALGAMMVWDAALTVARGFTYEETRDGVLGRILVRREPVGVVAAVVPWNVPQFVAAAKLAPALLTGCSVVLKPSPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGRRVMEVASRNLTRVTLELGGKSAAVVLPDADLATAVPGIVQAAWMNNGQACVAQTRILVPRSRYDEFADAFAAAASALVVGDPLDPATQVGPLVAERQRRRSLDYIRIGQEEGAKVLTGGGRPHGLDRGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDETEAVKIANDSDYGLSGSVWTADVAHGIDIARQVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFLEHKMIHLPAGWEA
>NZ_CP050975.1|WP_168527890.1|2951713_2952751_+|MBL-fold-metallo-hydrolase
MTQVTDHGGGVRSLRVPIPDNPLGTTLVHVVDTDRGPVLIDTGWDDPASWDVLTAGLAACGIPVAEVHGVVITHHHPDHHGLSGKVRDASGAWIAMHALDTEIVRRTREHKAERWFAYMADKLEACGAPEDHVALLRAARTARRSGSLPQFTPALPDREIVPGELLDLAGRRLRAIWTPGHTPGHVCLHLEEAHPAGLPGHGRLFSGDHLLPRITPHIGLYEDPDDVTVADPLGDYLDSLERVGRLDPAEVLPAHQHAFTDAPGRVRELLTHHEERLTGLLTLLATPLTAWQLAERMEWNRPWEQIPFGSRNIAVSEAEAHVRRLVKLGRAEAVAGSGPVTYVAV
>NZ_CP050975.1|WP_168527891.1|2952816_2953479_-|phosphotransferase
MRTGRLLGSGRSADVYEIDETWVLRRDREGWGDATAEATVMEHVRRHGYPVPGVRAATRGDLVMERLTGPTMLEAFGAGLFSAEEAGLTLARLLRKLHAVPARLSADPAVRVLHLDLHPDNVMLTPDGPKVIDWADAEEGPPGLDWGMSAVILAQVAVGAEAHAGVAGETLAAMLDANTDCMTQDGLTQAVRRRAANPTMSAQEVQLLGEAEELVRTLAF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_7

3609521-3609645

Orphan

Consensus_repeat	Method
AGGGGCGCGGGGAACTGCGCGCCCAACCCCCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_7

>merge|NZ_CP050975|7|3609521-3609645|CRISPRCasFinder
AGGGGCGCGGGGAACTGCGCGCCCAACCCCCACCGACCCGCACCCGAAACACCGACCGGGAAAGGCCGGGGGCGCAGCCCCCATGCCTGTCAGGGGCGCGGGGAACTGCGCGCCCAGCCCCCACC

>NZ_CP050975|7|5|3609521-3609645|CRISPRCasFinder
AGGGGCGCGGGGAACTGCGCGCCCAACCCCCACC	GACCCGCACCCGAAACACCGACCGGGAAAGGCCGGGGGCGCAGCCCCCATGCCTGTC
AGGGGCGCGGGGAACTGCGCGCCCAGCCCCCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168528291.1\|3598359_3599442_-\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|237887
NZ_CP050975.1\|WP_168528303.1\|3613215_3614691_+\|beta-1,6-galactanase	unknown	unknown	gnl\|CDD\|373145
NZ_CP050975.1\|WP_168528296.1\|3602954_3604079_-\|TIGR03364-family-FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|132407
NZ_CP050975.1\|WP_168528292.1\|3599522_3600320_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|132299
NZ_CP050975.1\|WP_168533667.1\|3617745_3620664_+\|Z1-domain-containing-protein	unknown	unknown	gnl\|CDD\|378453
NZ_CP050975.1\|WP_168528305.1\|3616045_3617626_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|372641
NZ_CP050975.1\|WP_168528297.1\|3604222_3604981_-\|UTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|225099
NZ_CP050975.1\|WP_168528302.1\|3612117_3612933_-\|class-E-sortase	unknown	unknown	gnl\|CDD\|320679
NZ_CP050975.1\|WP_168528304.1\|3614848_3615868_+\|SEC-C-domain-containing-protein	unknown	unknown	gnl\|CDD\|376935
NZ_CP050975.1\|WP_168528298.1\|3606502_3607849_-\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP050975.1\|WP_168528301.1\|3609707_3610565_-\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP050975.1\|WP_168533664.1\|3610715_3611426_-\|membrane-protein-insertase-YidC	unknown	unknown	gnl\|CDD\|376730
NZ_CP050975.1\|WP_168533666.1\|3611557_3611884_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168528299.1\|3607896_3609015_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|183212
NZ_CP050975.1\|WP_168528294.1\|3601171_3602227_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP050975.1\|WP_168528307.1\|3621694_3622453_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|370246
NZ_CP050975.1\|WP_168528300.1\|3609011_3609476_+\|heme-degrading-domain-containing-protein	unknown	unknown	gnl\|CDD\|179430
NZ_CP050975.1\|WP_168528293.1\|3600306_3601179_-\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|237888
NZ_CP050975.1\|WP_168528306.1\|3620711_3621692_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|378126
NZ_CP050975.1\|WP_168528295.1\|3602223_3602937_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|274534

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168528291.1\|3598359_3599442_-\|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|237887	PRK15046, PRK15046, 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional.	6.34073e-170
NZ_CP050975.1\|WP_168528303.1\|3613215_3614691_+\|beta-1,6-galactanase	gnl\|CDD\|373145	pfam14587, Glyco_hydr_30_2, O-Glycosyl hydrolase family 30.	1.61352e-10
NZ_CP050975.1\|WP_168528296.1\|3602954_3604079_-\|TIGR03364-family-FAD-dependent-oxidoreductase	gnl\|CDD\|132407	TIGR03364, putative_secreted_oxidoreductase, FAD dependent oxidoreductase TIGR03364. This clade of FAD dependent oxidoreductases (members of the pfam01266 family) is syntenically associated with a family of proposed phosphonatase-like enzymes (TIGR03351) and is also found (less frequently) in association with phosphonate transporter components. A likely role for this enzyme involves the oxidative deamination of an aminophosphonate differring slightly from 2-aminoethylphosphonate, possibly 1-hydroxy-2-aminoethylphosphonate (see the comments for TIGR03351). Many members of the larger FAD dependent oxidoreductase family act as amino acid oxidative deaminases.	9.64947e-112
NZ_CP050975.1\|WP_168528292.1\|3599522_3600320_-\|ABC-transporter-permease-subunit	gnl\|CDD\|132299	TIGR03255, PhnV, 2-aminoethylphosphonate ABC transport system, membrane component PhnV. This membrane component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.	5.55646e-52
NZ_CP050975.1\|WP_168533667.1\|3617745_3620664_+\|Z1-domain-containing-protein	gnl\|CDD\|378453	pfam10593, Z1, Z1 domain. This uncharacterized domain was identified by Iyer and colleagues. It is found associated with a helicase domain of superfamily type II.	1.10878e-70
NZ_CP050975.1\|WP_168528305.1\|3616045_3617626_+\|ATP-binding-protein	gnl\|CDD\|372641	pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.	1.40992e-20
NZ_CP050975.1\|WP_168528297.1\|3604222_3604981_-\|UTRA-domain-containing-protein	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	2.86863e-60
NZ_CP050975.1\|WP_168528302.1\|3612117_3612933_-\|class-E-sortase	gnl\|CDD\|320679	cd05830, Sortase_E, Sortase domain found in the class E family of sortases. Class E sortases are membrane-bound cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Actinobacteria). Genes encoding class A and E sortases are never found in the same organism, and similar to class A sortases, the genes encoding class E sortases are not positioned adjacent to genes encoding potential protein substrates, suggesting a housekeeping sortase function of class E sortases in some high G + C Gram-positive bacteria. Similar to class A sortase, class E sortases are capable of anchoring a large number of functionally distinct surface proteins containing a cell wall sorting signal to an amino group located on the bacterial cell wall. They recognize an LAXTG sorting signal, instead of the canonical LPXTG motif processed by class A sortases. The prototypical class E sortase from Corynebacterium diphtheria (named Cd-SrtF) is a non-polymerization sortase that is not required for pilus polymerization, and proceeds to complete the assembly process by anchoring the polymer to the cell wall peptidoglycan. Moreover, in Streptomyces coelicolor, one or both of Staphylococcus aureus SrtA homologs may function as class E sortase responsible for the cell wall anchoring of the long chaplin proteins (ChpA-C) containing an LAXTG sorting signal, which presumably mediate aerial hyphae formation. The family also includes some class E sortase homologs from Gram-negative and Archaebacterial species, but the functions of these enzymes are unknown.	1.00938e-46
NZ_CP050975.1\|WP_168528304.1\|3614848_3615868_+\|SEC-C-domain-containing-protein	gnl\|CDD\|376935	pfam02810, SEC-C, SEC-C motif. The SEC-C motif found in the C-terminus of the SecA protein, in the middle of some SWI2 ATPases and also solo in several proteins. The motif is predicted to chelate zinc with the CXC and C[HC] pairs that constitute the most conserved feature of the motif. It is predicted to be a potential nucleic acid binding domain.	1.8108e-05
NZ_CP050975.1\|WP_168528298.1\|3606502_3607849_-\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	8.32286e-16
NZ_CP050975.1\|WP_168528301.1\|3609707_3610565_-\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	3.15135e-95
NZ_CP050975.1\|WP_168533664.1\|3610715_3611426_-\|membrane-protein-insertase-YidC	gnl\|CDD\|376730	pfam02096, 60KD_IMP, 60Kd inner membrane protein.	1.80293e-31
NZ_CP050975.1\|WP_168528299.1\|3607896_3609015_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|183212	PRK11579, PRK11579, putative oxidoreductase; Provisional.	7.56094e-102
NZ_CP050975.1\|WP_168528294.1\|3601171_3602227_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	2.15578e-139
NZ_CP050975.1\|WP_168528307.1\|3621694_3622453_+\|restriction-endonuclease	gnl\|CDD\|370246	pfam09015, NgoMIV_restric, NgoMIV restriction enzyme. Members of this family are prokaryotic DNA restriction enzymes, exhibiting an alpha/beta structure, with a central region comprising a mixed six-stranded beta-sheet with alpha-helices on each side. A long 'arm' protrudes out of the core of the domain between strands beta2 and beta3 and is mainly involved in the tetramerisation interface of the protein. These restriction enzymes recognize the double-stranded sequence GCCGGC and cleave after G-1.	1.94292e-58
NZ_CP050975.1\|WP_168528300.1\|3609011_3609476_+\|heme-degrading-domain-containing-protein	gnl\|CDD\|179430	PRK02487, PRK02487, heme-degrading domain-containing protein.	9.55004e-86
NZ_CP050975.1\|WP_168528293.1\|3600306_3601179_-\|2-aminoethylphosphonate-ABC-transporter-permease-subunit	gnl\|CDD\|237888	PRK15050, PRK15050, 2-aminoethylphosphonate transport system permease PhnU; Provisional.	8.3685e-130
NZ_CP050975.1\|WP_168528306.1\|3620711_3621692_+\|restriction-endonuclease	gnl\|CDD\|378126	pfam09126, NaeI, Restriction endonuclease NaeI. Members of this family adopt a secondary structure consisting of nine alpha-helices, six 3-10 helices and 13 beta-strands. They bind two GCC-CGG recognition sequences to cleave DNA into blunt-ended products.	5.57598e-142
NZ_CP050975.1\|WP_168528295.1\|3602223_3602937_-\|HAD-hydrolase-like-protein	gnl\|CDD\|274534	TIGR03351, PhnX-like, phosphonatase-like hydrolase. This clade of sequences are the closest homologs to the PhnX enzyme, phosphonoacetaldehyde (Pald) hydrolase (phosphonatase, TIGR01422). This phosphonatase-like enzyme and PhnX itself are members of the haloacid dehalogenase (HAD) superfamily (pfam00702) having a a number of distinctive features that set them apart from typical HAD enzymes. The typical HAD N-terminal motif DxDx(T/V) here is DxAGT and the usual conserved lysine prior to the C-terminal motif is instead an arginine. Also distinctive of phosphonatase, and particular to its bi-catalytic mechanism is a conserved lysine in the variable "cap" domain. This lysine forms a Schiff base with the aldehyde of phosphonoacetaldehyde, providing, through the resulting positive charge, a polarization of the C-P bond necesary for cleavage as well as a route to the initial product of cleavage, an ene-amine. The conservation of these elements in this phosphonatase-like enzyme suggests that the substrate is also, like Pald, a 2-oxo-ethylphosphonate. Despite this, the genomic context of members of this family are quite distinct from PhnX, which is almost invariably associated with the 2-aminoethylphosphonate transaminase PhnW (TIGR02326), the source of the substrate Pald. Members of this clade are never associated with PhnW, but rather associate with families of FAD-dependent oxidoreductases related to deaminating amino acid oxidases (pfam01266) as well as zinc-dependent dehydrogenases (pfam00107). Notably, family members from Arthrobacter aurescens TC1 and Nocardia farcinica IFM 10152 are adjacent to the PhnCDE ABC cassette phosphonates transporter (GenProp0236) typically found in association with the phosphonates C-P lyase system (GenProp0232). These observations suggest two possibilities. First, the substrate for this enzyme family is also Pald, the non-association with PhnW not withstanding. Alternatively, the substrate is something very closely related such as hydroxyphosphonoacetaldehyde (Hpald). Hpald could come from oxidative deamination of 1-hydroxy-2-aminoethylphosphonate (HAEP) by the associated oxidase. HAEP would not be a substrate for PhnW due to its high specificity for AEP. HAEP has been shown to be a constituent of the sphingophosphonolipid of Bacteriovorax stolpii, and presumably has other natural sources. If Hpald is the substrate, the product would be glycoaldehyde (hydroxyacetaldehyde), and the associated alcohol dehydrogenase may serve to convert this to glycol.	1.55432e-51

>NZ_CP050975.1|WP_168528300.1|3609011_3609476_+|heme-degrading-domain-containing-protein
MSAPDIAELEEQERRLVLPRFTHDDAWTLGTLLVELARERRAPVAVDIRRGGQQLFHAALPGSTPDNDAWIDRKRRVVERYGCSSLLVGTRFRAKGTTFEESSRLDPDTYAAHGGAFPVTVEGAGVIGTVVVSGLPQLDDHAMVIEALTHFLAL
>NZ_CP050975.1|WP_168528299.1|3607896_3609015_+|Gfo/Idh/MocA-family-oxidoreductase
MTGSTTDTGPEAGSAPGAPLRVALIGYGLAGSVFHAPLIAATEGLALDTIVTSNPERQEQARAEFPQVRFAATPDDLWARADELDLVVIASPNKTHVPLATAALKADLPVVVDKPLAGTAAEARELAALADERGLLLSVFQNRRWDNDFLTLRKLLDEGELGDVWRFESRFERWRPQLKGGWRESGDPAEIGGLLYDLGSHVVDQALVLFGPAASVYAEAVVRRDGAVTDDDTFIAITHTSGVRSHLYVSATTAQLGPRFRVLGSRAGYVKHGLDPQEAQLREGGRPGVTAEWGVEPESLWGRVGSGESPLSGGGLSPEPTLPGAYPAYYAAVAAALRDGGPNPVTAHEAAAALDVLEAAHRSARENTVVAL
>NZ_CP050975.1|WP_168528298.1|3606502_3607849_-|ROK-family-protein
MAYVNRTSGESGASLAGRLEGAGANLLALRSHNGALVLDLLRTAGTTGISRLELAERTGLTPQAVSKITARLRAEGLAAEAGQLASTGGKPRTVLRLVPEAGYAVGLHLDRDELTAVLCDLAGAVVAERRVPLGLGAGAGAVVEGAAREVEALIEGAGVSVLGVGVALPGPLDHARGTLHRVTGFPEWDGFPLRDTLAGRLGVPVVVDKDTNAAALGLAVGGCGPVREPGAGRGDGDSYGDGSDGTGDRAGDRGGGSDGTGDRPGDRVGGRDRVGDGGVDGGRSGGGVRAGAEAAFAYLHLGTGLGAGLVFGGAVHRGARTGAGEFGHQVIQLDGPLCDCGNRGCVEALCLAAVGRGAVDEAARVLGAGAANLVGLLDIDLVLLGGRTVAAHQEAFVRGVGAVLGERARREGTDTVPVRIAPGGARGVAEGAAQLLLAPLFGRGEAEA
>NZ_CP050975.1|WP_168528297.1|3604222_3604981_-|UTRA-domain-containing-protein
MDYPNDQAPGAPVRSGIPEHGRIPKYYAVKAHIALLIEELGEGGLLPTERDLAEQYGVARETVRQALRELLLEGKLRRQGRGTVVAGPKLEQPLSLASYTEGVRRQGRTPGRTLISLDRFPCSETLAAEAGLTRGEPVWHMERVLLADDERVGLESTYVAVARVPHLDRDFTPDSSFYAYLHDRLGIAFGDADERIETVLATPREALLIGTPPALPMILIHRVSRDTERRPLERVRTLYRGDRFSFTAHLGG
>NZ_CP050975.1|WP_168528296.1|3602954_3604079_-|TIGR03364-family-FAD-dependent-oxidoreductase
MRVIVVGAGVVGTLHAWHAVERGHEVVQIEREAEARGASLRNFGQIWVSGRAGGEELETALRARELWESIGARVPGLGFRANGSLTPLRGERELAVAEAALTRTDAAARGYKLFTPDEARAVNPALRGTFDAALYCERDAAVEPRTAQLALREQLLRSPGYTFLPGREVRDVIGEHAVRDDHGDVHTGDVVVLCTGAWLGGLVRELAGPELPVRRVRLQMMQTDPLGEPLTTSVADADSFRYYPAYRGPALDELNTLQPQAPTAAEHRMQLLMVQRADGGLTIGDTHEYEHPFAFDTLEDPYDHLTEVVESFLGRPLPKIRRRWAGVYAQCTDTSRVVHRQRVRDGVWLVTGPGGRGMTCSPAIAETTANELGW
>NZ_CP050975.1|WP_168528295.1|3602223_3602937_-|HAD-hydrolase-like-protein
MTRDTRLVVLDMAGTTVADGGLVERAFAVAAGELGVEPGSADHAEKLDYVRATMGESKISVFRHLFGEEPLAQRANSAFEKAYGELVDGGHIAPVAGAREAIEALTGAGRTVVLSTGFARVTQDAILDALGWQDLVPLTLCPADAGGRGRPYPDMVLEAFLRTGAADGVQQIAVVGDTSYDMLSGVRAGGKPGRLSVLTGAHDDAALRAAGAGHVLGSVAELPALLLGSDRPGGDGR
>NZ_CP050975.1|WP_168528294.1|3601171_3602227_-|ATP-binding-cassette-domain-containing-protein
MTSGIRFDRVSVAYDGTTVLDALDLTVEPGEVMALLGPSGSGKTTALRAVAGFVRPASGRVFIGDRDVTDLPPHRRGIGMVVQQYALFPHLRVEDNVAFGLKARKVARSEIRGRVAEALEMTGMAAYARRRPRELSGGQQQRVAIARALAIRPGVLLLDEPLSALDAQLRSGMLAELARLHRELPDVSILYVTHDQVEALTLADRIAVMDRARLRDCGTPQELYRAPRTEFTASFVGNANLLPVTVGSGTVSLAGTELKADTADAAPGASATLCVRPHLVGLGPGPNQVTGTVSEVQWRGSTHRLYVDVAGHRVMADLRELREPPVHGDPVTLHFAPDDAVLLSAGVTADG
>NZ_CP050975.1|WP_168528293.1|3600306_3601179_-|2-aminoethylphosphonate-ABC-transporter-permease-subunit
MASAVATAPVPAPAGSRRRIPPWAWALPPVAVLGLVFLYPLALVVQQSFRPDTGGTSAQAYGDVFASTAFREALGTTVWLAVGSTAGCLVLGFALALVIAFVPFPGGKAVARFIDVFLSFPSFLITLALLFLYGSVGIANGLWTDATGTAEGPFRFLTTPWGVLLAEITYFTPFVMRPLLAAFSNIETAQLEVASSLGARPARIVRQVILPEALPALAAGGSLVLVLCLNEFGIVLFTGAKGVTTLPMLVYSKAILESDYPGACVVAVVNVLISVGLYGLYRVVSRRAGA
>NZ_CP050975.1|WP_168528292.1|3599522_3600320_-|ABC-transporter-permease-subunit
MLVHSRKGKWATWAVFFLLFLPLFALPLLVVLAASFATNWSSAFPSGFTTGHYTAATRGESLQALTTSLVTALTASVLALVVGTWAALAAHALRKRGARVLDALFMLPVAVPSVVVGLAVLVAFSKPPVLLNGTRWIVILAHAVLVTAFAHQSVSAAVVRLDPAYEQAAASLGARPSYVLWRVRLPLLLPSLTAAAGLCFALSMGELSATMMLYPPDWTPLPVQIYAATDRGALFTGSALAVVLMTATVLVLFAVSRIRTRATYR
>NZ_CP050975.1|WP_168528291.1|3598359_3599442_-|2-aminoethylphosphonate-ABC-transporter-substrate-binding-protein
MPTNTHLKSIAAVVGGLALASTLTACGGDSAAADAKVVTVYSADGLKGENGDGWYDQVFKDFEKQTGIKVKYVEGGSGEVVQRAVREKTNPQADVLVTLPPFIQQADGKGLLQKYTPKGSDQVDGADKATDGTWTSVVNNYFGFVYNKKELKQAPTNWDQLLDASYKNKLQYSTPGVAGDGTAVLIKAIHDFGGKGAALAYLKKLQANNVGPSASTGKLAPKVDKGELLVANGDVQMNYAQSKDMPNLGIWFPQATDKAADAAGKPTTFALPYAGGLVTKAPHSENGKKLLDFMLSAKAQQQVSEIGGGFSARGDVKATDANAIALTKLMDGVEVFAPDWADIDKNLTSYVDDWKSATGS
>NZ_CP050975.1|WP_168528301.1|3609707_3610565_-|fumarylacetoacetate-hydrolase-family-protein
MKLLRVGTAGSERPALLDTEGTLRDLSGVVPDIDGPLLADDAALGRIRTAAESGELPALDAAGLRVGPPLARIGKVVCIGLNYHDHARETGAEPPAEPVIFFKAADTVVGPHDTVLVPRGSVKTDWEVELAVVIGRTARYLPSHEEALAHVAGYAVAHDVSEREFQIERGGTWDKGKNCETFNPLGPWLVTADEVPDPQNLALRLWVNGELKQDGTTAEQIFPVAEVVRYVSQFMTLYPGDVINTGTPAGVALGQPEPKPYLRAGDVVELEIEGLGRQRQAFGDA
>NZ_CP050975.1|WP_168533664.1|3610715_3611426_-|membrane-protein-insertase-YidC
MSAFGTLVEQVADLLQPLFHASAAAAAIVLITALVRLLVHPLSRASARGQRARTALRPRVAELREKHGGNPEKYQKALLELHAREKVSPLAGCLPGLLQIPAFVLLYHLFSGTTLGDGPNGLLNHRLFGAPLGHRYADALGDGGVFGAQGLVYLGLFAVVALVATFNYRRTKRTTAAAAPEAGGEQRVPGLGAVSAFMPFLSYFTLLTVALVPLAAALYVVTTTTWSAVERAVLYP
>NZ_CP050975.1|WP_168533666.1|3611557_3611884_-|hypothetical-protein
MRSAVAPFPRPLPLVLLLLFLAEVVLLDAGGLSAAVAVAFAATTAVGSAIAVCAVLAARCAPVVPRTRVRTALRDREHRTAFLPQRDPDAAGRRRPRAPGSALPATTA
>NZ_CP050975.1|WP_168528302.1|3612117_3612933_-|class-E-sortase
MRVRVPVVRHSTLRRRALRRRVLWTGGELLVTVGVVLLLLVVHQLWWTNWQAQHNADREVRALEREWGAPGTPGPAGPSEGAEGAEGTERAETEAGDGDGSAGSRERERRAGSTDTPAAPRWSRAYAVLTIPRLGLRVPVAEGVGKRDVLNKGYVGHYKGSQQPGQAGNFAVAGHRNTHGEPFRYINRLRPGDTVRVETASAVFTYAVDRTLPRTSARDGGVIDPVPRSTVRPSYGYSQPGYYITLTTCTPEYTSTYRLVVWGKLRSMKPR
>NZ_CP050975.1|WP_168528303.1|3613215_3614691_+|beta-1,6-galactanase
MIRRRTLLAAAGGTVLGGALATGTARADATIAVNPGTTYGKWDGWGTSLAWWANVFGARDDFADLFFTTRSVTYNGTALPGLGLNIARYNLGACSANSVGGESMAASPDIPGYKQIEGYWQDWNNEDPTSSAWKWTADATQRAALTKATARGAASELFANSPMWWMCLNHNPSGASGGGNNLQSWNYRQHASHLAAVALYAKNNWGVNFSTVEAFNEPSSNWWTATGTQEGCHVDASVQSAVLPHLRDELDRRGLTGTRISASDETNYDVARTTWNSFGSTTRALVDRVNVHGYQGSGGRRDLLYTDAVTTGGKALWNSEYGDGDGTGLSLASNLLLDFRWLHPTAWVYWQVMDPTAGWGMIKYDESTLTAGAVETKLYVMAQFSRHIRPGMTIVDTGVDYAVAAYDATAKRLVIVAANKSTSAQTLTFDLSRFTTVTGSTGGLVPRWNTLTAGGGDLYTAHSDTRLNGKSLSVPFAAGAVQTLQVEGVVA
>NZ_CP050975.1|WP_168528304.1|3614848_3615868_+|SEC-C-domain-containing-protein
MRPDTPAENVDHTAEAARLERTAGLYPEDAEHLLLQAAAHLELAGDRPGASALYDRLLSSSTPLERPHLVRALKASNLWEYGHEAEARAIIDGVRAASPRDPAPWVIVAEALESHDELEAAQETFTEGATLLLTDVTDPPYATRPILFGRHRVRRMLGVAHDDWDALADTLHSSPVSLDELHDPKRVWSLGSENPAELQAEISRLRAELGAHREALSRPFPVAVLHWPADELAELLAAYPSLATEYPSHEEHLATIEASLRELSASGTPNLGIVTGTVPSYEAFSASEASSPSDTTLLPQYATTLAARGRATSWPPQRGVVCWCGSGRGYGECHGTPGA
>NZ_CP050975.1|WP_168528305.1|3616045_3617626_+|ATP-binding-protein
MPPYQPSSDWQFDVPTSGSKRLPPAARSFESLTHQGYGFEAAVADLIDNSIDAGAHNVVVSFLRDTGEHGGRDRLVGLLVIDDGHGMDEASLDTAMTVGGREKYAAGSLGHFGAGLKAASLSHADALTVISRTKRSPSAGRRWLTTRAQADFTCDIVDAAYCQSLVDRYDGIIDWHGTIVRWDEVRAFETITTGQTDRYLNDAIERLETHLGLFLHRFLARDGFHIDIVVEDVHTREELDHRSVEHIDPFGYRVPGRPGYPRTYVAPVEGAGDVALTAHIWPPKSPLVAYRGIGPLAERQGFYLYRNDRLVQAGGWNDTRSPEGHLALARIAVDLPPEPNDVFSLTVKKDGVQVTPAFARGLERAVTPTTGHTFTEYIREAETTYREAAKRRTEVKRTAVIPPGKGIDPKLKRTLRDELPQLEGDDPITFTWARLDVPPGADSAELLFTIDHKERLVVLNKDYRHVFNCGRRGGSNDAPVLKSLLYLMLNEIFQKERVWANQTDKVALWNSVLVTAVRAELARTDG
>NZ_CP050975.1|WP_168533667.1|3617745_3620664_+|Z1-domain-containing-protein
MSRRGPRHFAKLAFVLADTDEPADTYVTGFHDRILAAVPGDELLDLWRRKLIAWDFEQSPMWSATAPRTPERRAEVYGKLALDADLRKAFDAVVPVHTEPGPVTISREFQPWYTRETAANRSFYWASYERLLRRKGWNDAAVSGLDEAAHAVVERLADPTRDDPYGARGLVVGYVQSGKTANFTGVTAKAIDAGYRLVIVLGGTLNLLRGQTQRRLDMELIGQENILGAADPNDADALVGIDYQDDEDWPAKFVSFGARPSVLGAFDIERLTSRDHDYMSLERGISALEFDKPDRTRPLHDPANLHVARARVMVVKKNKSVLEKLVKDLKKMGPILGEIPALIIDDESDQASVNTTDPKKWEDGKVTRTAINGQISKLLTLLPRAQYVGYTATPFANVFIDPGDEEDLFPRDFLISLPRPTGYMGVQDFHDLDPVDDGEGEGEAERRHVRGIYDSTGDRLQEALDAFMLTGALKLYREAQGVPSDEFRHHTMLVHESVRMAEHAALALRINTLWDNAAYTGPEGHARLASLFDKDFHTYADSSLPTPPTYADLKPHVSDARRLINRGGTPVIVVNGESERDYAQPHLDFDRTPNVWKILVGGTKLSRGFTVAGLTITYYRRTTQQADTLMQMGRWFGFRPGYRDLVRLYIGREESLGRGRNAKTVDLYEAFEAICRDEELFRAELARYAPLVDGRPQVTPAQIPPLVAQHLPWVKPSARNKMFNAELVEVRSPGTPIEPAAYPQDAKMTARNTERWKPVLAAVSGTPTTCRLLPDTTSPLSRSFQAGTTVVSHTQLLSILSSLEWEDGNVLAPHLAYLSQLDGRLSKVDDWLVIVPQRTPRNRIEASVLGQGPFSLFRRSRQSGKASFGRISGLEHRLFAQQLIDQSGSVSAGGSSPALGSTRGVVLLYPVVEASHDDEVKAVAATGTATSDRVIMAFTVIPPKAALDTKQRLVRFQTRDSTRPDAVIVNAI
>NZ_CP050975.1|WP_168528306.1|3620711_3621692_+|restriction-endonuclease
MLPFEEADIRAAASVALQHAAAGADPELDKVYEHIKALDPTGCRFSRVLRETIDQLLNGEVTGRYDWKTLFKTEKTHAGTLVEINLQREFKFADGDAMDYQIAGVDVDCKYSQQFGGWMIPPEAVDRLCLLAWANDYKSVWSIGLVRIRNEWLNTGNNRDLKLTIKADHRDKIRWLWRDEDLPENVLLHMDAADREAVFTSNSGQRRLNELFRRVQKRRIGRNVVRTVAQQKDYMKRVRGNSGSRSALRAEGILIMGDSASHRVIAGRLGLPLPEEGEFVSARVVTARPHHGKALQVSLGGNPWVLAQPDDPVEAAPALPSHTGQD
>NZ_CP050975.1|WP_168528307.1|3621694_3622453_+|restriction-endonuclease
MNAPFATGLLGWKRLEKTGNLVPNSADSDSNTSKLLARHVLEALGVESDVVLPGTPDSLGPALEHAVCDHLGAVLPDLSPERVWHVDHKKTVADFTQYEHLDRVAEAVRKNATLRVDLGRDYLIKPDVTVGVTRPTAEATTRPRLHAAVSCKWTIRSDRVQNVRHEFLQMIRHRRGRLPHLVVVTAEPMPSRIASIARGTGEADAIYHIAFDALKAAVAAVGSRQQRDDLSEIIEQGRLLPYGTLPPTLSGW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_8

5383503-5383602

Orphan

Consensus_repeat	Method
GAGGACGTCGAGGACGAGGACGTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_8

>merge|NZ_CP050975|8|5383503-5383602|CRISPRCasFinder
CTGCACGTCGAGGACGAGTCCGGTGAGGACGTCGAGGACGAGGACGTCCCCGCGGACGCTCTCACCGAGAATGACGAGACCGCCGAGGACGAGCACGCCG

>NZ_CP050975|8|6|5383503-5383602|CRISPRCasFinder
CTGCACGTCGAGGACGAGTCCGGTG	AGGACGTCGAGGACGAGGACGTCCCCGCGGACGCTCTCACCGAGAATGAC
GAGACCGCCGAGGACGAGCACGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168529621.1\|5388659_5389040_+\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP050975.1\|WP_019072313.1\|5384441_5384876_+\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP050975.1\|WP_168529609.1\|5378276_5379332_+\|UDP-N-acetylmuramate-dehydrogenase	unknown	unknown	gnl\|CDD\|237552
NZ_CP050975.1\|WP_168529619.1\|5385874_5386774_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319988
NZ_CP050975.1\|WP_067367164.1\|5384981_5385707_+\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP050975.1\|WP_168533940.1\|5386894_5387728_+\|DUF1396-domain-containing-protein	unknown	unknown	gnl\|CDD\|369238
NZ_CP050975.1\|WP_168529623.1\|5389678_5393164_+\|DNA-directed-RNA-polymerase-subunit-beta	unknown	unknown	gnl\|CDD\|234749
NZ_CP050975.1\|WP_168529627.1\|5397928_5399188_-\|M48-family-metalloprotease	unknown	unknown	gnl\|CDD\|320696
NZ_CP050975.1\|WP_168529605.1\|5375183_5375612_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239537
NZ_CP050975.1\|WP_153289137.1\|5383002_5383284_+\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|236066
NZ_CP050975.1\|WP_164373166.1\|5388019_5388550_+\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP050975.1\|WP_168529607.1\|5375973_5376543_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP050975.1\|WP_168529603.1\|5374734_5375181_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|379194
NZ_CP050975.1\|WP_004571794.1\|5374369_5374534_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP050975.1\|WP_168529611.1\|5379358_5379991_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187555
NZ_CP050975.1\|WP_168533943.1\|5397400_5397871_+\|DUF1707-domain-containing-protein	unknown	unknown	gnl\|CDD\|377959
NZ_CP050975.1\|WP_168529613.1\|5380145_5381186_-\|adenosine-deaminase	unknown	unknown	gnl\|CDD\|273619
NZ_CP050975.1\|WP_168529615.1\|5381345_5382572_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|235596
NZ_CP050975.1\|WP_168529625.1\|5393275_5397175_+\|DNA-directed-RNA-polymerase-subunit-beta'	unknown	unknown	gnl\|CDD\|234794
NZ_CP050975.1\|WP_168529601.1\|5371577_5372234_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168529621.1\|5388659_5389040_+\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	4.58611e-42
NZ_CP050975.1\|WP_019072313.1\|5384441_5384876_+\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	2.64094e-95
NZ_CP050975.1\|WP_168529609.1\|5378276_5379332_+\|UDP-N-acetylmuramate-dehydrogenase	gnl\|CDD\|237552	PRK13903, murB, UDP-N-acetylmuramate dehydrogenase.	0
NZ_CP050975.1\|WP_168529619.1\|5385874_5386774_+\|hypothetical-protein	gnl\|CDD\|319988	cd16334, LppX-like, family includes lipoproteins LppX, LprA, LprF and LprG from Mycobacterium tuberculosis. This family includes the homologous lipoproteins LppX, LprA, LprF and LprG from Mycobacterium tuberculosis (Mtb), all of which share a core fold with lipoprotein transporter proteins LolA and LolB. Mtb contains components such as glycolipids, lipoglycans and lipoproteins that play critical roles in regulating host responses and promoting survival of the pathogen. Mtb LprA is a lipoprotein agonist of Toll-like receptor 2 (TLR2) that regulates innate immunity and APC function. LprF, which is also found in Mycobacterium bovis but not in the nonpathogenic Mycobacterium smegmatis, has a central hydrophobic cavity that binds a diacylated glycolipid that it transfers from the plasma membrane to the cell wall, which might be related to the pathogenesis of the bacteria. Similarly, LprG functions as a carrier of glycolipids and lipoglycans, such as lipoarabinomannan (LAM), during their trafficking and delivery to the mycobacterial cell wall, contributing to virulence; LAM inhibits fusion of phagosomes with lysosomes as a means for mycobacteria to evade host defense. In addition, LprG has potent TLR2 agonist activity that modulates antigen processing of dendritic cells and macrophages. LppX is required for the translocation of the key virulence factors, the phthiocerol dimycocerosates (PDIMs), to the surface of Mtb.	0.0082828
NZ_CP050975.1\|WP_067367164.1\|5384981_5385707_+\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	3.22222e-146
NZ_CP050975.1\|WP_168533940.1\|5386894_5387728_+\|DUF1396-domain-containing-protein	gnl\|CDD\|369238	pfam07161, LppX_LprAFG, LppX_LprAFG lipoprotein. This entry consists of several lipoproteins mainly from Mycobacterium species, collectively known as the LppX_ LprAFG family. Proteins in this entry include LprG, LppX, LprF and lprA.	8.23127e-13
NZ_CP050975.1\|WP_168529623.1\|5389678_5393164_+\|DNA-directed-RNA-polymerase-subunit-beta	gnl\|CDD\|234749	PRK00405, rpoB, DNA-directed RNA polymerase subunit beta; Reviewed.	0
NZ_CP050975.1\|WP_168529627.1\|5397928_5399188_-\|M48-family-metalloprotease	gnl\|CDD\|320696	cd07337, M48B_HtpX_like, Peptidase M48 subfamily B HtpX-like membrane-bound metallopeptidase. This HtpX family of peptidase M48 subfamily B includes uncharacterized HtpX homologs and consists of proteins smaller than Ste24p, with homology restricted to the C-terminal half of Ste24p. HtpX expression is controlled by the Cpx stress response system, which senses abnormal membrane proteins. HtpX participates in the proteolytic quality control of these misfolded proteins by undergoing self-degradation and collaborating with FtsH, a membrane-bound and ATP-dependent protease, to eliminate them. HtpX, a zinc metalloprotease with an active site motif HEXXH, has an FtsH-like topology, and is capable of introducing endoproteolytic cleavages into SecY (also an FtsH substrate). However, HtpX does not have an ATPase activity and will only act against cytoplasmic regions of a target membrane protein. Thus, HtpX and FtsH have overlapping and/or complementary functions, which are especially important at high temperature; in E. coli and Xylella fastidiosa, HtpX is heat-inducible, while in Streptococcus gordonii it is not.	7.94896e-28
NZ_CP050975.1\|WP_168529605.1\|5375183_5375612_+\|MaoC-family-dehydratase	gnl\|CDD\|239537	cd03453, SAV4209_like, SAV4209_like. Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.	6.58263e-58
NZ_CP050975.1\|WP_153289137.1\|5383002_5383284_+\|preprotein-translocase-subunit-SecE	gnl\|CDD\|236066	PRK07597, secE, preprotein translocase subunit SecE; Reviewed.	2.54726e-19
NZ_CP050975.1\|WP_164373166.1\|5388019_5388550_+\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	8.24209e-69
NZ_CP050975.1\|WP_168529607.1\|5375973_5376543_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.64312e-11
NZ_CP050975.1\|WP_168529603.1\|5374734_5375181_+\|MaoC-family-dehydratase	gnl\|CDD\|379194	pfam13452, MaoC_dehydrat_N, N-terminal half of MaoC dehydratase. It is clear from the structures of bacterial members of MaoC dehydratase, pfam01575, that the full-length functional dehydratase enzyme is made up of two structures that dimerize to form a whole. Divergence of the N- and C- monomers in higher eukaryotes has led to two distinct domains, this one and MaoC_dehydratas. However, in order to function as an enzyme both are required together.	5.04302e-40
NZ_CP050975.1\|WP_004571794.1\|5374369_5374534_+\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	1.12603e-22
NZ_CP050975.1\|WP_168529611.1\|5379358_5379991_-\|NAD(P)H-binding-protein	gnl\|CDD\|187555	cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs. Human BVR-B catalyzes pyridine nucleotide-dependent production of bilirubin-IX beta during fetal development; in the adult BVR-B has flavin and ferric reductase activities. Human BVR-B catalyzes the reduction of FMN, FAD, and riboflavin. Recognition of flavin occurs mostly by hydrophobic interactions, accounting for the broad substrate specificity. Atypical SDRs are distinct from classical SDRs. BVR-B does not share the key catalytic triad, or conserved tyrosine typical of SDRs. The glycine-rich NADP-binding motif of BVR-B is GXXGXXG, which is similar but not identical to the pattern seen in extended SDRs. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.39972e-52
NZ_CP050975.1\|WP_168533943.1\|5397400_5397871_+\|DUF1707-domain-containing-protein	gnl\|CDD\|377959	pfam08044, DUF1707, Domain of unknown function (DUF1707). This domain is found in a variety of Actinomycetales proteins. All of the proteins containing this domain are hypothetical and probably membrane bound or associated. Currently, it is unclear to the function of this domain.	5.46067e-19
NZ_CP050975.1\|WP_168529613.1\|5380145_5381186_-\|adenosine-deaminase	gnl\|CDD\|273619	TIGR01430, Putative_adenosine/adenine_deaminase, adenosine deaminase. This family includes the experimentally verified adenosine deaminases of mammals and E. coli. Other members of this family are predicted also to be adenosine deaminase, an enzyme of nucleotide degradation. This family is distantly related to AMP deaminase.	7.93248e-145
NZ_CP050975.1\|WP_168529615.1\|5381345_5382572_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|235596	PRK05764, PRK05764, aspartate aminotransferase; Provisional.	0
NZ_CP050975.1\|WP_168529625.1\|5393275_5397175_+\|DNA-directed-RNA-polymerase-subunit-beta'	gnl\|CDD\|234794	PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional.	0
NZ_CP050975.1\|WP_168529601.1\|5371577_5372234_-\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.50286e-54

>NZ_CP050975.1|WP_153289137.1|5383002_5383284_+|preprotein-translocase-subunit-SecE
MTDAVGSIDMPDAEAPESKKKARKGGKRAKKGPLKRLATFYRQIVAELRKVVWPTRNQLTTYTTVVIVFVVIMIGLVTVIDYGLNHAAKYVFG
>NZ_CP050975.1|WP_168529615.1|5381345_5382572_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MSAATPPTERRVSARVGAISESATLAVDAKAKALKAAGRPVIGFGAGEPDFPTPDYIVQAAIEACSNPKYHRYTPAGGLPELKAAIAAKTLRDSGYEVEAAQVLVTNGGKQAIYEAFAALLDPGDEVIVPAPYWTTYPESIRLAGGVPVEVVADETTGYRVSVEQLEAARTEHTKVLLFVSPSNPTGAVYTREQVEEIGRWAADKGLWVLTDEIYEHLVYGDAEFHSVPVVVPELADKCIVVNGVAKTYAMTGWRVGWVIGPKDVIKAATNLQSHATSNVSNVAQVAALAAVSGDLTAVAEMREAFDRRRKTIVRMLNEIEGVLCPEPEGAFYAYPSVKALLGKEIRGRRPQDTVELAALILEEAEVAVVPGEAFGTPGYLRLSYALGDEDLVEGVSRIQKLLAEAQD
>NZ_CP050975.1|WP_168529613.1|5380145_5381186_-|adenosine-deaminase
MERVRDLSELPKAHLHLHFTGSMRPTTLLELADKYGVRLPEALTEALTGGEPPKLRATDERGWFRFQRLYDAARSCLREPDDIRRLVREAAEEDIKDGSGWLEIQVDPTSYAPRLGGLIPALEIILDAVDSAVRETGIGMRVLVAANRMKHPLDARTLARLAVRYADRGVVGFGLSNDERRGMARDFDRAFAIAREGGLLSAPHGGELAGPASVRDCLDDLHATRIGHGVRAAENPRLLARLAERGITCEVCPASNVALGVYEKAEDIPLRTLFEAGVPMALGADDPLLFGSRLAAQYELARHHHGFTDAELAELARQSVRGSAAPQDVRGKLLAGIDDWLAAPVA
>NZ_CP050975.1|WP_168529611.1|5379358_5379991_-|NAD(P)H-binding-protein
MKLTVFGATGGIGQEIVRQALASGHQVTAVVRDPARLSVTGAGLEVLRADLTDPEALRPAVRGRDAVLSGLGARSRKDAGVTTRLTRTVLGAMRAEDVRRLLVVSAGPVGPDPEGASFADRAARALISVILKDVYADLRGMEGELARSDTDWTAVRPPRLRNKPVTGSYRTAVGSFPLGGRFIARADVAHAMLAMITDTGTVKQGVGIAY
>NZ_CP050975.1|WP_168529609.1|5378276_5379332_+|UDP-N-acetylmuramate-dehydrogenase
MQELHDAPLAPLTTFRLGGPATRLITATTDAEVIAAVREADDTGTPLLLIGGGSNLVIGDNGFAGTALRIATSGFALDGTRLELAAGEVWSDAVARTVEAGLAGVECLAGIPGSAGATPIQNVGAYGQEVSSTITEVIAYDRKTRETVTLTNADCAFSYRHSRFKADPERHVVLRVRFELEDAAGLSAPVKYAETARALGVEPGDRVPLTAARETVLKLRSGKGMVLDPEDHDTWSAGSFFTNPILTDEEFAAFHARVAQRLGSGAVPPAYPAGEGHTKTSAAWLIDKSGFTKGYGSGPARISTKHTLALTNRGRATTEDLLALAREVVAGVRDAFGITLVNEPVTVGVRL
>NZ_CP050975.1|WP_168529607.1|5375973_5376543_+|TetR-family-transcriptional-regulator
MSAEDRRESVIRAAIGEFARGGYYGTSTEAIAKRVGVSQPYLFRLFPGKKAIFLAAAERCLEDIRRTFEEASEGLEGEEALHSMATAYTRVIAEHPERLLMQMQTYTAVAAAEEAGDREFGEAVRSGWTRLWDTVHLPLGADVGETTNFLAYGMLINCFVAMGFPAGHRVWEGIYPEARVAGRAGVSGG
>NZ_CP050975.1|WP_168529605.1|5375183_5375612_+|MaoC-family-dehydratase
MAAKITYGDVEVGTELPPQTFPVTRATLVRYAGASGDFNPIHWNEKFAVEVGLPDVIAHGMFTMAEAIRVVTDWVGDPGAVLEYGVRFTKPVVVPNDDKGATVEVSAKVAAKLDDNTVRVDLTATSAGQKVLGMSRAVVRLA
>NZ_CP050975.1|WP_168529603.1|5374734_5375181_+|MaoC-family-dehydratase
MALDQSFVGRSYPPTEPYEVGREKIREFAEAVGDTNPVYTDPEAAKALGHADVIAPPTFVFAITFKAAGQVVEDPQLGLDYSRVVHGDQKFAYTRPVRAGDRLTVTSTIEAIKSMAGNDILDIRGEVHDETGEHVVTAITKLVARAEG
>NZ_CP050975.1|WP_004571794.1|5374369_5374534_+|50S-ribosomal-protein-L33
MAATDVRPKITLACVECKERNYITKKNRRNDPDRLEMKKHCPRCNAHTAHRETR
>NZ_CP050975.1|WP_168529601.1|5371577_5372234_-|NAD(P)H-binding-protein
MRIVIAGGHGQIALRLERLLAARGDEVAGIIRRAEQGDDLRAAGAEPVLCDLESASVKEVAAHLRGADAAVFAAGAGPGSGAARKDTVDRGAAVLFADAAEQAGVRRYVVVSSMGADPSHQGDDVFDVYLRAKGEADEYVRGRTALEWTILRPGGLIDDAGTGLVRLEASTGRGTVPRDDVAAVLAELVDTPATAGLTLELISGSTPVSVSVKSVAGN
>NZ_CP050975.1|WP_019072313.1|5384441_5384876_+|50S-ribosomal-protein-L11
MPPKKKKVTGLIKLQINAGAANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGWVIPVEITVYEDRSFTFVTKTPPAAKMILKAAGVEKGSGEPHKTKVAKITQAQVREIATTKLPDLNANDLDAASKIIAGTARSMGITVEG
>NZ_CP050975.1|WP_067367164.1|5384981_5385707_+|50S-ribosomal-protein-L1
MSKRSKSLRAADAKIDREKLYAPLEAVRLAKETSTSKFDGTVEVAFRLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGDRAEAALAAGADIVGSDELIDEVSKGRLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTPDVAKAVTEIKGGKIEFRVDKHSNLHFIIGKTSFEEAKLVENYGAALDEILRLKPSAAKGRYIKKAAISTTIGPGVPVDPNRTRNLLVEEDPAAV
>NZ_CP050975.1|WP_168529619.1|5385874_5386774_+|hypothetical-protein
MKSTTVRRVTLAIALVSALTTVAACSSGSSGGSGKDDKAAHKSPTRVSPIAALQSAEKSTDGADSAKVESTTTMGTLMSMKSDGVMGWGDGLTGDMTITYTGGTMADTMRKAGVTSMQARYLSDAYYAKMGETFARQAGGKHWIRYGYDDLAKLGGGSGALLKDQMQNSSPNQSVKLLLASGDVKKVGEEKVRGKQTTHYAGTVDVSDLAARSSHLSAGQLADLKKQFTQAGITTEDVDIWVDGDDLLVKAVSKGDLSTGTMSSTTYYTDYGVKVSSQAPPASDTADFKDLLKTQGAAG
>NZ_CP050975.1|WP_168533940.1|5386894_5387728_+|DUF1396-domain-containing-protein
MRGSVRRGATGAALAALVLGGGAVACAKSDESPKMTPAAAVAAAAKNTEAITSLTYRMTGKVPETGRVEAEAAMSMKPLAMSMKMNALDQGADGRMEIRVVDKAMYLGGGQAVAKELDGKSWMKFDLSGAAGGPGAGKLPSQAGQDPSQESTYLTGSKDVKKVGTEKVDGVSTTHYKGTVTLDDLRASLKDEDKATREKREKSLKQYEDLGADKLTMDMWIGPDDHTKQVRVRAAADKGPFDVTLTFLDYNKPVTVKAPPAKDTVDLAAMMKDAQAG
>NZ_CP050975.1|WP_164373166.1|5388019_5388550_+|50S-ribosomal-protein-L10
MARPDKAAAVAELADQFRSSNAAVLTEYRGLTVAQLKTLRRSLGEDAQYAVVKNTLTKIAANEAGISTLDDLFNGPTAVAFITGDPVTSAKGLRDFAKDNPNLVIKGGVLDGKALSADEIKKLADLESREVLLAKLAGAFKGKQTQTAQLFQALPSKFVRTAEALRAKQAEQGGAE
>NZ_CP050975.1|WP_168529621.1|5388659_5389040_+|50S-ribosomal-protein-L7/L12
MAKLSQEELLAQFENLTLIELSEFVKAFEEKFDVTAAAAVAVAGPAGPAAVEAAEEQDEFDVILTGAGEKKIQVIKVVRELTSLGLKEAKDLVDGAPKPVLEKVAKEAAEKAAESLKGAGASVEVK
>NZ_CP050975.1|WP_168529623.1|5389678_5393164_+|DNA-directed-RNA-polymerase-subunit-beta
MAASRTASTANTNNGASTAPLRISFAKIKEPLEVPNLLALQTESFDWLLGNEAWKARVEAALDSGQDVPTKSGLEEIFEEISPIEDFSGSMSLTFRDHRFEPPKNSIDECKDRDFTYAAPLFVTAEFTNNETGEIKSQTVFMGDFPLMTNKGTFVINGTERVVVSQLVRSPGVYFDSSIDKTSDKDIFSAKVIPSRGAWLEMEIDKRDMVGVRIDRKRKQSVTVLLKALGWTTEQILEEFGEYESMRATLEKDHTQGQDDALLDIYRKLRPGEPPTREAAQTLLENLYFNPKRYDLAKVGRYKVNKKLGGEAPLDAGILTVEDIISSIKYLVKLHAGETETVGNNGTSIVVETDDIDHFGNRRLRNVGELIQNQVRTGLARMERVVRERMTTQDVEAITPQTLINIRPVVASIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGFEVRDVHPSHYGRMCPIETPEGPNIGLIGSLASYGRVNAFGFVETPYRKVTGGVVTDDVDYLTADEEDRFVIAQANAPLTDELRFEESRVLVRRRGGEVDYVPGEDVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMMRQAVPLIKSEAPLVGTGMEYRCAVDAGDVLKSEKDGVVQEVSADYVTTANDDGTYTTYRLHKFSRSNQGTSVNQKVVVDEGARVVAGQVLADGPATENGEMALGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLSSIHIEEHEVDARDTKLGPEEITRDIPNVSEEVLADLDERGIIRIGAEVVAGDILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGEIGKVIGVRVFDREEGDELPPGVNQLVRVYVAQKRKITDGDKLAGRHGNKGVISKILPIEDMPFLEDGTPVDIILNPLGVPSRMNPGQVLEIHLGWLASRGWDVSGLGEDWAQRLQAIEADVVAPGTNVATPVFDGAREDELAGLLNHTIPNRDGERMVLPTGKAPLFDGRSGEPFPEPISVGYMYILKLHHLVDDKLHARSTGPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEPGIPESFKVLIKEMQSLCLNVEVLSSDGMSIEMRDTDEDVFRAAEELGIDLSRREPSSVEEV
>NZ_CP050975.1|WP_168529625.1|5393275_5397175_+|DNA-directed-RNA-polymerase-subunit-beta'
MLDVNFFDELRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKVIYFAAYMITFVDEERRTRDLPSLEAHVSVERQQIENRRDADLEARAKKLETDLAELEAEGAKADVRRKVREGAEREMKQLRDRAQREIDRLDEVWTRFKNLKVQDLEGDELLYRELRDRFGTYFDGSMGAAALQKRLESFDLDEEAERLREIIRTGKGQKKTRALKRLKVVSAFLQTSNSPKGMVLDCVPVIPPDLRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSARSVIVVGPQLKLHQCGLPKAMALELFKPFVMKRLVDLNHAQNIKSAKRMVERGRTVVYDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILKPADGRPVTMPTQDMVLGLFFLTTDGELRDVKGEGRAFGSTAEATMAFDAGELALQSAVDIRFPVGTIPPRGWTPPAQEEGEPEWQQGDTFRLRTTLGRALFNELLPEDYPFVDYSVGKKQLGEIVNDLAERYPKVIVAATLDNLKAAGFYWGTRSGVTVAISDIVVPEAKKEIVKGYEAQDEKVQKQYERGLITKDERTQELIAIWTKATNEVAEAMNANFPKTNPIFMMVDSGARGNMMQMRQIAGMRGLVSNAKNETIPRPIKASFREGLSVLEYFISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIIREEDCGTDRGLKLHIAERGADGVLRKAENVETSVYARALAEDITVDGKVLAPANTDLGDVLIDELVKHGIEEVKTRSVLTCESAVGTCAMCYGRSLATGKLVDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGLPRVVELFEARTPKGVAPISEAAGRIRIEETEKTKKIVVTPDDGSDETAFPISKRAKVMVREGDHVEVGQKLTFGATNPHDVLRILGQRAVQVHLVGEVQKVYNSQGVSIHDKHIEIIIRQMLRRVTIIESGDAELLPGELVERSKFETENRRVVQEGGHPASGRPQLMGITKASLATESWLSAASFQETTRVLTDAAINAKSDSLIGLKENVIIGKLIPAGTGLSRYRNIRVEPTEEAKAAMYSAVGYDDIDYSPFGTGSGQAVPLEDYDYGPYNQ
>NZ_CP050975.1|WP_168533943.1|5397400_5397871_+|DUF1707-domain-containing-protein
MLASHADRERAVDVLRAGFGEGRLEQAEFEKRVARAYAARTVGELAVLVGDLPQGPVPMTAGPGAVVPQTFLPAPRPMTNGKAVGAMVCGLLTVVTLGATGIPAVVLGHSARSEMRRTGESGDGLAMTGLVLGWLSVAGWALFLMLAMIAAVAAGG
>NZ_CP050975.1|WP_168529627.1|5397928_5399188_-|M48-family-metalloprotease
MTQPPSSPPEYPQYPAPPQSPVPPPYPGQQPPPYPGERPPPYPGEQPPAYPGQQPPSYPGQHSQAPHHPQPPRYPQAAAPPSQPAYPHAATPPAPPLSPGDPAHPHHISTDHGRVHIRSQQRRTDSTAVGNLLLHLPNFLCSLFVVGLFSAFFGDLGFLVVLAWLASGALVFHRPTESAIARRLLRLRYPTPQERAKLEPVWHEVTARAGVEGRTYELWVEDSDGLNAVAAAGHIVGVTRFAMNHLPNGELAAVLAHELGHHVGGHAWSSLLGYWYALPGRLAWRVLRGFASIVFKVSRAFSCFGAAFVVLVLGGLALATVSTLYGLPLLVLAVPYALAAVGRRAELRADEHAAALGFAPMLAAVLHKLHQQEQYETAALTARNGGVAPRESSLSKLLSSHPDHYTRLHHLQPYLQPPG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_9

5453677-5453798

Orphan

Consensus_repeat	Method
TGGGCGTCGATCGCTCGGTGACGGCGGGGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_9

>merge|NZ_CP050975|9|5453677-5453798|CRISPRCasFinder
TGGGCGTCGATCGCTCGGTGACGGCGGGGTCGACTCCGAGCCGGTGCCGGGTGGGCGCACAGTTCCCCGCGCCTCTGACGGGCGTTCTGTTGGGCGTCGATCGCTCGGTGACGGCCGGGTCG

>NZ_CP050975|9|7|5453677-5453798|CRISPRCasFinder
TGGGCGTCGATCGCTCGGTGACGGCGGGGTCG	ACTCCGAGCCGGTGCCGGGTGGGCGCACAGTTCCCCGCGCCTCTGACGGGCGTTCTGT
TGGGCGTCGATCGCTCGGTGACGGCCGGGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168529677.1\|5441479_5442838_+\|phosphoglucosamine-mutase	unknown	unknown	gnl\|CDD\|237672
NZ_CP050975.1\|WP_168529685.1\|5446982_5447354_+\|holo-ACP-synthase	unknown	unknown	gnl\|CDD\|234610
NZ_CP050975.1\|WP_168529701.1\|5459426_5460326_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472
NZ_CP050975.1\|WP_168529681.1\|5443808_5444777_-\|type-I-pantothenate-kinase	unknown	unknown	gnl\|CDD\|235466
NZ_CP050975.1\|WP_168529694.1\|5454487_5455135_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP050975.1\|WP_168529693.1\|5453800_5454355_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168533952.1\|5460330_5461206_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224096
NZ_CP050975.1\|WP_168529696.1\|5455627_5456725_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP050975.1\|WP_168529683.1\|5444996_5446844_+\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_CP050975.1\|WP_168529675.1\|5440794_5441316_+\|30S-ribosomal-protein-S9	unknown	unknown	gnl\|CDD\|178888
NZ_CP050975.1\|WP_168529705.1\|5462683_5463712_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380519
NZ_CP050975.1\|WP_168533950.1\|5455152_5455635_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|273701
NZ_CP050975.1\|WP_168529673.1\|5440308_5440752_+\|50S-ribosomal-protein-L13	unknown	unknown	gnl\|CDD\|181703
NZ_CP050975.1\|WP_168529679.1\|5442834_5443773_-\|DUF389-domain-containing-protein	unknown	unknown	gnl\|CDD\|129372
NZ_CP050975.1\|WP_168529698.1\|5456721_5456979_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168529703.1\|5461238_5462546_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270452
NZ_CP050975.1\|WP_168529687.1\|5449138_5450056_+\|L,D-transpeptidase-family-protein	unknown	unknown	gnl\|CDD\|341130
NZ_CP050975.1\|WP_168529700.1\|5457076_5459377_-\|glycosyl-hydrolase	unknown	unknown	gnl\|CDD\|185053
NZ_CP050975.1\|WP_168529689.1\|5451480_5452719_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP050975.1\|WP_168529691.1\|5452684_5453218_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|376771

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168529677.1\|5441479_5442838_+\|phosphoglucosamine-mutase	gnl\|CDD\|237672	PRK14318, glmM, phosphoglucosamine mutase; Provisional.	0
NZ_CP050975.1\|WP_168529685.1\|5446982_5447354_+\|holo-ACP-synthase	gnl\|CDD\|234610	PRK00070, acpS, 4'-phosphopantetheinyl transferase; Provisional.	6.17798e-49
NZ_CP050975.1\|WP_168529701.1\|5459426_5460326_-\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.4162e-61
NZ_CP050975.1\|WP_168529681.1\|5443808_5444777_-\|type-I-pantothenate-kinase	gnl\|CDD\|235466	PRK05439, PRK05439, pantothenate kinase; Provisional.	0
NZ_CP050975.1\|WP_168529694.1\|5454487_5455135_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	3.18512e-61
NZ_CP050975.1\|WP_168533952.1\|5460330_5461206_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	6.10517e-61
NZ_CP050975.1\|WP_168529696.1\|5455627_5456725_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	0
NZ_CP050975.1\|WP_168529683.1\|5444996_5446844_+\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_CP050975.1\|WP_168529675.1\|5440794_5441316_+\|30S-ribosomal-protein-S9	gnl\|CDD\|178888	PRK00132, rpsI, 30S ribosomal protein S9; Reviewed.	1.91447e-73
NZ_CP050975.1\|WP_168529705.1\|5462683_5463712_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|380519	cd06296, PBP1_CatR-like, ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group includes the ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation. This group belongs to the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	5.29083e-112
NZ_CP050975.1\|WP_168533950.1\|5455152_5455635_+\|ribosomal-protein-S18-alanine-N-acetyltransferase	gnl\|CDD\|273701	TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase. Members of this model belong to the GCN5-related N-acetyltransferase (GNAT) superfamily. This model covers prokarotes and the archaea. The seed contains a characterized accession for Gram negative E. coli. An untraceable characterized accession (PIR\|S66013) for Gram positive B. subtilis scores well (205.0) in the full alignment. Characterized members are lacking in the archaea. Noise cutoff (72.4) was set to exclude M. loti paralog of rimI. Trusted cutoff (80.0) was set at next highest scoring member in the mini-database. [Protein synthesis, Ribosomal proteins: synthesis and modification].	1.33796e-29
NZ_CP050975.1\|WP_168529673.1\|5440308_5440752_+\|50S-ribosomal-protein-L13	gnl\|CDD\|181703	PRK09216, rplM, 50S ribosomal protein L13; Reviewed.	2.04832e-98
NZ_CP050975.1\|WP_168529679.1\|5442834_5443773_-\|DUF389-domain-containing-protein	gnl\|CDD\|129372	TIGR00271, Uncharacterized_protein_MJ0678, uncharacterized hydrophobic domain. This domain is in a family of archaeal proteins that includes AF0785 of Archaeoglobus fulgidus and in several eubacterial proteins, including the much longer protein sll1151 from Synechocystis PCC6803.	5.80868e-44
NZ_CP050975.1\|WP_168529703.1\|5461238_5462546_-\|extracellular-solute-binding-protein	gnl\|CDD\|270452	cd14749, PBP2_XBP1_like, The periplasmic-binding component of ABC transport systems specific for xylo-oligosaccharides; possesses type 2 periplasmic binding fold. This group represents the periplasmic component of an ABC transport system XBP1 that shows preference for xylo-oligosaccharides in the order of xylotriose > xylobiose > xylotetraose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.07641e-53
NZ_CP050975.1\|WP_168529687.1\|5449138_5450056_+\|L,D-transpeptidase-family-protein	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	6.12748e-21
NZ_CP050975.1\|WP_168529700.1\|5457076_5459377_-\|glycosyl-hydrolase	gnl\|CDD\|185053	PRK15098, PRK15098, beta-glucosidase BglX.	8.01952e-130
NZ_CP050975.1\|WP_168529689.1\|5451480_5452719_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.03638e-25
NZ_CP050975.1\|WP_168529691.1\|5452684_5453218_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|376771	pfam02367, TsaE, Threonylcarbamoyl adenosine biosynthesis protein TsaE. This family of proteins is involved in the synthesis of threonylcarbamoyl adenosine (t(6)A).	1.11942e-44

>NZ_CP050975.1|WP_168529691.1|5452684_5453218_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MEAPAAPHNPAEPAAARAGVRITVNSPEQMRELGLHLADLLRAGDLVMLNGELGAGKTTLTRGLGEGLGVRGAVTSPTFVIARVHPSLGDGPPLVHVDAYRLGGGLDEMEDLDLDVSLSDSVIVVEWGEGKVEELTDDRLHVVIHRAVGDTTDEVRHVTLTGLGARWAAADLSGLTV
>NZ_CP050975.1|WP_168529689.1|5451480_5452719_+|alpha/beta-fold-hydrolase
MSESSAEAVTDVAAAAVASAAGNWRKAGIAGVAIGVVAAGAAAGVAIERLTVGRGMRSKARLALDSTGPYGSLRGTPGKAYADDGTELYYEVDDIEQDVTFTPRRRRLFGRKAPAPVTVVFSHGYCLNQDSWHFQRAALRGVVRTVHWDQRSHGRSGRGVAQSTDGTPVTIDQLGRDLKAVIDAAAPEGSVVLVGHSMGGMTVMALADQYPELIRDRVVAVALVGTSSGRLGEVNFGLPVAGVNAVRRVLPGVLKALGQQAALVERGRRATADLFAGIIKRYSFASRDVDPAIARFAERMIEGTPIDVVAEFYPAFTDHDKTEALAHFADMPVLVLAGVGDMVTPSEHSEAIADLLPDAELVLVPDAGHLVMLERPEVVMDRLADLLMRAGAVPAGATVGGYGSTSSTAQPG
>NZ_CP050975.1|WP_168529687.1|5449138_5450056_+|L,D-transpeptidase-family-protein
MAWRSAAVMLALLTVLPAQTALAEADGPLTPGPESPLVPGAASAVGSLVPGVAPGPRQSWQGPADTPDQMLAPEVYTPSAREDAVEPRDAAPEADALIEYVPPGDAADKALSCSRRTGPYQRQVERWLKLKADGKQSGGDCRAIRTFQTRHGIKPATGFAGPVTWARMQLLSARKNPNAAGKCHVRSSRVACVDLTRQLTWVQKGKKVLWGPVPMRSGRAGYRTRTGQFKIYWKHKNHWSTLYNSPMPYSQFFSGGQAFHAVYGSIYDPHGSWGCVNLRLADARTLWNVLKKGDRVSVWGRRAGT
>NZ_CP050975.1|WP_168529685.1|5446982_5447354_+|holo-ACP-synthase
MSIIGVGIDVAEIDRFRASLERTPGLAQRLFVEQELHLPSGERRGIASLAVRFAAKEAVAKALGAPAGMHWTDAEVYVEDSGRPRLRVRGTVAARAAELGVMSWHVSLSHDAGVASAVVIAEG
>NZ_CP050975.1|WP_168529683.1|5444996_5446844_+|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGYVGSQSALDVVMAGLKRLEYRGYDSAGVAVPADGGLAAAKRAGKLVNLEKELVDRPLPTGTTGIGHTRWATHGGPTDANAHPHLDNAGRVAVVHNGIIENFAELRAELTERGHELASETDTEVVAHLLAEEFSVCADLAEAMRLVCRRLEGAFTLVAVHADMPDVVVGARRNSPLVVGVGEGEAFLASDVTAFIDHTRSAIELGQDQVVELRRDGVTVTGFDGRPAEVRSYHVDWDAAAAEKGGYDYFMLKEIAEQPKAVADTLLGRIDAGGSLRLDEVRIPVRELREVDKVVIVACGTAFHAGLIAKYAIEHWTRIPCEVELASEFRYRDPILGARALVIAISQSGETMDTLMALRHARDQGSKVLAICNTNGSTIPRESDAVLYTHAGPEVAVASTKAFLTQLVACYLVALYLGQVRGTKWGDEIQAVIRDLSHISGEVERVLETMEPVRELARTLADKRTVLFLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEEDLPVVVVVPSPRGRSVLHDKIVSNIQEIRARGARTIVIAEEGDEAVVPYADHLIRIPVTPTLLQPLVATVPLQVFACELATARGNEVDQPRNLAKSVTVE
>NZ_CP050975.1|WP_168529681.1|5443808_5444777_-|type-I-pantothenate-kinase
MPRSAHRHKPEATPYVDLTRAEWSALREKTPLPLNAEEVEKLRGLGDVIDLDEVRDIYLPLSRLLNLYVGATDGLRGALNTFLGEKGSQSGTPFVIGVAGSVAVGKSTVARLLQALLSRWPEHPRVELVTTDGFLLPTKELEARGLMSRKGFPESYDRRALTRFVADIKAGKDEVTAPVYSHLIYDIVPGQKLTVRRPDILIVEGLNVLQPALPGKDGRTRVGLADYFDFSVYVDARAEDIEAWYLNRFRKLRATAFQNPSSYFRKYTQVSEEEALDYARTTWRTINKPNLMENVAPTRGRAALVVRKGPDHKVQRLSLRKL
>NZ_CP050975.1|WP_168529679.1|5442834_5443773_-|DUF389-domain-containing-protein
MLHLRLITPAGRTDEVVRLIGRTVGTTHLVVLPGAARDPVGDVVMCDVAREAGDELIGALREFDLERTGSIAVENIDLSLSSRADEAEEEAPGEGADAVLWEHLADASHEESTLSVTYAALLAVATMLAACGVMLDNAILIVGAMAVGPEFGPLAGISTALVRRAPHLVWRSLWALLAGFALAMVLTAGFSLLLDGLGLFEKAMVEAPRPNTAFIWKPDWMSFVVAFLAGIAGTLSLTSAKSGALIGVAISVTTVPAAANAAVALSYADYSQTWGSTWQLLANLGGIVLAGTLTLLAQKWFWARQRAVTPLG
>NZ_CP050975.1|WP_168529677.1|5441479_5442838_+|phosphoglucosamine-mutase
MGRLFGTDGVRGVANADLTAELALGLSVAAAHVLAEAGTFEGHRPVAVVGRDPRASGEFLEAAVVAGLASAGVDVLRVGVLPTPAVAYLTGALGADLGVMLSASHNAMPDNGVKFFARGGHKLADELEDRIEAVYDEHRTGAPWDRPTGSGVGRVRSYDEGFDQYVAHLIGVLPNRLDGLKVVLDEAHGAAARVSPEAFTRAGAEIVTIGTAPDGLNINDGCGSTHLDLLKAAVVEHGADLGIAHDGDADRCLAVDHTGAEVDGDQILAVLALAMRERSALRSDTVVATVMSNLGFKLAMEREGVALIQTAVGDRYVLEEMKQHGYALGGEQSGHVIILDHATTGDGTLTGLMLAARVAQTGRTLHDLASVMERLPQVLINVPDVDRSRVNSSAELAAAVVEAERELGTTGRVLLRPSGTEPLVRVMVEAADIDHARSVAGRLADAVKSSLG
>NZ_CP050975.1|WP_168529675.1|5440794_5441316_+|30S-ribosomal-protein-S9
MAETTVEQPVEETELVDIENYTTESEVPVEGEYTSESLAGRFGDPQPAAGLGRRKNAIARVRIVPGTGKWKINGRTLEDYFPNKVHQQEVNEPFKVLELDNRYDVIARISGGGVSGQAGALRLGVARALNEADVDNNRAALKKAGFLKRDDRAVERKKAGLKKARKAPQYSKR
>NZ_CP050975.1|WP_168529673.1|5440308_5440752_+|50S-ribosomal-protein-L13
MRTYSPKPGDITRQWYVIDAQDVVLGRLATTAANILRGKHKPIYAPHVDAGDFVIIINADKVHLSGNKKTQKLAYRHSGYPGGLRSVRYDELLAKNPEKAVEKAIKGMVPKNTLGRQVLSKLKVYAGENHPHAAQQPVPFEITQVAQ
>NZ_CP050975.1|WP_168529693.1|5453800_5454355_-|hypothetical-protein
MARSSSGFVAGLTAAAVAVVGFLAYQASANAPDHLAGPRVGTSPAVSTTKAPRDRKNPAALPGDSGTGERVVYSIDDDRVWLVGENNRTQRTFAVTPGTLDPVVGTYEVTSRGRIVTGSDGAQIEHVVRFSVVDGIVIGFSAATDGSTAAPDPGKKLGGIRESRADGDAMWTFATVGVKVVVIQ
>NZ_CP050975.1|WP_168529694.1|5454487_5455135_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MLLLALDTATPAVTVALHDGTSVIASSSQVDARRHGELLLPAVDRVLAEAGLRLDAVTGVVVGVGPGPYTGLRVGLMTADTFGLALGVPVHGLCTLDALAYAADLDVPFVVATDARRKEVYWARYADSRTRVSEPAVDRPGDLALDGLPAVGAGALLYPDTFPDARAPEHVSAAALASLAAERLAAGEELEPPRPLYLRRPDAQVPKNYKVVTPK
>NZ_CP050975.1|WP_168533950.1|5455152_5455635_+|ribosomal-protein-S18-alanine-N-acetyltransferase
MRWWDIDPVLALEKDLFPEDAWSRGMFWSELAHARGPEATRRYVVALDGDRLVGYAGLAAAGDLGDVQTIAVRRDQWSTGLGARLLAELLRAATAFECAEVMLECRVDNVRAQKLYERFGFEPIGFRRGYYQPGNVDALVMRLNDPSTSVNGVQGTEING
>NZ_CP050975.1|WP_168529696.1|5455627_5456725_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MADEPLVLGIETSCDETGVGIVRGTTLLADAIASSVDEHARFGGVVPEVASRAHLEAMVPTIQRALKDAGVSARDLDGIAVTAGPGLAGALLVGVSAAKAYAYALGKPLYGVNHLASHICVDQLEHGALPEPTMALLVSGGHSSLLLSTDITSDVRPMGATIDDAAGEAFDKIARVLNLGFPGGPVIDRYAKEGDPKAISFPRGLTGPRDPAYDFSFSGLKTSVARWIEAKRAAGEEVPVRDVAASFQEAVVDVLTRKAVRACKDQGVDHLMIGGGVAANSRLRVLAQERCEAAGIRLRVPRPKLCTDNGAMVAALGAEMVARGRSASDWDLSADSSLPVTDPHVPGHSHTHDHVHEVSKENLYS
>NZ_CP050975.1|WP_168529698.1|5456721_5456979_+|hypothetical-protein
MTVALMWEARAVDGRGGDLLAWVRRQETAGEPVRREILRAPRDRVLVITWWDADYDADLPELPEPDGELVTRAVHRWRFESVTED
>NZ_CP050975.1|WP_168529700.1|5457076_5459377_-|glycosyl-hydrolase
MTTAPWRDPSRTPAARVDDLLSRMTVEEKAAQLYGVWVGAATDGDGVAPLQHEMTADQDWDELITFGLGQLTRSFGTAPVDPALGARALARAQRAIADAGRFGIPAVAHEECLAGFTAWRATAYPVPLAWGATFDPELVEELGGRIGDDLRSVGVHQGLAPVLDVVRDLRWGRVEETIGEDPYLVGTIGTAYVRGLESAGIVATLKHFAGYASSAGARNLAPVRAGAREFADVTLPPFEMALREGGARSVMAAYNETDGVPASADARLLTELLRERWGFTGTVVADYFGVGFLQTLHRVAGSPAEAAHAALEAGIDVELPTVNCYGKPLVDAVRGGSTPESLIDRAARRVLLQKCELGLLDEDWEPERQGPVDLDSTANRALAGRLAEASVVLLDNPAGLLPLAPGTRVAVVGPRAADPLAMLGCYSFPSHVLTHHPDVLMGIDIPTVLDSLRAELPDTKVTFAEGCGVTDPDPSGFAEAVARASEADVCVVVLGDRAGLFGRGTSGEGCDASDLRLPGVQGELLDALVDTGVPVVLVLLTGRPYALGRWDGRLGAVVQAFFPGEEGGPAVAGVLSGRVNPSGRLPVSVPRLPGGQPWTYLQPPLGLASEVSNLDPTPLHAFGHGHSYTTFAWEDFRGTDAEIATDGSYGLSLTVRNTGDRDGTEVVQLYLHDPVASVTRPDVRLIGYQRLRLAPGEARRVTFGFHADLSAFTDRSGERVVEPGALELRLGASSAETRHTARLSLTGPRRVLGSDRRLRCEVSTDD
>NZ_CP050975.1|WP_168529701.1|5459426_5460326_-|ABC-transporter-permease-subunit
MSHDTLRRPVKTAPAPGPDRTAPRRRHWSRRANPLAGAGSVIWLAVVIVPVYAMISASLTHQSEALGHNALKPPSHPTLDNYDTVLHNGFGHLLWNTALVAAAVVVIVLALCVPLSYVAVRTRSVWSGAAFRLFLLGVAIPAQAVVVPLYLMIAKLNLYDSLLAIILPTAAFAMPVSVLILTGTLRDISEDLYEAMGLDGASTTRMLFQLVIPLAKGGISTVVVYAALQAWNGLLFPLIFTQSDGPRVLTLGLFNYVSEFGVNIPALLASVVLSGVPIFVVYLVARRALVGGLMGVGGK
>NZ_CP050975.1|WP_168533952.1|5460330_5461206_-|ABC-transporter-permease-subunit
MGRPRSAARNRAGRPNAALALPAILFFAFFAVAPMVLAFYLSFTQWNGLGDPRPVGLANWRKLLNDDRLTQSLTVTVVLTVVSWAFQTVLSLLLGVWAAGRQRNRAVLSAIFFTPFLLSSTAISLLFYALLDPNFGIIHADTLGTTSGAFLAIVFVGGWQFIPFHTLIYQGGARQIPEVLYQAAAIDGAGRLRQFFSITLPQLRNTATTSGVLMIVGSLTYFETVLILTQGGPGTDTAILPYLMYQAGFKSYDFGYASAVASFLVIAATALSLLMVRLSGFGAMRSTREGM
>NZ_CP050975.1|WP_168529703.1|5461238_5462546_-|extracellular-solute-binding-protein
MESYSRRWFLGAGATALASVGGLTACGSGGGSGDGGTLTAFVYGDDAAKIQVKSVDRFNASAAAKKAKGTVKLQKVPATDYPAKLRTAMGSPNAPDVFFNWGGGSIKAYKDAGQLVDLTDVIASDPVLKSGFLPSVLSAGGLDGKNYGVPMRGMQPVILFYNKTVFEEHKLQPPTTWDQLLDINAKLKKAKITPFALGGSDIWPELMWLEYLVDRIGGPDVFDKIKNGDASGWGDPAVLKAAQTVKELIDDGAFGKGYSSVGYGNGGAPAVFAKGKAAMHLMGSWEYSTQLGKFPDFAKKNLGWCAFPKIEGGAGDIRNVVGNPTNYWSVNARTSNKDAAIAFLRDSASEAYTKELIANGDVPATSNAASLLDASPNPEFAKFQYQMVQDAPAFTLSWDQAVAPNVSTPMLTEVNKLFVGKSSPAQFVSALKGLK
>NZ_CP050975.1|WP_168529705.1|5462683_5463712_+|substrate-binding-domain-containing-protein
MKPGNSVEARTATLAEIAREAGVSAPTVSKVLNGRADVAPATRTRVEELLRGHGYRRRGGEGGRSPLIDLVFHELESAWAMEVIRGVENVAREEGLSVVLSESAGRLTPGRTWADQVAARRPHGVILVLSGLDESGRALLTSRSVPFVVMDPAGDPGDDVPSIGATNWQGGLAATRHLIELGHTRIGAITGPSQMMCSRARVDGYRAALETAGLPVDSGLIRPGTFHHESGYRAGLDLLRMTDRPTAVFAGNDLQALGLYEAARELGLRVPEDLSVVGFDDLPVARWVGPPLTTVRQPLMEMAEAAAKLVLELGRQERPAAGTRMELATSLVVRSSTGAPPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_10

7958185-7958273

Orphan

Consensus_repeat	Method
GATGACCCGGCCCTCGCCCGGAGGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_10

>merge|NZ_CP050975|10|7958185-7958273|CRISPRCasFinder
GATGACCCGGCCCTCGCCCGGAGGCACCTACCGGATCAACGGATCCAGCAACGGAACCGGCGATGACCGGGCCCTCGCCCGGAGGCACC

>NZ_CP050975|10|8|7958185-7958273|CRISPRCasFinder
GATGACCCGGCCCTCGCCCGGAGGCACC	TACCGGATCAACGGATCCAGCAACGGAACCGGC
GATGACCGGGCCCTCGCCCGGAGGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168531476.1\|7950866_7952096_-\|glycoside-hydrolase-family-3-protein	unknown	unknown	gnl\|CDD\|224389
NZ_CP050975.1\|WP_168531478.1\|7953662_7954448_+\|polysaccharide-lyase-family-7-protein	unknown	unknown	gnl\|CDD\|378049
NZ_CP050975.1\|WP_168531474.1\|7947627_7949607_+\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|379868
NZ_CP050975.1\|WP_168531483.1\|7958379_7958544_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531473.1\|7946291_7947500_+\|HupE/UreJ-family-protein	unknown	unknown	gnl\|CDD\|379373
NZ_CP050975.1\|WP_168531490.1\|7966635_7966980_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531487.1\|7963600_7964449_-\|ABC-transporter-permease	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531485.1\|7960089_7961280_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340883
NZ_CP050975.1\|WP_168531480.1\|7955445_7956015_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_CP050975.1\|WP_168531477.1\|7952727_7953222_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531488.1\|7964445_7965396_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213235
NZ_CP050975.1\|WP_168531481.1\|7956341_7956800_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531475.1\|7949681_7950758_+\|DUF916-domain-containing-protein	unknown	unknown	gnl\|CDD\|368712
NZ_CP050975.1\|WP_168531486.1\|7961546_7962221_-\|response-regulator	unknown	unknown	gnl\|CDD\|225107
NZ_CP050975.1\|WP_168531489.1\|7965720_7966200_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP050975.1\|WP_168534343.1\|7962217_7963477_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP050975.1\|WP_168531484.1\|7958963_7959728_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|212491
NZ_CP050975.1\|WP_168531482.1\|7956813_7958148_+\|diaminopimelate-decarboxylase	unknown	unknown	gnl\|CDD\|143501
NZ_CP050975.1\|WP_168531491.1\|7967021_7967447_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531479.1\|7954741_7955071_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168531476.1\|7950866_7952096_-\|glycoside-hydrolase-family-3-protein	gnl\|CDD\|224389	COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism].	6.38992e-60
NZ_CP050975.1\|WP_168531478.1\|7953662_7954448_+\|polysaccharide-lyase-family-7-protein	gnl\|CDD\|378049	pfam08787, Alginate_lyase2, Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.	2.58301e-72
NZ_CP050975.1\|WP_168531474.1\|7947627_7949607_+\|metallophosphoesterase-family-protein	gnl\|CDD\|379868	pfam16656, Pur_ac_phosph_N, Purple acid Phosphatase, N-terminal domain. This domain is found at the N-terminus of Purple acid phosphatase proteins.	3.12249e-13
NZ_CP050975.1\|WP_168531485.1\|7960089_7961280_+\|MFS-transporter	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.46423e-27
NZ_CP050975.1\|WP_168531480.1\|7955445_7956015_-\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	2.99956e-16
NZ_CP050975.1\|WP_168534343.1\|7962217_7963477_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	8.95138e-38
NZ_CP050975.1\|WP_168531488.1\|7964445_7965396_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	8.36136e-88
NZ_CP050975.1\|WP_168531473.1\|7946291_7947500_+\|HupE/UreJ-family-protein	gnl\|CDD\|379373	pfam13795, HupE_UreJ_2, HupE / UreJ protein. These proteins contain many conserved histidines that may be involved in nickel binding.	1.38897e-42
NZ_CP050975.1\|WP_168531475.1\|7949681_7950758_+\|DUF916-domain-containing-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	1.14013e-08
NZ_CP050975.1\|WP_168531486.1\|7961546_7962221_-\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.16665e-70
NZ_CP050975.1\|WP_168531489.1\|7965720_7966200_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	7.55327e-24
NZ_CP050975.1\|WP_168531484.1\|7958963_7959728_-\|glucose-1-dehydrogenase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.44049e-71
NZ_CP050975.1\|WP_168531482.1\|7956813_7958148_+\|diaminopimelate-decarboxylase	gnl\|CDD\|143501	cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase. Diaminopimelate decarboxylase (DapDC, EC 4.1.1.20) participates in the last step of lysine biosynthesis. It converts meso-2,6-diaminoheptanedioate to L-lysine. It is a fold type III PLP-dependent enzyme that contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. DapDC exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	7.57175e-157

>NZ_CP050975.1|WP_168531482.1|7956813_7958148_+|diaminopimelate-decarboxylase
MTTVHESAVSTTGGDLSVWPASATEARQGDLAVGGVPLAEIADRFGTPAYVLDESEVRERCRTYRHAFPDADVLYAAKAFLCRGMAHWVEEEGLGLDVCSAGELELAVTTGFPPERIVLHGNAKSPHDLESALRLGVGRIVIDSPSEIARLAAAVGPGGHQKVMVRVVPAISAGGHEKIRTGTDDQKFGLSMADGYAQHAIARILDQPQLELTGLHCHLGSQISSVKPYLVAVRRMVGLMARLREQHGLVLPELDLGGGHGIAYRPGEQALDLTALARRVRSELTEACAAAGLTVPRLMIEPGRAVVGPAGVALYHVLAVKRSGDHVFVAVDGGMSDNPRPALYGVRYAPRLIGRHSAAERAAVTVVGRHCEAGDVLATDVELPADVRPGDLLAVPVAGAYHLSMASGYNMVGRPPVIAVRGGHARLLVRRESLDDIRSRDVGL
>NZ_CP050975.1|WP_168531481.1|7956341_7956800_+|hypothetical-protein
MQQLSCGEDPEPCERFPAGALFVPVRPGSAGCAARLFRTPLGERTAVGFTSERRLTTTLGPEQAWIRLAEPALRALAEPLGVTKVTVDPSFSAPAPAQAEPVTPERFGNAAPATREPSAPRTRTSTWDPQAVGVLRVTGAAALVSVLALWIG
>NZ_CP050975.1|WP_168531480.1|7955445_7956015_-|universal-stress-protein
MSDSGAPAAARVVVGVSGSLGSLTALCRAADEARRRSAELWPVLAWEPPGGELAARRTPTSYVLLDEWQRLARRNLLTALDHAFGHAGPGVPMRALVARGTAGRALVESADRDNDLLVVGGLSRSSWHRLCSCSVSRYCLAHAVCPVLAVPPSPLEAELTSAHRRNLWRLRLDTRRLAETAEETVPPDA
>NZ_CP050975.1|WP_168531479.1|7954741_7955071_+|hypothetical-protein
MWQARTAARAERNRLAVRLRDAVLHRTSALVELAHRGRLEEVSAEARTALAAVRELLHGLEHGPESERRLAPQPTGADLVALCRTQGASGREVTLRGTLESAAGLLGRR
>NZ_CP050975.1|WP_168531478.1|7953662_7954448_+|polysaccharide-lyase-family-7-protein
MIRSKLLAIAAAAGMAGTLALLGTGNATAGVLADPSVAPGGNFDLSVWQLQEPVGSPGSPTTIPSSRLQGANGFQDSYFYTDTRDGAMTFWAPEKGVTTPNSNYARSELREMNRSGSAANWSLSGTHRMSATLRVVSVTQNVCVGQIHLGTGGSSTKPLLELYYHSNGDIVLGTENSPSGGQTTHTVGHVSIGKTWSYTIGVSGGHTIDLTVNGTTTHYSIPSSFDPYKQYFKAGSYNQSSSDSTTKGARVAFYGLTVSHS
>NZ_CP050975.1|WP_168531477.1|7952727_7953222_+|hypothetical-protein
MTTRNIAVTAAVAAATALVATGVTYASASAAPEAAPVVKQVAPMGGDSGQSKGNEGGGGGGDRGGRGHYEGRIDFNERSYSAQSWGCITVVSGLGSRSFNVRNDSHKTVEVFRGATCDNGSPVATVGPWSTSNGVMPFRVHGSVKVRNGVVGSFRVVEDHHRDW
>NZ_CP050975.1|WP_168531476.1|7950866_7952096_-|glycoside-hydrolase-family-3-protein
MTSQQAPTHGSRRAPSRGPKGRKALWPVPLLALSLATASLGVTYPSHPSAASRSPEAAAASCVDKVYSAMTGPQRVGQLFMGSITASKPDQARIQVLRQYHVGSVFLAGRSKAGTKATKSLVDSLQAKADTVSKHRVGLMVSTDQEGGQVQVLSGPGFSTIPSGLVQGSWSTSKLRAEAATWAKQLKAAGVNLNLAPVADVVPLSLGRNNAPIGRYDREYGHTAAAVTPHTNAFAAGFAQSNVLATLKHFPGLGNVRGNTDTTANVVDTVTTTKSSSLTPFSSGIKAGAPFVMISSATYSKIDSKHRAAFSSTVIQGLLRKTMGFKGVVVSDDLGNAVAVKTVPPADRALNFLSAGGDLVLAGEPNQVPAMTKAVTARMAQSSAFRTQMDQSVHRVLTAKQKVGLLTCG
>NZ_CP050975.1|WP_168531475.1|7949681_7950758_+|DUF916-domain-containing-protein
MHPPVSRRTTTVTALVRVVTLTLLTACALVGLRAVPAAADGDVTWTVRTAANGYGDDRSSFSYGVNPGGRIKDAMVVANHGKAPLTLAVYAADGFTTDTGQLDLVTKDKKSVAVGSWVHADHATVVVRPGKSVEVPFQIAVPGNASPGDYVGGVLTSLRQSDDAQGINVDRRLGIRVKLRVSGELKPRLAVEDLSVDYTGTANPFGTGDATVTYTIHNTGNAILSARQTVFTTGPFGWWRTDAGTVPAPPELLPGEHWKVKVPVHGVTPGVRLTATVNLVPLLTDASGSTTSLKPVLATADTWTVPWSLLLLVVLVATAAVGAFLLVRRGRARRTRREDARVRDAVAQALNSKKEEVG
>NZ_CP050975.1|WP_168531474.1|7947627_7949607_+|metallophosphoesterase-family-protein
MRSNHSARASEPTQRRMARGAAAAFLGLTVALGSGLATSPASAAGTDAVTGIVLGVGANESQRTVTWYTSADTAQKVQMVPTAQLAGGDFPADAATFDATGSANIATSGGFNRHATITGLKENTAYSYRVGTEGNWSSAYSFKTQDFEGNYDFLFYGDPQIGSSGDLAKDQAGWQDTLDVSLAANPNAELLVSGGDQVETANTESNWNSFLAPDKLRQYPWAATIGNHDVGGKAYEQHFTTPNTDRSGSYYSNGNPASNTSGGDYWYIYKDVLFIDLNSNSYNPATGGGGDAAHVNYVSDVINKHGSEAKWKVLVYHHSIYSPASHAKDGDNKTRRTDFPTTFSKLGVDLVLQGHDHSYSRSYLIKNGEKADPAEQPGAADVYPGPGGVLYVTANSSSGSKYYDITAPDNSGTSGAGNGADPLNPKNYWYNSVQNQEHVRSYVKVQVRNDKLVVENLRSGTCAAPNSEVEHGLSCSNTTADQPVGSTVDKVTVHPFHGDKQDLQVNVPNPAPGEFGWTIDGYNGLVDLGTAKEQDGDHFTATGKINPLLVSDSRRSLAPWSISANVGDFRDADKTFSGANLGWTPFVLDGGAGAKAGDPVASGYDDHGQGLALSRALGSAEQGHPRGEARLGADLDLKIPDSVEKGGYRATLTITALSS
>NZ_CP050975.1|WP_168531473.1|7946291_7947500_+|HupE/UreJ-family-protein
MSRLFRRALLALAAAVITLLCVGGPAVAHGFSSTVYVHVTEGDGGRLRTAVDVEYDLFVVSAADSEHDDPLFRSGTAAFDAGDAAEQAAALRAHTRPAVKYVTDRFSVTSGGTACRATRAGDFTIGRHEGVPYAGLVLDWSCPAESADHVVRSTLFPDGEHYVRDAKTIVTYEVGGRSGSAALDGEHPSFSIGQAWYERFWEFFRLGAEHLLTGIDHILFLLALIAGSRRPREVVLAATSFTLAHSVTFLLAALGVVDVPPAVVEPVIALSIAVVAGWYLWRVWRRGGAAADLGAAGEGHFGLDRAGWTRLGVVFCFGLVHGLGFAGALGIHDAWSWTLLWSLLVFNIGIEAVQLAIIGLVFPLLILIRRQAPRTGVWTTGTISAGVAAMGLLWFVQRVSAV
>NZ_CP050975.1|WP_168531483.1|7958379_7958544_-|hypothetical-protein
MPNPQPGHHSPEDVYISHVGNCRVCKRESGRCPRAERLWRVYQEWRATTRGRSG
>NZ_CP050975.1|WP_168531484.1|7958963_7959728_-|glucose-1-dehydrogenase
MSKRLEGRTALVTGATSNIGRAIAEAFAAEGAHVAVSGRSAERGQEVVDGIRARGGRAAFVRADLDGSAAASQALAQEATRVLGGRIDVLVNNAGIYPGDTTTATDEKTFDQVYAVNVKAPFFLTAAVAPAMAEAGGGAIINLGSWIARLGIPVGALYSSTKGAMETLTRAWAAEFGPQGVRVNAISPGVVLPPAPGEERPSAIMMKGTPAGRMGTPDEIAKAAVYLAGDESSFVHGIVLDVDGGRTTAAVIAA
>NZ_CP050975.1|WP_168531485.1|7960089_7961280_+|MFS-transporter
MDGVRRGWRQCLLGGAVFAVCMAGTTLPTPLYNLYQQKFGFSELMVTVVYAVYAFGVIGVLLLAGNASDAVGRRPVLLCGLAFAAVSAVCFLCATGLGWLYAGRLLSGLSAGLFTGAATAYVIDLAPHGSGSRGTLVATAANMGGLGCGPLLAGLLAQYAPWPLYLPFAVHLVLVACSVAVLLRLPETVGERRPLRTVRPQRPGLPAQVRAVFGPAAIAAFVGFALFGVFTAVSPAFLEHSLDVHSRAVSGLVVALAFFASTAGQLAVGVIGLGRSLPVGCAALLAGLALLAGALRWDLLVLVVLSAIVGGAGQGIAFRGALSAVAQASPDHQRAAVISLLFVVAYVGISLPVIGAGVLADRIGLEGAGLVFIACMAVLVAVAVLYLLRRRTPART
>NZ_CP050975.1|WP_168531486.1|7961546_7962221_-|response-regulator
MTTVLIVDDQPLQRFGFRMLLESVPDTEVAGEAAHGAEAVRKAAELRPDVVLMDVRMPGMDGIEATRRIIATGGRSRVLVLTTFDLDEYAHAALRAGASGFLLKDARPEELLAGIRAVAAGDAVIAPALTRRLLDAYAQHLPGQGVPDADADPRLRSLTDREREILVAIGRGWSNGEIATRLVLSESTVKTHVGRVLAKIGARDRVQAVIFAYDLGLARPNSTA
>NZ_CP050975.1|WP_168534343.1|7962217_7963477_-|sensor-histidine-kinase
MSPLFARLTRGGQWLRQADRARPWVLDTAVVVLVFLMFCLADLVHGHDGRRELAARFTRPPLAGMLALQAGLVLPLLWRRRNPSAAFAVIMAVFLLQWSLGVLLRADVALLIALYSLTLHGTLRRLAWACAVTAVGLVLVAVRASAVVSVWDALFFLFSAAIAAVAVGMAVRIRRAQLAGLRERAARLEIERDQRSRLAAATERTRVAREMHDIVGHNLAVMITLADAGAYACDVTPERGKQALLLIGDTGRQALGELRRMLGVLREEAEAPALSPQPGIVDIDALCARIRSAGPLITYRTAGDTDALDGGVQLTVYRIVQEALTNSLKHAGADTRVRLAIGVEGARVRIRVQDTGPPDDSRPAGPPNEDGHGLAGMRERAALYGGTVDAGPVPRPGRGWAVQATLDLTPLPGSEGGTP
>NZ_CP050975.1|WP_168531487.1|7963600_7964449_-|ABC-transporter-permease
MSTITATETSAPLPAPVARPDYRVTGRRVLRSEWAKLWSLRSTWITLGLGLLFLVAFGLIAAAQFKSRINSGHHMDPDFAHSTAVSLSLFGTNFAQLALGVLGVLVTAGEYSTGMIRSTLAAVPRRLPVLWSKSAVFGLVSLAVGTLGAFVAFLFASGIVSGTSAAMTFSHPGVVRSLLGAGLYLGLVGVIGAALGALLRSVAGGISVLVGALMLVPGLISLLPSSWQDDISPYLPSNAGESMFALTHDSTTLSPTAGLVVFVGWTVLALAGAAYRLVRSDA
>NZ_CP050975.1|WP_168531488.1|7964445_7965396_-|ATP-binding-cassette-domain-containing-protein
MIEAQQLTKRYGEKTAVDHLDFVVRPGTVTGFLGPNGAGKSTTMRLIVGLDAPSSGSVRVGGRRYAQHAAPLQEVGALLEAKSIHPGRSAYNHLLALALTHGIPRRRVDEVIELAGLGSVAKKRAGAFSLGMGQRLGIAAALLGDPQTVMLDEPVNGLDPEGVLWIRNLLTELAAEGRTVFVSSHLMTEVALVADHLIIVGRGRLLADTTVQDLIREVGGDTVKVATADPARLREVLAGPGVDITGHAGSEELHVTGVTARQIGLKAAEHGIALFELSAKSVSLEEAFMDLTRDAVEYHGSTTATGAGVETPGRAA
>NZ_CP050975.1|WP_168531489.1|7965720_7966200_-|carboxymuconolactone-decarboxylase-family-protein
MNADARLNFYTSPLTAQFARHINSAGKVVSDSALPHTTQELVKLRASQINGCGFCTDMHTKDAAHAGESPLRLHLVAVWREATVFTDAERAALELTEEGTRIADAAGGVSDEVWANAAKHFDEEQLAALVSLIALINAYNRLNVIVRQPAGDYQPGQFG
>NZ_CP050975.1|WP_168531490.1|7966635_7966980_+|hypothetical-protein
MSNGVIAAVALGSLAFTPFTEQYARESVPPGYGDSPVFRRTNRVLTAIRGGVLPVTALLGAGYHFAKRTAPTGIALRMTQLNHSAPSGRRRGPRLGGVRWAEGTPAFRGRGLAR
>NZ_CP050975.1|WP_168531491.1|7967021_7967447_+|hypothetical-protein
MLDHSEDRLLEEALGAIAGQGRLGAKFAARFLKHDVHEIELRLPLSFDLALERVRGSLLESTGGTDPALLRSGADGAALRVLSGAGFAAMNPVVVTVTVTRVEEDTTAIQVRAVAKEGLIKQHAGEKTAQRVASALEGRRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050975_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050975_11

8275539-8275671

Orphan

Consensus_repeat	Method
GGTGAATGCACCGAAGAGCATCACTCCGTCCGTCGTCACCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050975_11

>merge|NZ_CP050975|11|8275539-8275671|CRISPRCasFinder
GGTGAATGCACCGAAGAGCATCACTCCGTCCGTCGTCACCCCACCGTCAGTCACCCGCCGCTGTCATCCCGTCGTCGCCCCGGAGGCCCGCGGGTGAATGCACCGAAGAGCATCACTCCGTCCGTCGTCACCC

>NZ_CP050975|11|9|8275539-8275671|CRISPRCasFinder
GGTGAATGCACCGAAGAGCATCACTCCGTCCGTCGTCACCC	CACCGTCAGTCACCCGCCGCTGTCATCCCGTCGTCGCCCCGGAGGCCCGCG
GGTGAATGCACCGAAGAGCATCACTCCGTCCGTCGTCACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050975.1\|WP_168531695.1\|8282756_8284094_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340925
NZ_CP050975.1\|WP_168531693.1\|8281075_8281840_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP050975.1\|WP_168531688.1\|8275738_8277193_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP050975.1\|WP_168531690.1\|8278698_8279400_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|378924
NZ_CP050975.1\|WP_168531687.1\|8272138_8275417_-\|family-78-glycoside-hydrolase-catalytic-domain	unknown	unknown	gnl\|CDD\|379971
NZ_CP050975.1\|WP_168531686.1\|8270824_8272042_-\|4-hydroxybenzoate-3-monooxygenase	unknown	unknown	gnl\|CDD\|236198
NZ_CP050975.1\|WP_168534415.1\|8286509_8286728_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531694.1\|8281836_8282703_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP050975.1\|WP_168534407.1\|8266425_8267418_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050975.1\|WP_168531683.1\|8262535_8263519_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381312
NZ_CP050975.1\|WP_168534405.1\|8263632_8264253_-\|DUF2238-domain-containing-protein	unknown	unknown	gnl\|CDD\|378345
NZ_CP050975.1\|WP_168531685.1\|8265230_8266400_+\|NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|223727
NZ_CP050975.1\|WP_168531689.1\|8277451_8278477_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176256
NZ_CP050975.1\|WP_168534413.1\|8285782_8286166_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|189968
NZ_CP050975.1\|WP_168534411.1\|8268980_8270618_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP050975.1\|WP_168531691.1\|8279483_8280239_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP050975.1\|WP_168531684.1\|8264497_8265226_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367243
NZ_CP050975.1\|WP_148008417.1\|8267729_8267921_+\|putative-ATP-grasp-modified-RiPP	unknown	unknown	gnl\|CDD\|373048
NZ_CP050975.1\|WP_168531692.1\|8280279_8281029_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181335
NZ_CP050975.1\|WP_168534409.1\|8267981_8268878_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275040

Protein	Function_ID	Function_description	E-value
NZ_CP050975.1\|WP_168531695.1\|8282756_8284094_-\|MFS-transporter	gnl\|CDD\|340925	cd17367, MFS_KgtP, Alpha-ketoglutarate permease of the Major Facilitator Superfamily of transporters. This subfamily includes Escherichia coli alpha-ketoglutarate permease (KgtP) and similar proteins. KgtP is a constitutively expressed proton symporter that functions in the uptake of alpha-ketoglutarate across the boundary membrane. Also included is a putative transporter from Pseudomonas aeruginosa named dicarboxylic acid transporter PcaT. The KgtP subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.90723e-109
NZ_CP050975.1\|WP_168531693.1\|8281075_8281840_-\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.74224e-66
NZ_CP050975.1\|WP_168531688.1\|8275738_8277193_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	2.36643e-31
NZ_CP050975.1\|WP_168531690.1\|8278698_8279400_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|378924	pfam12697, Abhydrolase_6, Alpha/beta hydrolase family. This family contains alpha/beta hydrolase enzymes of diverse specificity.	8.95992e-10
NZ_CP050975.1\|WP_168531687.1\|8272138_8275417_-\|family-78-glycoside-hydrolase-catalytic-domain	gnl\|CDD\|379971	pfam17389, Bac_rhamnosid6H, Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.	1.19509e-110
NZ_CP050975.1\|WP_168531686.1\|8270824_8272042_-\|4-hydroxybenzoate-3-monooxygenase	gnl\|CDD\|236198	PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated.	5.58178e-177
NZ_CP050975.1\|WP_168531694.1\|8281836_8282703_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	4.15933e-27
NZ_CP050975.1\|WP_168531683.1\|8262535_8263519_+\|aldo/keto-reductase	gnl\|CDD\|381312	cd19086, AKR_AKR11C1, AKR11C family of aldo-keto reductase (AKR). Bacillus subtilis uncharacterized oxidoreductase YqkF is a founding member of aldo-keto reductase family 11 member C1 (AKR11C1). It may function as oxidoreductase. This family also includes Bacillus halodurans AKR11C1, an NADPH-dependent 4-hydroxy-2,3-trans-nonenal reductase.	2.8163e-100
NZ_CP050975.1\|WP_168534405.1\|8263632_8264253_-\|DUF2238-domain-containing-protein	gnl\|CDD\|378345	pfam09997, DUF2238, Predicted membrane protein (DUF2238). This domain, found in various hypothetical bacterial proteins, has no known function.	5.05597e-68
NZ_CP050975.1\|WP_168531685.1\|8265230_8266400_+\|NAD(P)-binding-protein	gnl\|CDD\|223727	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion].	1.97637e-32
NZ_CP050975.1\|WP_168531689.1\|8277451_8278477_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176256	cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADHs), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
NZ_CP050975.1\|WP_168534413.1\|8285782_8286166_-\|hypothetical-protein	gnl\|CDD\|189968	pfam01391, Collagen, Collagen triple helix repeat (20 copies). Members of this family belong to the collagen superfamily. Collagens are generally extracellular structural proteins involved in formation of connective tissue structure. The alignment contains 20 copies of the G-X-Y repeat that forms a triple helix. The first position of the repeat is glycine, the second and third positions can be any residue but are frequently proline and hydroxy-proline. Collagens are post translationally modified by proline hydroxylase to form the hydroxy-proline residues. Defective hydroxylation is the cause of scurvy. Some members of the collagen superfamily are not involved in connective tissue structure but share the same triple helical structure. The family includes bacterial collagen-like triple-helix repeat proteins.	9.99591e-06
NZ_CP050975.1\|WP_168534411.1\|8268980_8270618_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	3.59215e-34
NZ_CP050975.1\|WP_168531691.1\|8279483_8280239_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	3.65693e-51
NZ_CP050975.1\|WP_168531684.1\|8264497_8265226_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|367243	pfam02909, TetR_C, Tetracyclin repressor, C-terminal all-alpha domain.	1.60193e-08
NZ_CP050975.1\|WP_148008417.1\|8267729_8267921_+\|putative-ATP-grasp-modified-RiPP	gnl\|CDD\|373048	pfam14404, Strep_pep, Ribosomally synthesized peptide in Streptomyces species. A ribosomally synthesized peptide related to microviridin and marinostatin, usually in the gene neighborhood of one or more RimK-like ATP-grasp. The gene-context suggests that it is further modified by the ATP-grasp. The peptide is predicted to function in a defensive or developmental role, or as an antibiotic.	1.74826e-27
NZ_CP050975.1\|WP_168531692.1\|8280279_8281029_-\|SDR-family-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.08759e-84
NZ_CP050975.1\|WP_168534409.1\|8267981_8268878_+\|hypothetical-protein	gnl\|CDD\|275040	TIGR04187, conserved_hypothetical_protein, ATP-grasp ribosomal peptide maturase, SAV_5884 family. Members of this protein family are ATP-grasp ligase family enzymes that regularly occur in a contexts with a methyltransferase and a putative ribosomally translated post-translationally modified peptide precursor. Because of this conserved gene neighborhood and close sequence similarity to ATP-grasp enzymes from microviridin/marinostatin biosynthesis cassettes, this enzyme is suggested also to serve as a peptide maturase.	1.88319e-110

>NZ_CP050975.1|WP_168531687.1|8272138_8275417_-|family-78-glycoside-hydrolase-catalytic-domain
MARDWNRRVFLRSSAGSVAGASVVLGPGAVTASASPGAGAHAPHEGGLRVGRTTVEYAETLLGTEVEHPRLTWELAAPGKGARQSAYQVRVALTEKQLRTGRRLVWDSGRVESDRTVGIVYAGPALRPRTRYHWQVRVWDGAGRPSAWSAPRWWETTLPKDGWEGFWIGASAAPEPPGLTGASWIWSPGSTSDGAPTGPCWFRATTTLPTGTEVLRATLVATADDDFTLYVDGQQVLHQPEQTDAWRTGHVADVTEQVRGAAGGRIVVAAVATNRGNVSVNPGGLLVRLLVETTGGDTVELVTGQGWRCVRDERTGWQQPGFDDGDWPAAVVLAPYGQGPWGTDVSLSAPEQPAPLLRREFTLRKAVTRARLHISGLAYYDAEINGVRIGRQVLDPGFTDYDETVLYAVHDVTDRVRRGANAIGVTLGRGFFGLTTPNAWNWNRPPWHGEPRLLAQLEIDHPDGSRTVVATDGEWRITDGPTRSNSLYAGESYDARKAPAHWTRPGIDDRGWQRAERQTAPRGTLHAQAHDPIEVAETLRPVAVSELSEGVYVVDMGRTLAGWTRLTVRAPAGTTVRLAHGERLNPDGSVLARNDLVPGRCQTDEYVCAGGGAEEVWEPKFSYKGFRYVQVSGLPSKPAPSQVLGRVVHTRVESTSTFSCSEPFYEQLERAMRRTVLNNLYGIPTDTPVYEKNGWTGDAQLGAPVWAYAFGVHRFLTKWLGDLKDSQNTEGQLPVIVPSGGWGYHELAPAPEWTTVYPFLLREMYRVYGDERTARDHWAPLVRYLDWEIARLQDGLAVTALGDWLPPGYDGGVPPEDTRLTATAYLHRALTGTAELADLLGDSAVAARYRSTADTLKEAFNAAFLGADGHYRTAKDPDYRQTSNCVPLAFGLVPPGARASVVDSLLADIERRGNHLNTGALGTSVLLRELSAQGHPEVAHALATQRTYPSWGYWFDHGADTMWESWSLDARSRDHYFLGTVVQWLYENVAGLRPGDAGYRTFTVRPDGRTGVDWARTSVHTVRGEAAAAWSAVDGTIRLSIRVPVGATAEVHVPAASRAAVTAPAGAEFRRAEPGFAVYTVPHGNWDFVARA
>NZ_CP050975.1|WP_168531686.1|8270824_8272042_-|4-hydroxybenzoate-3-monooxygenase
MIKPSPTSAPTRRVPVVVIGAGPAGLTVANILRTAGVDCVVLETESREFVEQRPRAGFIEEWAVRALRERGLADRLVERAQAHSACEFRIDGERHRFRYAELTGERHFVYPQPLLVTDLVRAYADVKGGDIRFGVKDVALHGLDGDRPSVLYTDPATGERRRIDCEIVAGCDGARGVTRSCVAPGRGTVARHDYGVGWLALLAEAPPSSDCVVFGVHPRGFAAHMARSPEVTRYYLEVAPGEDPERWSHDRVWSELHARLAVAGAPPLTEGRLIEKRVLDMHSYVVEPMVYGRLFLAGDSAHLVAPIAAKGMNLALHDALLLADALVAYCGTGDDGGLRDYSAACLRRVWEYQEFSQWLAELLHGPSSGDPFRAGAARARLRRILDSPAAAATFAASYIGQDAVS
>NZ_CP050975.1|WP_168534411.1|8268980_8270618_-|serine/threonine-protein-kinase
MTMVKVQVSTDESVAGRYRLLEVVHQEEGRESWNGQDVESRRLVTLTRSRCPAHLREEAELRTAVRITRESEALGLVCPGRVAVVVDVVEDDAFLWTVTARPAGVPLSALLAHGPVDHVRTARIGLDLLDVLGAAHQEGFTHGDLSPGHVWVEEFGGLTVGGFGLMGATDSPRVTAPSYASPEQARGEGGGPATDLWALGAIMYEMVEGRAIRDRGSLEATFRAVERLPIRVPLNAGPLGPAIQGLLRRDPVERVPESVVREALTRILKAELDDSEPTGTLPLFEESGFDGPRPGRVRGRRPVSRPVLLGGALAVTVVCFAGLAMAGGLSDRGTSASGSAPSPSASDRPYSPAPTAGGTDPRATPSAPASRSSSPSRSASPSPSRTGRQDPPAGFFRFTAPQGFAIDLPKGWAPLRTERSADQSYRVLLGASGDPRTLTVTYSTQLAPDPVAVWNEVDTSLRGESIDYERVGDIRSVDYRGYKGADMEWLSTADGVRERTFGRGFLVDGRRGFSLRWTTPADDWGTAANRQALDTFLRTFTYTSG
>NZ_CP050975.1|WP_168534409.1|8267981_8268878_+|hypothetical-protein
MVVARLHEQGVPMVRLDPADVPGRAVLSADYAHGDFDGYLSVNGHVLSMGGLRSVWVRRPGEPAAHAPEPSPWLTAETRQALFGMLYSASTRWMNHPRRAEQARHKPWQLRVAHSSGFAVPPTVITTAPRVAQQFVEEYRQVVVKSASGPPPGEPPVALPTTLIGPDADFSGVAAGPALLQQYIPKRADIRLTCIGDRLFGARKTAVAGQVDGRFGETGHVWEPIAVPGRIARSVQEYTAFTELAYTAFDFAEDEEGVWWFLEGNQGGQFGFIELETGQPISEAVALWLSQRRPADRR
>NZ_CP050975.1|WP_148008417.1|8267729_8267921_+|putative-ATP-grasp-modified-RiPP
MRPFTLNYALPTGHSAAVPPYHFDVSLQLNVLPDGRPAVSDRALLMATGTTTSTAGSQTHFDD
>NZ_CP050975.1|WP_168534407.1|8266425_8267418_-|hypothetical-protein
MTRDAQDSVSRDARDFGAYARTGGWAFALKVARSVRPGGQSADETAKVSAKEFAELAGCSPERVMRYYKAWDKAADDGLVPHFEVLAPGEEIELPDADAWLTYYAARSSASSERGTAIAEAAQAEGIRPTKALEVAENPTALRAAILADPSTAQAARTALLDRVKEDPALQAELARDIARTDELKKAVATETRAADRIGYVRQIAEKGQIRTPAGQTLDAPAELRSEAERHLSLLDELDKGEDTGEWAAEAYDTMKGLVVETVEADPELRVQERRTKFYNSLQRATKVFEELTFDDADDIYEDDMVQRLEDLQQAIGSCIAALRGAAPRE
>NZ_CP050975.1|WP_168531685.1|8265230_8266400_+|NAD(P)-binding-protein
MSIHHPIAVVGAGLGGLTLARVLHRSGIEAAVFDLDASPTARAQGGMLDMHEESGQAALRAAGLHDAFRGLIHAGGEAMRILDKAAVVHLEDDGEGGGRPEVKRGALRDLLLGSLPPDTVRWGAKATGVRTLDDGRHEVTLADGETFTADVLIGADGAWSKVRPLVSDATPVYSGLSFVEAHLPDADTRHPEGAALVGHGMMFALADGKGFLAHRDPDGSLHIYVALRTPAEWATAGPIDFTATAAAKTALLEHFPDWDERLRALVADADGELVPRPVHALPVGHRWDRTPGVTLLGDAAHLMSPFAGEGANLAMLDGAELATAIATHRDDVEKALAVYEEALFVRSEAAAAESADNLGLCFRPDAPRPLVERMTHYLGEDRPGSASAS
>NZ_CP050975.1|WP_168531684.1|8264497_8265226_+|TetR-family-transcriptional-regulator
MTAHPAPRPSRRERPAKPALTREGIIETAVALMCAEGLSRVTMRRLAQELDTGPASLYVYVRNTAELHAAVLDELLGAVDLGPARADGDWRDRLVEVLTSYTAVLFEHPGLARSALVSRPFGDRYLDLLDALLALMSEGGIPRARAAWAVDLLLQFATATAAEHAPGEKDPADAEGEWAALAAALHGASGERHPHVTAAGAELLSGPGEARMDWGFQVLISGILHTPRHGTSDTSRPSLPKE
>NZ_CP050975.1|WP_168534405.1|8263632_8264253_-|DUF2238-domain-containing-protein
MPTALVALVVAGLAVSAWNPHDRTTWLLETVWVLLGLPLAVLFRRRFPLTNLLCCLLAAHALVLAVGGHYTYAQVPVGDWVRDGLGLARNPYDRFGHLMQGFVPAVLVREVLSRTSPLRGSRWLAPLTVCACLAFSALFEMFEWAAAVIGGHSADAFLATQGDVWDTQWDMFCALIGATLSVVLLSRAHDRQLDALRSEGSGKDAR
>NZ_CP050975.1|WP_168531683.1|8262535_8263519_+|aldo/keto-reductase
MDEREFGRSGQKASVIGLGTWQLGADWGDVSEADAKAVLETAAESGVTFFDTADVYGDGRSEQTIASFVSGRPDLHVMVATKMGRRVEQIPQNYVLDNFRAWNDRSRRNLGVDRIDLVQLHCPPTPVYSSDEVFDALDTLVEEERIAAYGVSVETCDEALTAIARPNVASVQIILNPFRMKPLRQVLPAAQEAGVGIIARVPLASGLLSGKYTKDTVFGADDHRTYNRHGEAFDQGETFSGVDFVTGVEAAAEFSALAPEGCTPAQLALRWIIQQPGVTTVIPGARSPEQAHANAEAAKLPPLSRQTLDAIDELYDRRIKEQVEGRW
>NZ_CP050975.1|WP_168531688.1|8275738_8277193_+|serine-hydrolase
MSARPLPVSTPAAQGVDAAGVHAFLDAVEAAPDIEPHSLMLLRHGHVVASGWWAPYAPDRLHLLYSLSKSFTSTAAGFAVAEGLVRLDDPVISYFPEFEAEITDPRSRAMLVRHVASMASGHLGETFEAAARLDREEIVRGFLLVPPDREPGTVFAYNQPATYTLASIVQRVTGRSLTEYLRPRLLDPLGIGETAWLQRPPGRDLGFSGLHAATDAVARLGQFYLQDGVWDGERLLPSWWIKEATREQIPTADGTPAGERSDWQRGYGFQFWMGRHGYRGDGAFGQFCVVLPEQDVVIATTAATEDMQGLLDLMWRHLLPAFGSAPLPGTEDEGLRRRLAGLALPPVEANPEPPAAGDAWAGAVFAPRDGVCAEQRTLTGVEVVAPADGDGWRVSLTEGDERHELRLAPAEWTVEDGPIPMAVSGGWTDPDTLRFDVVFLETPHRLTVSCALPDGTFGVRWHATPLHRGPLRSLRAPGREREQA
>NZ_CP050975.1|WP_168531689.1|8277451_8278477_+|alcohol-dehydrogenase-catalytic-domain-containing-protein
MTTYRVAQVESAGGPFEIVEREATPPGPGHVRVTVDACGVCHSDTFFVNAGVPGVTFPVVPGHEIAGRVEELGEGTQGRGWEVGDRVGVGWFGGACGYCTPCREGDFIVCENLKVPGWAYEGGFAESVVVPVDTLARIPDALAATDAAPLGCAGVTVFNGLRRSSARPGDLVAVLGVGGLGHLAVQYAVAMGCETVAIARGSGKADFAKRLGAHHYVDSTADTPVAEALRSLGGAQVVLATASNSEAITATVDGLRHRGELVVIGLDGTPLGISPAQLIMGARVVRGHPSGTSQDVQDAMEFSALHGIRPMTEVVPLDQTDEAYRKMLAGSARFRMVLSNG
>NZ_CP050975.1|WP_168531690.1|8278698_8279400_-|alpha/beta-fold-hydrolase
MVSVVLVHGLYHRPEHFIRVAEGLRAAGVDVVTPELHRGSLAADTAAVQTAVDVLAEPPLVLGHSYGGSVITGLRGVGRLVYLAAFVPDVHESAANLGGASVELKTAIEPRTDGSTRLDPSRAAHVLYRDCPERLAALAVGLLRPQAAGCGRGVPERQGWKHAPSVYVVCTEDRAVDPGLQQVMAARCGSVREWATGHSPFVGRAELVIDLVLELLGASDTPDGADRGITATR
>NZ_CP050975.1|WP_168531691.1|8279483_8280239_-|helix-turn-helix-domain-containing-protein
MSTIAKAGRVLDLYTPGSPVWGVSEVATALQIPRSTAHSLLAGLTEAGLLHQPRRGRYELGWRAFELGQIHRVTSGGLIETAHPVMQEISRRHSESVCMAVYDRQALIFIDKVVGDDPLSVVGPRIGMRYEPHTFASGRLLMAHLPTAEIEDYIRTSSQRTRSSNAVVRPQVFRDQLVRIQNDELSYDDGGAILDVGCVAARLIGRHGQTIASLSISAPSRRFQENRVRLTESVKAAAATISRRLREHGQM
>NZ_CP050975.1|WP_168531692.1|8280279_8281029_-|SDR-family-oxidoreductase
MTDIAGQAVIVTGANGGLGRQWVAQALERGAAKVYATDVTPGTWDDARVTPLVLDVTREETIDAVVAAASDATILINNAGIALRDPIMTVEDAKLRHVFDVNFFGTVTVTRRLAPVIVANGGGAILNVISLLSWLSLPAAYSAAKAALWSVTNAFRLELAPHGVDLVALHMGYTATPMTEALNVVKNDPADIVRAGLDGIQDGSLEVLADQWSVEVKAALAGPVQDLYPQLSGAAYPFRMVPIAAAPVQ
>NZ_CP050975.1|WP_168531693.1|8281075_8281840_-|SDR-family-oxidoreductase
MTHPFDMRGRTALVTGSTAGIGLAVAKGLHGLGARVVLSSNDEADIKEAIDALAADGIEVEGIVCDLNDPDSVRTLAERAHARFGRIDALIAHAGGYTHVGPLIDTSEEDVERTFRTSVFHNLILIEGFLPLMAAQGGGSVVLTSSIASLRASTRLAVYGAAKAALNSLVRNIAAEWGDRGVRANAVAPGTVRTRFSQALWSDPERERAAGANTALGRIAEPEDIVGAVLLFASDAGSYISGQTLLVDAGRSIL
>NZ_CP050975.1|WP_168531694.1|8281836_8282703_-|alpha/beta-fold-hydrolase
MSQTLTAPDHFVTVGDETYAYRSFGASEGTPLVFLSRLRGTMDDWDHALIDPIAADRPVILFDNLGVGRTSGRNPGTVTEMTASAIAFVEAIADGPVDLLGFSLGGYIAQRFVLARPDLVRRVVLAGTGPGYGEGILPSEPVVAPLRTAPELALDAFRVLFFTDSQAGIRAGDDMWRRIHVRADREPEVPMDAVLQQVAAIRNWSGGVEGGDQAFPELEKIWHPVLVANGAHDVMIPTVNSFIMSQKLPNAELHVYPDSGHGFLFQYPDAFSQLVNGFLARTGSRATA
>NZ_CP050975.1|WP_168531695.1|8282756_8284094_-|MFS-transporter
MVTPTSEDLSAPSPPAAAPVSVATRVRSYFASTVGNLLEWFDWAVYAAMSPFIATALFSPANKVSGLLATLAVFAVGFVMRPVGGVVFGFLANRRGRKFVLLVTMIGMAAGTLSIAVIPTYAAIGGWSSFLLVVARLLQGFAHGGETAISYSYVTEVAPRERRGLWSSGVLGCVIAGTILANAVAGTLTAATSEGFMADGGWRIPFVIGAALGIYALFLRRSMMESNVYERATTSGAGDARSITSLPSWSAGRIVRRSTQLVLYVAGGSVVQYTWTAYAGTYAITQKHMSPSTAYWSLLVAQVVGLAFMPFWGWVSDRVGRRPLVIAYGIVFAALVYPAFTFIGSTWWTLAVPATVIFALWGMSGSQSPAVQAENVTTRHRAPVVGAVSSIAAALFGGTAPYLSAYTGSVGAPWAFQVFVIVLCLISAIVGFTLKETKGVDLEKV
>NZ_CP050975.1|WP_168534413.1|8285782_8286166_-|hypothetical-protein
MVTQREGYVRSVKEAWHSPRRRLLLSAVLTVAVVAQSAVIVAHQQQIDELRARRIELQSDGTLHGPSGPPGPSGPSGPPGPTGPTGKPGWHGKDGRHGGRGHNGRRGENGRNGHVITAEPTPDETDD
>NZ_CP050975.1|WP_168534415.1|8286509_8286728_-|hypothetical-protein
MQLDGLQTQPIDLQEHLEPGPPGPSGPSGPPGADGAIGPPGKDGTDGQDGQDGREGRDGKDGTDGKDAVVPP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP050975.1	587891-587911	2	0.905
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP050975.1	2732590-2732610	2	0.905
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP050975.1	6940919-6940939	2	0.905

1. spacer 1.2|282666|21|NZ_CP050975|CRT matches to position: 587891-587911, mismatch: 2, identity: 0.905

gccgcctacgccacggccgac	CRISPR spacer
gccgcctacgccaaggcctac	Protospacer
************* **** **

2. spacer 1.2|282666|21|NZ_CP050975|CRT matches to position: 2732590-2732610, mismatch: 2, identity: 0.905

gccgcctacgccacggccgac	CRISPR spacer
gccgccgacgccgcggccgac	Protospacer
****** *****.********

3. spacer 1.2|282666|21|NZ_CP050975|CRT matches to position: 6940919-6940939, mismatch: 2, identity: 0.905

gccgcctacgccacggccgac	CRISPR spacer
gccccctacgccaccgccgac	Protospacer
*** ********** ******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	25339-25359	1	0.952
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP054026	Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence	124888-124908	1	0.952
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	CP016642	Mycobacterium sp. djl-10 plasmid djl-10_2, complete sequence	3598-3618	1	0.952
NZ_CP050975_1	1.2\|282666\|21\|NZ_CP050975\|CRT	282666-282686	21	NZ_CP054036	Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence	250932-250952	1	0.952
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	336235-336258	2	0.917
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP015742	Shinella sp. HZN7 plasmid pShin-06, complete sequence	75463-75486	2	0.917
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	60676-60699	2	0.917
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	69891-69914	2	0.917
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	492-515	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	983718-983741	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NC_024970	Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence	62018-62041	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP015523	Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence	167718-167741	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_KJ396772	Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence	62018-62041	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP009405	Mycobacterium avium subsp. hominissuis strain OCU464 plasmid p78K, complete sequence	47365-47388	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP015738	Shinella sp. HZN7 plasmid pShin-02, complete sequence	173355-173378	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3579075-3579098	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	330224-330247	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	27186-27209	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	29961-29984	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	64831-64854	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	84297-84320	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP020447	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed7, complete sequence	113788-113811	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP024986	Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence	179036-179059	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP040096	Pantoea sp. SO10 plasmid unnamed1, complete sequence	55303-55326	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	293221-293244	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	323752-323775	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	58330-58353	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	835722-835745	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP042264	Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence	163408-163431	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	251221-251244	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	251950-251973	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	232355-232378	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	513004-513027	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_LR134447	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence	237622-237645	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_LR134451	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence	145929-145952	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP052758	Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence	138726-138749	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	185265-185288	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	269782-269805	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MK310226	Halobacterium virus ChaoS9, complete genome	32345-32368	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	KJ538722	Mycobacterium phage HH92, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	KT222940	Mycobacterium phage Kinbote, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MN062706	Mycobacterium phage Heathen, complete genome	31813-31836	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MK919482	Mycobacterium phage DeepSoil15, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MT657330	Mycobacterium phage Webster2, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MF919517	Mycobacterium phage LilHazelnut, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	EU203571	Mycobacterium phage Giles, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NC_042328	Mycobacterium virus HelDan, complete genome	32065-32088	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MF373840	Mycobacterium phage Fred313, complete genome	31757-31780	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MT818421	Mycobacterium phage Luke, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MT684594	Mycobacterium phage Hadrien, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	MT114159	Mycobacterium phage Ein37, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	KT246485	Mycobacterium phage OBUpride, complete genome	7742-7765	3	0.875
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	KT454972	Mycobacterium phage Evanesce, complete genome	7748-7771	3	0.875
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	236356-236379	4	0.833
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	3692-3715	4	0.833
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	812262-812285	4	0.833
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP016354	Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence	30117-30140	4	0.833
NZ_CP050975_1	1.1\|282621\|24\|NZ_CP050975\|CRT	282621-282644	24	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	801967-801990	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	565803-565826	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_AP021845	Azospira sp. I09 plasmid pAZI09, complete sequence	134016-134039	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP013436	Burkholderia latens strain AU17928 isolate AU17928 plasmid pAU17928, complete sequence	23643-23666	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP021914	Sagittula sp. P11 plasmid unnamed1, complete sequence	200806-200829	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP045095	Streptomyces sp. GY16 plasmid unnamed1, complete sequence	51866-51889	4	0.833
NZ_CP050975_1	1.3\|282708\|24\|NZ_CP050975\|CRT	282708-282731	24	NZ_CP041605	Streptomyces sp. S1D4-14 plasmid pS1D4-14.1, complete sequence	66655-66678	4	0.833

1. spacer 1.2|282666|21|NZ_CP050975|CRT matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.952

gccgcctacgccacggccgac	CRISPR spacer
gccgcctacgcaacggccgac	Protospacer
*********** *********

2. spacer 1.2|282666|21|NZ_CP050975|CRT matches to NZ_CP054026 (Rhizobium sp. JKLM12A2 plasmid pPR12A205, complete sequence) position: , mismatch: 1, identity: 0.952

gccgcctacgccacggccgac	CRISPR spacer
gccgcctacgcaacggccgac	Protospacer
*********** *********

3. spacer 1.2|282666|21|NZ_CP050975|CRT matches to CP016642 (Mycobacterium sp. djl-10 plasmid djl-10_2, complete sequence) position: , mismatch: 1, identity: 0.952

gccgcctacgccacggccgac	CRISPR spacer
gccgccgacgccacggccgac	Protospacer
****** **************

4. spacer 1.2|282666|21|NZ_CP050975|CRT matches to NZ_CP054036 (Rhizobium sp. JKLM13E plasmid pPR13E05, complete sequence) position: , mismatch: 1, identity: 0.952

gccgcctacgccacggccgac	CRISPR spacer
gccgcctacgcaacggccgac	Protospacer
*********** *********

5. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP044283 (Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence) position: , mismatch: 2, identity: 0.917

acggccaccaccgtcgcggccacg	CRISPR spacer
acgtccaccaccgtcgcgtccacg	Protospacer
*** ************** *****

6. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP015742 (Shinella sp. HZN7 plasmid pShin-06, complete sequence) position: , mismatch: 2, identity: 0.917

acggccaccaccgtcgcggccacg	CRISPR spacer
acggccgccactgtcgcggccacg	Protospacer
******.****.************

7. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.917

acggtcaccgtctccgccgacgac	CRISPR spacer
acggtcaccgccgccgccgacgac	Protospacer
**********.* ***********

8. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 2, identity: 0.917

acggtcaccgtctccgccgacgac	CRISPR spacer
accgtcaccgtctccgccgacggc	Protospacer
** *******************.*

9. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gaggccaccaccgtcgcggtcacg	Protospacer
. *****************.****

10. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
acggcaaccaccgtcgcggccaaa	Protospacer
***** **************** .

11. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NC_024970 (Streptomyces aureofaciens strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gcggccaccaccgtcgtggcgacg	Protospacer
.***************.*** ***

12. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP015523 (Sphingomonas sp. NIC1 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaacaccgtcgcgggcacg	Protospacer
 ****** *********** ****

13. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_KJ396772 (Streptomyces lavendulae subsp. lavendulae strain CCM3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gcggccaccaccgtcgtggcgacg	Protospacer
.***************.*** ***

14. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP009405 (Mycobacterium avium subsp. hominissuis strain OCU464 plasmid p78K, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
ccggccaccaccgtcgcggcgccg	Protospacer
 *******************  **

15. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP015738 (Shinella sp. HZN7 plasmid pShin-02, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
ccggccaccaccgccgcggcgacg	Protospacer
 ************.****** ***

16. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gcggccaccaccggcgccgccacg	Protospacer
.************ *** ******

17. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gccgccaccaccgtcgcggccagg	Protospacer
.* ******************* *

18. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcacggcaacg	Protospacer
 **************.**** ***

19. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcacggcaacg	Protospacer
 **************.**** ***

20. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcacggcaacg	Protospacer
 **************.**** ***

21. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcacggcaacg	Protospacer
 **************.**** ***

22. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP020447 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed7, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcacggcaacg	Protospacer
 **************.**** ***

23. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP024986 (Streptomyces lavendulae subsp. lavendulae strain CCM 3239 plasmid pSA3239, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
gcggccaccaccgtcgtggcgacg	Protospacer
.***************.*** ***

24. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP040096 (Pantoea sp. SO10 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcgcccacgaccgtcgcggccacg	Protospacer
 ** **** ***************

25. spacer 1.1|282621|24|NZ_CP050975|CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
tcggccaccaccgtcaccgccacg	Protospacer
 **************.* ******

26. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
aagggcaccaccgtcgcggccacc	Protospacer
* ** ******************

27. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

acggccaccaccgtcgcggccacg	CRISPR spacer
acggccaccaccgacccggccacc	Protospacer
************* * *******

28. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
ccggtgaccgtctgcgccgacgac	Protospacer
 **** ******* **********

29. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP042264 (Litoreibacter sp. LN3S51 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
accgtcaccgtcaccgccgacgat	Protospacer
** ********* **********.

30. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
gcggtcaccgtctcggtcgacgac	Protospacer
.************* *.*******

31. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
gcggtcaccgcctccgccgacggc	Protospacer
.*********.***********.*

32. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
gcggtcaccgtcgccgccgccgac	Protospacer
.*********** ****** ****

33. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
gccgtcaccgtctccgccgacaac	Protospacer
.* ******************.**

34. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_LR134447 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 5, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
ccgggcaccgtctccgccgacgcc	Protospacer
 *** ***************** *

35. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_LR134451 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 9, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
ccggtcaccgtccccgcggacgac	Protospacer
 ***********.**** ******

36. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP052758 (Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
gcgctcaccgtctccgccggcgac	Protospacer
.** ***************.****

37. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
accgtcaccgtctccgacgacgag	Protospacer
** ************* ******

38. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgtctgcgccgccgac	Protospacer
 ************ ***** ****

39. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MK310226 (Halobacterium virus ChaoS9, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
aacgtcaccgtctccgtcgacgac	Protospacer
*  *************.*******

40. spacer 1.3|282708|24|NZ_CP050975|CRT matches to KJ538722 (Mycobacterium phage HH92, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

41. spacer 1.3|282708|24|NZ_CP050975|CRT matches to KT222940 (Mycobacterium phage Kinbote, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

42. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MN062706 (Mycobacterium phage Heathen, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
acggtcaccgtccgcgccgacgag	Protospacer
************. *********

43. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MK919482 (Mycobacterium phage DeepSoil15, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

44. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MT657330 (Mycobacterium phage Webster2, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

45. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MF919517 (Mycobacterium phage LilHazelnut, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

46. spacer 1.3|282708|24|NZ_CP050975|CRT matches to EU203571 (Mycobacterium phage Giles, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

47. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NC_042328 (Mycobacterium virus HelDan, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
acggtcaccgtccgcgccgacgag	Protospacer
************. *********

48. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MF373840 (Mycobacterium phage Fred313, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
acggtcaccgtccgcgccgacgag	Protospacer
************. *********

49. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MT818421 (Mycobacterium phage Luke, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

50. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MT684594 (Mycobacterium phage Hadrien, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

51. spacer 1.3|282708|24|NZ_CP050975|CRT matches to MT114159 (Mycobacterium phage Ein37, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

52. spacer 1.3|282708|24|NZ_CP050975|CRT matches to KT246485 (Mycobacterium phage OBUpride, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

53. spacer 1.3|282708|24|NZ_CP050975|CRT matches to KT454972 (Mycobacterium phage Evanesce, complete genome) position: , mismatch: 3, identity: 0.875

acggtcaccgtctccgccgacgac	CRISPR spacer
tcggtcaccgcctccgccgccgac	Protospacer
 *********.******** ****

54. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.833

acggccaccaccgtcgcggccacg	CRISPR spacer
ggcgccaccaccgtcgcggccacc	Protospacer
.  ********************

55. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 4, identity: 0.833

acggccaccaccgtcgcggccacg	CRISPR spacer
ggcgccaccaccgtcgcggccacc	Protospacer
.  ********************

56. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 4, identity: 0.833

acggccaccaccgtcgcggccacg	CRISPR spacer
ggcgccaccaccgtcgcggccacc	Protospacer
.  ********************

57. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP016354 (Prauserella marina strain DSM 45268 plasmid pPmarDSM45268, complete sequence) position: , mismatch: 4, identity: 0.833

acggccaccaccgtcgcggccacg	CRISPR spacer
acggccaccaccgtcgcgccccac	Protospacer
****************** **

58. spacer 1.1|282621|24|NZ_CP050975|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.833

acggccaccaccgtcgcggccacg	CRISPR spacer
gcgggcaccaccgtcgcggccagc	Protospacer
.*** *****************

59. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
ctcgtcaccctctccgccgacgac	Protospacer
 . ****** **************

60. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_AP021845 (Azospira sp. I09 plasmid pAZI09, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
cgggtcaccgtctccgccgaccgc	Protospacer
  ******************* .*

61. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP013436 (Burkholderia latens strain AU17928 isolate AU17928 plasmid pAU17928, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
caggtcaccctctccgccgacgaa	Protospacer
  ******* *************

62. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP021914 (Sagittula sp. P11 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
ctggtcaccgtccccgccgacgag	Protospacer
 .**********.**********

63. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP045095 (Streptomyces sp. GY16 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
ccggtcaccgtgtccgccgacgcg	Protospacer
 ********** **********

64. spacer 1.3|282708|24|NZ_CP050975|CRT matches to NZ_CP041605 (Streptomyces sp. S1D4-14 plasmid pS1D4-14.1, complete sequence) position: , mismatch: 4, identity: 0.833

acggtcaccgtctccgccgacgac	CRISPR spacer
ggcgtcaccgtcaccgccgacgac	Protospacer
.  ********* ***********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1672 : 60093

Clostridium_botulinum_C_phage(33.33%)

transposase,integrase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168524991.1\|1672_2440_-\|transposase	transposase	NA	NA	NA	NA
WP_168524993.1\|2524_3865_-\|transposase	transposase	NA	NA	NA	NA
WP_168533134.1\|4270_5125_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_168524994.1\|5204_5639_-\|transposase	transposase	NA	NA	NA	NA
WP_168524996.1\|5828_6245_-	tautomerase family protein	NA	NA	NA	NA
WP_168524934.1\|6830_7169_-	hypothetical protein	NA	NA	NA	NA
WP_168524998.1\|7505_7793_+	hypothetical protein	NA	NA	NA	NA
WP_168533136.1\|7837_8098_+	hypothetical protein	NA	NA	NA	NA
WP_168525000.1\|10756_11017_-	hypothetical protein	NA	NA	NA	NA
WP_168525002.1\|11723_12464_-	restriction endonuclease	NA	NA	NA	NA
WP_168524935.1\|13009_13198_-	hypothetical protein	NA	NA	NA	NA
WP_168525004.1\|13447_15238_-	DEDDh family exonuclease	Q332J4	Clostridium_botulinum_C_phage	2.3e-05	38.7
WP_168533138.1\|16741_17836_-	hypothetical protein	NA	NA	NA	NA
WP_168525006.1\|19370_20558_+	epoxide hydrolase	NA	NA	NA	NA
WP_168525008.1\|22514_23117_+	GPP34 family phosphoprotein	NA	NA	NA	NA
WP_168525010.1\|23762_24782_-	ABC transporter	NA	NA	NA	NA
WP_168525011.1\|26073_27165_-	CU044_5270 family protein	NA	NA	NA	NA
WP_168525013.1\|27161_27854_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_168533140.1\|28495_29368_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168525015.1\|29544_29952_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_168525017.1\|30376_30799_-	SsgA family sporulation/cell division regulator	NA	NA	NA	NA
WP_168525019.1\|31324_34102_-	AAA family ATPase	NA	NA	NA	NA
WP_168525021.1\|35394_36357_-	alpha/beta hydrolase fold domain-containing protein	L7RDF8	Acanthamoeba_polyphaga_moumouvirus	6.9e-49	37.1
WP_168533142.1\|36839_37256_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_168525023.1\|37294_38110_-	AAA family ATPase	NA	NA	NA	NA
WP_168525025.1\|38106_38385_-	hypothetical protein	NA	NA	NA	NA
WP_168525027.1\|38381_39740_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_168525029.1\|39844_40429_-	hypothetical protein	NA	NA	NA	NA
WP_168533144.1\|40837_41260_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168525031.1\|41491_42493_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168525032.1\|42999_44430_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_168525033.1\|44686_45160_-	glyoxalase	NA	NA	NA	NA
WP_168525034.1\|46053_46524_-	glyoxalase	NA	NA	NA	NA
WP_168525035.1\|47227_48169_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168525036.1\|48575_49127_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168533146.1\|49252_50248_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_168525037.1\|50820_51117_-	hypothetical protein	NA	NA	NA	NA
WP_168533148.1\|51239_51848_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168533150.1\|51956_52967_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_168525038.1\|52987_53590_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_168525039.1\|55018_55717_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168525040.1\|55979_56327_+	hypothetical protein	NA	NA	NA	NA
WP_168525041.1\|56495_56948_+	hypothetical protein	NA	NA	NA	NA
WP_168525042.1\|58517_59267_+	hypothetical protein	NA	NA	NA	NA
WP_168533152.1\|59694_60093_+\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	1.7e-41	63.1

DBSCAN-SWA_2

8303952 : 8378500

Thermus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168531708.1\|8303952_8304528_+\|transposase	IS607 family transposase	F9VHY9	Thermus_phage	1.9e-22	36.8
WP_168531709.1\|8304524_8305982_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A7P9	Microcystis_virus	3.4e-39	33.3
WP_168531710.1\|8306051_8307530_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_168534419.1\|8307658_8308198_+	hypothetical protein	NA	NA	NA	NA
WP_168531711.1\|8308403_8309228_-	ABC transporter permease	NA	NA	NA	NA
WP_168531712.1\|8309224_8310154_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.5e-28	33.5
WP_168531713.1\|8310353_8311529_+	sensor histidine kinase	NA	NA	NA	NA
WP_168531714.1\|8311525_8312188_+	response regulator	NA	NA	NA	NA
WP_168534421.1\|8312577_8314293_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	3.2e-20	34.7
WP_168531715.1\|8314592_8315222_+	hypothetical protein	NA	NA	NA	NA
WP_168531716.1\|8315366_8317427_-	beta-galactosidase	NA	NA	NA	NA
WP_168531717.1\|8317529_8318870_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_168531718.1\|8318970_8319963_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_168531719.1\|8319967_8320894_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_168531720.1\|8321174_8322206_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	9.1e-39	35.9
WP_168531721.1\|8322310_8322862_+	hypothetical protein	NA	NA	NA	NA
WP_168531722.1\|8323858_8327032_-	Ig-like domain repeat protein	NA	NA	NA	NA
WP_168531723.1\|8327252_8328560_-	beta-propeller fold lactonase family protein	NA	NA	NA	NA
WP_168531724.1\|8330065_8336839_+	hypothetical protein	NA	NA	NA	NA
WP_168531725.1\|8337182_8337551_-	hypothetical protein	NA	NA	NA	NA
WP_168531726.1\|8338378_8338864_-	DUF1524 domain-containing protein	NA	NA	NA	NA
WP_168531727.1\|8338889_8339585_-	hypothetical protein	NA	NA	NA	NA
WP_168531728.1\|8340186_8340711_-	hypothetical protein	NA	NA	NA	NA
WP_168531729.1\|8340862_8341057_-	hypothetical protein	NA	NA	NA	NA
WP_168531730.1\|8341119_8341293_+	hypothetical protein	NA	NA	NA	NA
WP_168531731.1\|8341471_8341663_+	hypothetical protein	NA	NA	NA	NA
WP_168531732.1\|8342521_8343106_+	hypothetical protein	NA	NA	NA	NA
WP_168534423.1\|8343087_8343537_-	hypothetical protein	NA	NA	NA	NA
WP_168534425.1\|8343888_8344506_+	hypothetical protein	NA	NA	NA	NA
WP_168531733.1\|8345153_8345606_+	hypothetical protein	NA	NA	NA	NA
WP_168534427.1\|8345895_8347080_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_168531734.1\|8348119_8348896_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168531735.1\|8349064_8349883_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_168524962.1\|8350222_8350492_-	hypothetical protein	NA	NA	NA	NA
WP_168534429.1\|8350663_8351257_+	hypothetical protein	NA	NA	NA	NA
WP_168531736.1\|8352144_8353557_+	hypothetical protein	NA	NA	NA	NA
WP_168531737.1\|8353828_8355421_-	Na+/H+ antiporter	NA	NA	NA	NA
WP_168534431.1\|8355676_8358220_+	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_168531738.1\|8358287_8359037_+	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_168531739.1\|8360358_8361225_-	hypothetical protein	NA	NA	NA	NA
WP_168531740.1\|8362538_8363084_-	hypothetical protein	NA	NA	NA	NA
WP_168534433.1\|8363185_8364088_-\|transposase	transposase	NA	NA	NA	NA
WP_059203638.1\|8364238_8364616_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_168531741.1\|8364787_8365132_-	hypothetical protein	NA	NA	NA	NA
WP_168531742.1\|8365510_8366320_+	hypothetical protein	NA	NA	NA	NA
WP_168531743.1\|8366655_8367489_-	hypothetical protein	NA	NA	NA	NA
WP_168531744.1\|8367498_8368032_-	SigE family RNA polymerase sigma factor	NA	NA	NA	NA
WP_168531745.1\|8368938_8369367_+	hypothetical protein	NA	NA	NA	NA
WP_168534435.1\|8369507_8370362_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_168531746.1\|8370899_8371301_-	hypothetical protein	NA	NA	NA	NA
WP_168531747.1\|8372608_8373376_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_168531748.1\|8373570_8373717_+	hypothetical protein	NA	NA	NA	NA
WP_168531749.1\|8374753_8375479_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	7.1e-06	34.0
WP_168531750.1\|8375609_8375810_-	hypothetical protein	NA	NA	NA	NA
WP_168531751.1\|8376369_8377038_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_168531752.1\|8377294_8377912_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168531753.1\|8378326_8378500_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

8599229 : 8676279

Mycobacterium_phage(33.33%)

transposase,integrase

attL 8589646:8589661|attR 8632085:8632100

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
8589646:8589661	attL	NA	NA	NA	NA
WP_168531903.1\|8599229_8599889_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_168531904.1\|8600426_8601686_+	group II intron reverse transcriptase/maturase	NA	NA	NA	NA
WP_168531905.1\|8601722_8602091_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168531906.1\|8602108_8602492_-\|transposase	transposase	NA	NA	NA	NA
WP_168531907.1\|8602525_8603470_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_168531908.1\|8604233_8604839_+	hypothetical protein	NA	NA	NA	NA
WP_168531909.1\|8604942_8606421_-	metallophosphoesterase	NA	NA	NA	NA
WP_168531910.1\|8607940_8608819_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168531911.1\|8609085_8610150_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168531912.1\|8610524_8610866_+	hypothetical protein	NA	NA	NA	NA
WP_168531913.1\|8611330_8611975_+	CBS domain-containing protein	NA	NA	NA	NA
WP_168531914.1\|8613307_8614267_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168531915.1\|8614510_8615356_+	SDR family NAD(P)-dependent oxidoreductase	A0A2P0VP75	Tetraselmis_virus	2.5e-10	31.2
WP_168531916.1\|8615524_8616505_+	aldo/keto reductase	NA	NA	NA	NA
WP_168531917.1\|8616648_8617191_+	flavodoxin family protein	NA	NA	NA	NA
WP_168531918.1\|8617096_8617639_-\|transposase	transposase	NA	NA	NA	NA
WP_168531919.1\|8617712_8617865_-	hypothetical protein	NA	NA	NA	NA
WP_168524964.1\|8618279_8619164_+	hypothetical protein	NA	NA	NA	NA
WP_168534463.1\|8619234_8619915_+	DoxX family membrane protein	NA	NA	NA	NA
WP_168531920.1\|8620082_8620997_+	universal stress protein	NA	NA	NA	NA
WP_168534465.1\|8622472_8623216_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_168531921.1\|8623218_8625606_+	glycoside hydrolase family 65 protein	NA	NA	NA	NA
WP_168531922.1\|8625621_8626353_-	universal stress protein	NA	NA	NA	NA
WP_168531923.1\|8626524_8629218_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168531924.1\|8632581_8633283_-	response regulator	NA	NA	NA	NA
8632085:8632100	attR	NA	NA	NA	NA
WP_168531925.1\|8633417_8634080_-	CBS domain-containing protein	NA	NA	NA	NA
WP_168531926.1\|8634108_8634573_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_168531927.1\|8634803_8635787_+	universal stress protein	NA	NA	NA	NA
WP_168531928.1\|8637471_8638542_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_168531929.1\|8638561_8639248_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168531930.1\|8639364_8639808_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_168531931.1\|8640432_8641356_+	carbamate kinase	NA	NA	NA	NA
WP_168531932.1\|8642156_8642480_-	hypothetical protein	NA	NA	NA	NA
WP_168531933.1\|8643019_8643511_-	hypothetical protein	NA	NA	NA	NA
WP_168531934.1\|8643543_8644446_-	hypothetical protein	NA	NA	NA	NA
WP_168531935.1\|8644767_8645058_+	WhiB family transcriptional regulator	A0A2P1JRB7	Mycobacterium_phage	3.8e-11	44.2
WP_168531936.1\|8645334_8645934_+	hypothetical protein	NA	NA	NA	NA
WP_168534467.1\|8646795_8647218_+	hypothetical protein	NA	NA	NA	NA
WP_168531937.1\|8647815_8647980_-	hypothetical protein	NA	NA	NA	NA
WP_168531938.1\|8648992_8649517_+	hypothetical protein	NA	NA	NA	NA
WP_168531939.1\|8649513_8650287_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.4e-28	33.2
WP_168531940.1\|8650286_8651882_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	8.3e-15	24.3
WP_168531941.1\|8652736_8653231_+	hypothetical protein	NA	NA	NA	NA
WP_168534469.1\|8653344_8653836_+	hypothetical protein	NA	NA	NA	NA
WP_168531942.1\|8654639_8655113_-	hypothetical protein	NA	NA	NA	NA
WP_168531943.1\|8656720_8657959_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_168531944.1\|8658562_8659567_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168531945.1\|8659770_8660172_+	hypothetical protein	NA	NA	NA	NA
WP_168531946.1\|8661772_8662105_+	Lsr2 family protein	S5W0B7	Mycobacterium_phage	4.7e-13	43.1
WP_168531947.1\|8663982_8664720_+	hypothetical protein	NA	NA	NA	NA
WP_168531948.1\|8665374_8665677_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_168531949.1\|8666915_8667878_-	carbohydrate kinase	NA	NA	NA	NA
WP_168531950.1\|8668138_8669155_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_168531951.1\|8669305_8670301_+	ABC transporter permease	NA	NA	NA	NA
WP_168531952.1\|8670297_8671134_+	ATP-binding cassette domain-containing protein	F2Y1V6	Organic_Lake_phycodnavirus	2.2e-06	24.9
WP_168531953.1\|8671210_8672242_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_168534471.1\|8672343_8672769_-	ATP-binding protein	NA	NA	NA	NA
WP_168531954.1\|8675010_8676279_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

8797962 : 8855223

Gordonia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168532039.1\|8797962_8798658_-\|transposase	transposase	NA	NA	NA	NA
WP_168532040.1\|8798756_8799620_-	radical SAM protein	NA	NA	NA	NA
WP_168532041.1\|8799700_8799958_-	hypothetical protein	NA	NA	NA	NA
WP_168532042.1\|8803768_8804266_+	hypothetical protein	NA	NA	NA	NA
WP_168532043.1\|8804424_8805051_+	hypothetical protein	NA	NA	NA	NA
WP_168532044.1\|8805318_8805498_-	hypothetical protein	NA	NA	NA	NA
WP_168532045.1\|8807451_8808567_+	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	6.2e-33	31.2
WP_168532046.1\|8808563_8809790_+	hypothetical protein	NA	NA	NA	NA
WP_168532047.1\|8809774_8810389_-	hypothetical protein	NA	NA	NA	NA
WP_168532048.1\|8810798_8811056_+	hypothetical protein	NA	NA	NA	NA
WP_168532049.1\|8811223_8813989_+	protein kinase	M1HTZ5	Acanthocystis_turfacea_Chlorella_virus	3.3e-11	32.0
WP_168532050.1\|8814364_8814511_-	hypothetical protein	NA	NA	NA	NA
WP_168534493.1\|8815160_8817272_+	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_168532051.1\|8817300_8818311_+	AAA domain-containing protein	NA	NA	NA	NA
WP_168532052.1\|8818397_8823158_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_168532053.1\|8823569_8824697_+	DUF1768 domain-containing protein	NA	NA	NA	NA
WP_168532054.1\|8825215_8825470_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532055.1\|8825717_8826260_-	hypothetical protein	NA	NA	NA	NA
WP_168532056.1\|8826727_8827243_-	hypothetical protein	NA	NA	NA	NA
WP_168532057.1\|8827239_8827884_-	hypothetical protein	NA	NA	NA	NA
WP_168532058.1\|8831657_8832119_+	hypothetical protein	NA	NA	NA	NA
WP_168532059.1\|8832145_8832991_+	hypothetical protein	NA	NA	NA	NA
WP_168532060.1\|8833064_8833250_-	hypothetical protein	NA	NA	NA	NA
WP_168534494.1\|8833325_8833646_+	hypothetical protein	NA	NA	NA	NA
WP_168534496.1\|8837805_8838927_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_168532061.1\|8839252_8840122_+	hypothetical protein	NA	NA	NA	NA
WP_168532062.1\|8840743_8841742_+	DUF218 domain-containing protein	NA	NA	NA	NA
WP_168532063.1\|8843368_8843800_+	hypothetical protein	NA	NA	NA	NA
WP_168534498.1\|8844071_8844908_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
WP_168532064.1\|8845482_8846070_+	DUF4240 domain-containing protein	NA	NA	NA	NA
WP_168534500.1\|8847178_8848111_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_168532065.1\|8848562_8850863_+	M4 family peptidase	NA	NA	NA	NA
WP_168532066.1\|8852878_8853787_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-25	30.1
WP_168532067.1\|8853792_8854098_-\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	1.5e-05	34.0
WP_168532068.1\|8854176_8855223_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

8975133 : 9105044

106

Mycobacterium_phage(23.08%)

transposase,integrase

attL 8963481:8963498|attR 9108256:9108273

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
8963481:8963498	attL	NA	NA	NA	NA
WP_168532138.1\|8975133_8976375_-\|transposase	IS256 family transposase	A0A2P1JQX9	Mycobacterium_phage	1.2e-146	64.0
8963481:8963498	attL	NA	NA	NA	NA
WP_168532139.1\|8976863_8977697_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168534528.1\|8977719_8978301_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532140.1\|8979105_8979492_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_168532141.1\|8981575_8981983_+	(2Fe-2S) ferredoxin domain-containing protein	NA	NA	NA	NA
WP_168534530.1\|8982693_8983146_+	hypothetical protein	NA	NA	NA	NA
WP_168534532.1\|8983247_8984177_+	hypothetical protein	NA	NA	NA	NA
WP_168532142.1\|8985144_8985615_+	hypothetical protein	NA	NA	NA	NA
WP_168534534.1\|8987018_8988071_-	phosphotransferase	NA	NA	NA	NA
WP_168534536.1\|8988345_8988588_+	hypothetical protein	NA	NA	NA	NA
WP_168532143.1\|8988798_8989347_-	hypothetical protein	NA	NA	NA	NA
WP_168532144.1\|8989918_8990113_+	hypothetical protein	NA	NA	NA	NA
WP_168532145.1\|8990162_8990540_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_168532146.1\|8990509_8991712_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_168532147.1\|8992484_8992790_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_168532148.1\|8993067_8994474_+\|transposase	IS1380 family transposase	A0A222ZN33	Mycobacterium_phage	5.1e-93	46.0
WP_168532149.1\|8994741_8995221_-	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_168532150.1\|8995668_8996949_-	MFS transporter	NA	NA	NA	NA
WP_168532151.1\|8997949_8998483_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_168532152.1\|8998562_8999159_+	nucleotidyltransferase family protein	NA	NA	NA	NA
WP_168532153.1\|8999327_8999678_-	hypothetical protein	NA	NA	NA	NA
WP_168524971.1\|9000448_9000601_+	hypothetical protein	NA	NA	NA	NA
WP_168532154.1\|9001209_9003549_+	AAA family ATPase	NA	NA	NA	NA
WP_168532155.1\|9003545_9004142_+	response regulator transcription factor	NA	NA	NA	NA
WP_168532156.1\|9004755_9008418_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.1e-30	36.5
WP_168532157.1\|9008495_9009059_+	hypothetical protein	NA	NA	NA	NA
WP_168532158.1\|9009872_9010832_+	DUF1152 domain-containing protein	NA	NA	NA	NA
WP_168532159.1\|9012068_9012731_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532160.1\|9012928_9016144_+	cytochrome P450	V5UQK0	Mycobacterium_phage	2.2e-67	34.5
WP_168532161.1\|9017743_9019978_-	SpoIIE family protein phosphatase	A0A1J0MCT1	Streptomyces_phage	4.7e-08	45.8
WP_168532162.1\|9020110_9020746_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532163.1\|9020882_9022028_+	2,3-dihydroxybiphenyl 1,2-dioxygenase	NA	NA	NA	NA
WP_168534538.1\|9022039_9022999_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_168532164.1\|9022995_9024618_+	bifunctional 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase	NA	NA	NA	NA
WP_168532165.1\|9024634_9026641_+	acetoacetate--CoA ligase	NA	NA	NA	NA
WP_168534540.1\|9026822_9027440_+	malonic semialdehyde reductase	NA	NA	NA	NA
WP_168532166.1\|9027823_9028528_+	hypothetical protein	NA	NA	NA	NA
WP_168532167.1\|9028667_9029327_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532168.1\|9029587_9030007_-	SRPBCC family protein	NA	NA	NA	NA
WP_168532169.1\|9030793_9031417_-	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_168532170.1\|9031450_9032185_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.6e-16	30.5
WP_168532171.1\|9032328_9032940_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532172.1\|9032936_9033182_+	hypothetical protein	NA	NA	NA	NA
WP_168532173.1\|9034077_9034437_-	hypothetical protein	NA	NA	NA	NA
WP_168532174.1\|9035130_9036567_-	acyltransferase family protein	NA	NA	NA	NA
WP_168532175.1\|9036939_9038529_-	hypothetical protein	NA	NA	NA	NA
WP_168532176.1\|9038533_9038863_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168534542.1\|9038859_9039417_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8DJP1	Virus_Rctr41k	1.3e-07	32.5
WP_168534544.1\|9040089_9040488_-\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	1.9e-40	61.5
WP_168532067.1\|9041409_9041715_+\|transposase	transposase	A0A1B3AZF8	Gordonia_phage	1.5e-05	34.0
WP_168532177.1\|9041720_9042629_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.9e-25	29.5
WP_168534546.1\|9043139_9044051_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_168532178.1\|9044237_9044870_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_168534548.1\|9044962_9045898_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_168532179.1\|9045976_9046636_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_168532180.1\|9047329_9047590_-	hypothetical protein	NA	NA	NA	NA
WP_168532181.1\|9047696_9047861_+	hypothetical protein	NA	NA	NA	NA
WP_168532182.1\|9048092_9048302_+	hypothetical protein	NA	NA	NA	NA
WP_168534550.1\|9048771_9049053_+	ANTAR domain-containing protein	NA	NA	NA	NA
9048553:9048570	attR	NA	NA	NA	NA
WP_168532183.1\|9049114_9049522_-	ATP-binding protein	NA	NA	NA	NA
9048553:9048570	attR	NA	NA	NA	NA
WP_168532184.1\|9050078_9050309_-	DUF5133 domain-containing protein	NA	NA	NA	NA
WP_168534552.1\|9050786_9051071_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_168532185.1\|9051548_9053498_+	transglycosylase SLT domain-containing protein	B1ABI9	Lactococcus_phage	1.1e-05	32.6
WP_168532186.1\|9053772_9054096_-	hypothetical protein	NA	NA	NA	NA
WP_168532187.1\|9054310_9054682_+	hypothetical protein	NA	NA	NA	NA
WP_168534554.1\|9055636_9056047_+	hypothetical protein	A0A1J0MC67	Streptomyces_phage	2.1e-10	50.0
WP_168532188.1\|9056451_9056928_-	hypothetical protein	NA	NA	NA	NA
WP_168534556.1\|9057848_9058583_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_168534558.1\|9059442_9061032_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_168532189.1\|9061309_9061729_-	hypothetical protein	NA	NA	NA	NA
WP_168532190.1\|9065204_9066359_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_168532191.1\|9066549_9066900_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532192.1\|9067083_9067452_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532193.1\|9067842_9068148_+	DUF427 domain-containing protein	NA	NA	NA	NA
WP_168534560.1\|9068425_9069376_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_168532194.1\|9069710_9071408_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_168532195.1\|9071846_9073118_+	MFS transporter	NA	NA	NA	NA
WP_168532196.1\|9073430_9075395_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_168532197.1\|9075748_9076471_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532198.1\|9077547_9077883_+	hypothetical protein	NA	NA	NA	NA
WP_168532199.1\|9077945_9078659_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_168532200.1\|9079101_9079485_+	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_168532201.1\|9080108_9080744_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168532202.1\|9080749_9080983_-	hypothetical protein	NA	NA	NA	NA
WP_168532203.1\|9081689_9082244_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_168532204.1\|9082494_9083319_+	isocitrate lyase/phosphoenolpyruvate mutase family protein	NA	NA	NA	NA
WP_168532205.1\|9083379_9084027_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_168532206.1\|9084633_9085548_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_168532207.1\|9086119_9087007_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_168532208.1\|9087564_9087810_+	hypothetical protein	NA	NA	NA	NA
WP_168532209.1\|9088187_9088796_-	hypothetical protein	NA	NA	NA	NA
WP_168532210.1\|9088965_9089454_-	hypothetical protein	NA	NA	NA	NA
WP_168532211.1\|9089654_9090074_-	hypothetical protein	NA	NA	NA	NA
WP_168532212.1\|9090543_9090777_+	hypothetical protein	NA	NA	NA	NA
WP_168534562.1\|9090819_9091326_+\|transposase	transposase	NA	NA	NA	NA
WP_168534564.1\|9091355_9091811_-	hypothetical protein	NA	NA	NA	NA
WP_168532213.1\|9092001_9092616_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532214.1\|9092795_9093050_+	hypothetical protein	NA	NA	NA	NA
WP_168532215.1\|9093198_9093894_-	hypothetical protein	NA	NA	NA	NA
WP_168532216.1\|9094296_9097890_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	0.0e+00	52.8
WP_168532217.1\|9097886_9098261_+	hypothetical protein	NA	NA	NA	NA
WP_168532218.1\|9098265_9099387_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_168532219.1\|9100652_9101213_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_168532220.1\|9101476_9103030_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_168532221.1\|9103178_9103331_+	hypothetical protein	NA	NA	NA	NA
WP_168534566.1\|9103943_9105044_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
9108256:9108273	attR	NA	NA	NA	NA

DBSCAN-SWA_6

9389156 : 9429483

Planktothrix_phage(40.0%)

protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168532467.1\|9389156_9390347_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_168532469.1\|9390807_9391497_+\|tail	lamin tail domain-containing protein	NA	NA	NA	NA
WP_168532471.1\|9391853_9392306_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168532473.1\|9392511_9393555_+	hypothetical protein	NA	NA	NA	NA
WP_168532475.1\|9393797_9394703_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_168534609.1\|9394968_9396171_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_168532477.1\|9397116_9397857_+	DUF1684 domain-containing protein	NA	NA	NA	NA
WP_168532479.1\|9397903_9399424_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168532481.1\|9399423_9400389_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_168532483.1\|9400385_9401264_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_168532485.1\|9401260_9402061_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.0e-14	31.0
WP_168532487.1\|9402057_9402822_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.8e-22	37.0
WP_168532489.1\|9402929_9403871_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168532491.1\|9404014_9404740_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168532493.1\|9404798_9405338_-	AAA family ATPase	NA	NA	NA	NA
WP_168532495.1\|9405607_9405793_+	CsbD family protein	NA	NA	NA	NA
WP_168532497.1\|9406249_9407803_+	carboxylesterase family protein	A0A0M4JT58	Mollivirus	1.8e-38	35.6
WP_168534610.1\|9408043_9408778_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_168532499.1\|9409031_9409535_-	hypothetical protein	NA	NA	NA	NA
WP_168532501.1\|9409596_9409701_-	aminopeptidase	NA	NA	NA	NA
WP_168532503.1\|9409983_9410634_+	DUF4360 domain-containing protein	NA	NA	NA	NA
WP_168532505.1\|9410709_9410916_-	hypothetical protein	NA	NA	NA	NA
WP_168532507.1\|9411140_9411377_+	DUF320 domain-containing protein	NA	NA	NA	NA
WP_168532509.1\|9412163_9413042_+	hypothetical protein	NA	NA	NA	NA
WP_168532511.1\|9413145_9413397_+	hypothetical protein	NA	NA	NA	NA
WP_168532513.1\|9413408_9414608_+	flotillin	NA	NA	NA	NA
WP_168532515.1\|9414817_9415057_-	hypothetical protein	NA	NA	NA	NA
WP_168532517.1\|9416860_9417418_-\|tail	phage tail protein	NA	NA	NA	NA
WP_168532519.1\|9419374_9419815_-	GPW/gp25 family protein	A0A1D8KR06	Synechococcus_phage	5.3e-12	31.6
WP_168532521.1\|9419855_9421763_-	VgrG-related protein	NA	NA	NA	NA
WP_168532523.1\|9421762_9422500_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_168532525.1\|9422561_9422987_-\|tail	phage tail protein	NA	NA	NA	NA
WP_168532527.1\|9423031_9423211_-	hypothetical protein	NA	NA	NA	NA
WP_168532529.1\|9426032_9426383_-	hypothetical protein	NA	NA	NA	NA
WP_168532531.1\|9426715_9426874_-	hypothetical protein	NA	NA	NA	NA
WP_153286958.1\|9427365_9427809_-\|tail	phage tail protein	NA	NA	NA	NA
WP_168532533.1\|9427902_9429483_-\|tail	phage tail sheath family protein	J9PVC2	Bacillus_phage	3.1e-70	34.7

DBSCAN-SWA_7

9546582 : 9611088

Burkholderia_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168534618.1\|9546582_9548067_+\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_168532697.1\|9548372_9548828_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168532698.1\|9549070_9549637_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_168532700.1\|9549898_9550444_-	hypothetical protein	NA	NA	NA	NA
WP_168532702.1\|9550589_9550994_+	hypothetical protein	NA	NA	NA	NA
WP_168532704.1\|9550983_9551295_+	hypothetical protein	NA	NA	NA	NA
WP_168532706.1\|9551437_9552142_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_168534619.1\|9552229_9552580_-	SsgA family sporulation/cell division regulator	NA	NA	NA	NA
WP_168532708.1\|9552893_9553340_-	hypothetical protein	NA	NA	NA	NA
WP_168534620.1\|9554611_9554812_+	hypothetical protein	NA	NA	NA	NA
WP_168532710.1\|9554948_9555725_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_168532712.1\|9555898_9556738_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_168532714.1\|9557203_9558079_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168532715.1\|9558481_9558961_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168532717.1\|9559176_9560109_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_168534621.1\|9560589_9563433_-	alpha-L-rhamnosidase	NA	NA	NA	NA
WP_168532719.1\|9563902_9565711_+	glycosyl hydrolase	NA	NA	NA	NA
WP_168532721.1\|9565956_9566517_+	hypothetical protein	NA	NA	NA	NA
WP_168532723.1\|9567194_9567524_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.5e-06	32.4
WP_168532725.1\|9568282_9568762_-	hypothetical protein	NA	NA	NA	NA
WP_168532727.1\|9575214_9575985_+\|transposase	transposase	NA	NA	NA	NA
WP_168532729.1\|9576056_9576971_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532731.1\|9577046_9577394_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_168534622.1\|9578130_9578754_+	hypothetical protein	NA	NA	NA	NA
WP_168532733.1\|9579030_9579834_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_168532735.1\|9579993_9580881_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168534623.1\|9581181_9581553_-	VOC family protein	NA	NA	NA	NA
WP_168532737.1\|9581780_9582365_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168532739.1\|9582500_9583373_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_168532741.1\|9583752_9584289_-	2'-5' RNA ligase family protein	NA	NA	NA	NA
WP_168532743.1\|9584549_9585797_-	phosphodiester glycosidase family protein	NA	NA	NA	NA
WP_168532745.1\|9585947_9587729_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_168532747.1\|9588027_9589185_+	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	1.1e-32	31.4
WP_168531420.1\|9590439_9590868_+\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	9.9e-40	59.8
WP_168532749.1\|9591128_9591989_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168532751.1\|9592177_9593041_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_168532753.1\|9593337_9593859_-	hypothetical protein	NA	NA	NA	NA
WP_168532755.1\|9594067_9595426_-	hypothetical protein	NA	NA	NA	NA
WP_168532757.1\|9595530_9595983_+	hypothetical protein	NA	NA	NA	NA
WP_168532759.1\|9596303_9596876_+	hypothetical protein	NA	NA	NA	NA
WP_168532761.1\|9596965_9597667_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168532763.1\|9597663_9597843_+	hypothetical protein	NA	NA	NA	NA
WP_168532765.1\|9600213_9600669_+\|transposase	transposase	NA	NA	NA	NA
WP_168532767.1\|9600613_9601816_-	XdhC family protein	NA	NA	NA	NA
WP_168532769.1\|9602166_9602643_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_168532771.1\|9602653_9604987_-	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_168534624.1\|9607327_9608350_-	RNA polymerase subunit sigma-70	NA	NA	NA	NA
WP_168534625.1\|9608676_9610044_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_168532773.1\|9610503_9611088_+\|transposase	IS607 family transposase	F9VHY9	Thermus_phage	8.2e-21	35.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050975

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection