CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP051128	Bacillus megaterium strain S2 chromosome, complete genome	5 crisprs	cas14k,cas3,csa3,DEDDh,DinG	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051128_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051128_1

1296085-1296187

Orphan

Consensus_repeat	Method
AAAAACTAATCAAACGTTTGATTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051128_1

>merge|NZ_CP051128|1|1296085-1296187|CRISPRCasFinder
AAAAACTAATCAAACGTTTGATTATATGGGATTTAAGCATGGAACTATAAGGGTTTCTCCATGCCCTATTGATTGAGTGAAAAACTAATCAAACGTTTGATTA

>NZ_CP051128|1|1|1296085-1296187|CRISPRCasFinder
AAAAACTAATCAAACGTTTGATTA	TATGGGATTTAAGCATGGAACTATAAGGGTTTCTCCATGCCCTATTGATTGAGTG
AAAAACTAATCAAACGTTTGATTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051128.1\|WP_168245911.1\|1304552_1305644_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|340819
NZ_CP051128.1\|WP_168241766.1\|1290134_1290929_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
NZ_CP051128.1\|WP_168241768.1\|1294220_1295354_+\|glycerate-kinase	unknown	unknown	gnl\|CDD\|376844
NZ_CP051128.1\|WP_168241763.1\|1285892_1287191_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270303
NZ_CP051128.1\|WP_168241771.1\|1296771_1297743_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP051128.1\|WP_098935138.1\|1287216_1288098_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP051128.1\|WP_168241775.1\|1302564_1302909_+\|DUF4183-domain-containing-protein	unknown	unknown	gnl\|CDD\|372730
NZ_CP051128.1\|WP_168241765.1\|1288973_1290032_+\|zinc-binding-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176217
NZ_CP051128.1\|WP_168241770.1\|1296382_1296580_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168241776.1\|1303082_1304297_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340831
NZ_CP051128.1\|WP_168241764.1\|1288084_1288939_+\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
NZ_CP051128.1\|WP_168241762.1\|1284195_1285881_+\|sugar-phosphorylase	unknown	unknown	gnl\|CDD\|200493
NZ_CP051128.1\|WP_168241774.1\|1300882_1301269_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168245910.1\|1301466_1302384_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187566
NZ_CP051128.1\|WP_168241773.1\|1299464_1300691_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
NZ_CP051128.1\|WP_168245909.1\|1290939_1291980_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP051128.1\|WP_168241772.1\|1297744_1299094_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319269
NZ_CP051128.1\|WP_168241769.1\|1295356_1296040_+\|beta-phosphoglucomutase	unknown	unknown	gnl\|CDD\|213672
NZ_CP051128.1\|WP_168241767.1\|1291976_1294205_+\|glycoside-hydrolase-family-65-protein	unknown	unknown	gnl\|CDD\|224471
NZ_CP051128.1\|WP_168241777.1\|1305636_1306623_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|367154

Protein	Function_ID	Function_description	E-value
NZ_CP051128.1\|WP_168245911.1\|1304552_1305644_+\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|340819	cd03786, GTB_UDP-GlcNAc_2-Epimerase, UDP-N-acetylglucosamine 2-epimerase and similar proteins. Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family (EC 5.1.3.14) are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues (UDP-ManNAc) for use in the biosynthesis of a variety of cell surface polysaccharides; The mammalian enzyme is bifunctional, catalyzing both the inversion of stereochemistry at C-2 and the hydrolysis of the UDP-sugar linkage to generate free ManNAc. It also catalyzes the phosphorylation of ManNAc to generate ManNAc 6-phosphate, a precursor to salic acids. In mammals, sialic acids are found at the termini of oligosaccharides in a large variety of cell surface glycoconjugates and are key mediators of cell-cell recognition events. Mutations in human members of this family have been associated with Sialuria, a rare disease caused by the disorders of sialic acid metabolism. This family belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	3.35599e-122
NZ_CP051128.1\|WP_168241766.1\|1290134_1290929_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	2.44315e-43
NZ_CP051128.1\|WP_168241768.1\|1294220_1295354_+\|glycerate-kinase	gnl\|CDD\|376844	pfam02595, Gly_kinase, Glycerate kinase family. This is family of Glycerate kinases.	4.03887e-179
NZ_CP051128.1\|WP_168241763.1\|1285892_1287191_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.33618e-56
NZ_CP051128.1\|WP_098935138.1\|1287216_1288098_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	4.00819e-67
NZ_CP051128.1\|WP_168241775.1\|1302564_1302909_+\|DUF4183-domain-containing-protein	gnl\|CDD\|372730	pfam13799, DUF4183, Domain of unknown function (DUF4183). This domain of unknown function contains a highly conserved ING motif.	8.107e-16
NZ_CP051128.1\|WP_168241765.1\|1288973_1290032_+\|zinc-binding-alcohol-dehydrogenase	gnl\|CDD\|176217	cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability.	2.63506e-78
NZ_CP051128.1\|WP_168241771.1\|1296771_1297743_-\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	0.00229206
NZ_CP051128.1\|WP_168241776.1\|1303082_1304297_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	5.89605e-60
NZ_CP051128.1\|WP_168241764.1\|1288084_1288939_+\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.86917e-74
NZ_CP051128.1\|WP_168241762.1\|1284195_1285881_+\|sugar-phosphorylase	gnl\|CDD\|200493	cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase). Sucrose phosphorylase is a bacterial enzyme that catalyzes the phosphorolysis of sucrose to yield glucose-1-phosphate and fructose. These enzymes do not have the conserved calcium ion present in other alpha amylase family enzymes. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP051128.1\|WP_168245910.1\|1301466_1302384_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187566	cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs. This subgroup contains UDP-N-acetylglucosamine 4-epimerase of Pseudomonas aeruginosa, WbpP, an extended SDR, that catalyzes the NAD+ dependent conversion of UDP-GlcNAc and UDPGalNA to UDP-Glc and UDP-Gal. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.35099e-128
NZ_CP051128.1\|WP_168241773.1\|1299464_1300691_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
NZ_CP051128.1\|WP_168245909.1\|1290939_1291980_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	8.96348e-68
NZ_CP051128.1\|WP_168241772.1\|1297744_1299094_-\|hypothetical-protein	gnl\|CDD\|319269	cd16412, dndB, DNA sulfur modification protein DndB. dndB acts in the regulation of DNA modifications, including DNA phosphorothioation. DndB may act by binding near the phosphorothioate modification site and regulating access of the Dnd modification machinery to DNA. These proteins show similarity to the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system, and other members of the ParB/Srx superfamily.	7.97906e-14
NZ_CP051128.1\|WP_168241769.1\|1295356_1296040_+\|beta-phosphoglucomutase	gnl\|CDD\|213672	TIGR01990, bPGM, beta-phosphoglucomutase. This model represents the beta-phosphoglucomutase enzyme which catalyzes the interconverison of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate. The 6-phosphate is capable of non-enzymatic anomerization (alpha <-> beta) while the 1-phosphate is not. A separate enzyme is responsible for the isomerization of the alpha anomers. Beta-D-glucose-1-phosphate results from the phosphorylysis of maltose (2.4.1.8), trehalose (2.4.1.64) or trehalose-6-phosphate (2.4.1.216). Alternatively, these reactions can be run in the synthetic direction to create the disaccharides. All sequenced genomes which contain a member of this family also appear to contain at least one putative maltose or trehalose phosphorylase. Three species, Lactococcus, Enterococcus and Neisseria appear to contain a pair of paralogous beta-PGM's. Beta-phosphoglucomutase is a member of the haloacid dehalogenase superfamily of hydrolase enzymes. These enzymes are characterized by a series of three catalytic motifs positioned within an alpha-beta (Rossman) fold. beta-PGM contains an inserted alpha helical domain in between the first and second conserved motifs and thus is a member of subfamily IA of the superfamily. The third catalytic motif comes in three variants, the third of which, containing a conserved DD or ED, is the only one found here as well as in several other related enzymes (TIGR01509). The enzyme from L. lactis has been extensively characterized including a remarkable crystal structure which traps the pentacoordinate transition state. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	4.69109e-97
NZ_CP051128.1\|WP_168241767.1\|1291976_1294205_+\|glycoside-hydrolase-family-65-protein	gnl\|CDD\|224471	COG1554, ATH1, Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism].	0
NZ_CP051128.1\|WP_168241777.1\|1305636_1306623_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|367154	pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein, mannosyl-transferase, and several putative epimerases (e.g. WbiI).	2.06833e-122

>NZ_CP051128.1|WP_168241769.1|1295356_1296040_+|beta-phosphoglucomutase
MVNPTIEAVVFDLDGVITDTAHFHYLAWKQLAEELDIIIDEIFNERLKGVSRMDSLELILKEGNRQNDFTLSEKEEMAYKKNLHYCDLLKQLTPNDVLPGILELISNIKAEGIPVGLASVSKNAGTVLKALDLEGAFDYIADAAKIKKSKPDPEIFLTACKGLGASPKRSIGIEDARAGIEAINSSEMFSVGVGNTLRDANYLVGSTIHLQWKSIKEAYEICLKGSK
>NZ_CP051128.1|WP_168241768.1|1294220_1295354_+|glycerate-kinase
MKIVIAPDSFKESLAADQVAKAIQAGFMKFFPEAEYHLLPIADGGEGTVQALSSATGGNMETITVTGPLHEPVKAKIAFSNDGKKAFIEMAEACGLHLVPLKRRNPLQTTSYGVGELILHAINRGAVELIIGVGGSGTNDGGMGMASALGYQFFDKNSEIVYGDGQDLFQACSMSDIHRDKRLDDVKITIAADVDNPLTGQNGATYVYGPQKGLPETMLFEVDQAMGEFYHMACGHLGKDVTNLPGSGAGGGMGAGLILFANATIKKGIDLMLEQLRVKEICQDADIVIVGEGKIDGQTLYGKAPMGVASCAPPQAKVIAICGSVGVGSEALYEYGFDAIFPTIPGLLPMEQIMDGAYTNIETTSRNIAAIFQKGGN
>NZ_CP051128.1|WP_168241767.1|1291976_1294205_+|glycoside-hydrolase-family-65-protein
MINEQIIYENKFDLHSINKFASLMTLGNGYLGLRATYDEDYFEQTRGMYVAGIYNKSAENEPSDLVNLPDLAGIRIEIDNEIFSLSNGEILSYERFLNLATGELKRELLWKNRGGARFRFVFQRFVAKNNLHVFASKMTVTSLDQSASIKIVTGINAQQTNFGKQHLIEEKVRVFDEEVMQGVYKTTESGHTIALATRCKCSAESEVSFAAKNRQLHTTIKHGLYVNIPFIFEKLGTVFTSLDQGVDGQDPEAASIKELSEISPLGYDALLEISALKWQEFWQQKRIEITSTDQFDQTAMDFALYHLEIMTPAHDERFSIGAKGLTGEGYKGHVFWDTEIFINPFHLYTEPETAKKLLIYRYLHLQQAKEKAARNGYEGALFPWESAFSGEEETPEFAAINIRTGKRQKVASALAEHHIVADIAYAVVQYYQTTLDEEFMKKEGLALLKETARFWISRAVLENGQVSIKDVIGPDEYTEHIDNNAYTNYMAYYNVEQALYFMEQYGEVDEQLKEQGRAFIKHLYLPKPNEQLIIPQDDTFLSKPEIDLSRYKENQGSQGILLDYSRAEVNEMQILKQADVVMLMYLFPELFESEVVSKNLSYYEEHTIHDSSLSKAIHAIVAARCHESDAAYRFFQEACLIDLGPNPHSSDEGLHAASLGAIWLTAMFGFANISLTNNRLKLDPRLPASWSELKFKLTIQGCPLEIFMTHEKIVVSKNLGPNLLLEINGTEYLLTDRIEVNS
>NZ_CP051128.1|WP_168245909.1|1290939_1291980_+|Gfo/Idh/MocA-family-oxidoreductase
MVIKKKVAIIGGGQVAEKVHIPNYQAREELEVVAVVSPNFDRARSFAERNGISRVYTDAAEMFAMEKPDIVSVCTPNKYHYENVMRALEFGCDVMCEKPPAISAAQANDMQIAAQKNDCILAYNFHHRFADDVKILRESVENGVLGDIYVTKAKALRRCGIPGWGTFTDKEIQGGGPLIDLGAHMLDAALYVLGFPKIEKVTAKMYQKIGTKKTQGTLGEWDPQKFKVEDSLFGFIELEGGRLLQLETSFALNIKETSVMNVEFCGDQAGATLFPAQIYTDESGELVSLLSREEADTDRHHKSMSAFIDKCLGKDVMVADGKQGYIIQQLIEALYQSAEKGESVSL
>NZ_CP051128.1|WP_168241766.1|1290134_1290929_+|sugar-phosphate-isomerase/epimerase
MKIGTQNQAFFPEGIKEKFRYLKEVGFEGFEIDGKFLVDHIDEVKEAIAETGIPVTTACGGYTGWIGDFIEERRLNGLAEIKQILEALKEVGGKGIVVPAAWGMFTFRLPPMVSPRSQAGDRKAVSDSLIYLDKVAEETGTTIFLEPLNRYQDHMINTLADARSYIEENELKNVKIIADFYHMNIEEDDISEALHQNRDLVGHIHLADNHRYQPGSGSLDFKKHFNQLKEDGYNGFLTIECRVRGNDPEAAYINALRHLKESLI
>NZ_CP051128.1|WP_168241765.1|1288973_1290032_+|zinc-binding-alcohol-dehydrogenase
MKKLVAVEPRKAELVEYEDRHVQPNEVKIDVDFAAPKHGTEVIDFRGQTPFMGENFNEEWRMFMPREEGSAPGIVFGEFQLGNMVVGKIVEIGSDVTEYHMGETVCTYGPIMETVIVNAINNHRLRKMPEGAKWQNAVCYDPAQFALSGVRDAQVRAGDVVVIVGLGAIGQIAIQLAKKAGASIVVGVDPIEHRCEIALRNGADVCFDPTSCDVGYEVKKLTNKMGADSIIETSGNSAALQDALKGIAYGGIISYVAFGKPFPAGLNFGREAHFNNAKIVFSRAASEPNPDYPRWNRKRIEDTCWELLMNGYLNCEDIIQPIVTFENSAEAYMEYVDQHPELSIKMGIEYKK
>NZ_CP051128.1|WP_168241764.1|1288084_1288939_+|carbohydrate-ABC-transporter-permease
MAMASSKKNKVAKTAGFYTALIAILTLCLFPFFIMLMTSFKSSKEAVSTNPTFLPKEWTLQHYLDIFNPDIFPYLSYFNNSLVVSLTASILSVAIGIFGAYALSKLNFKGRVTINASFYTVYMFSGILLVVPLFKIISGLGLYDTKTSLIITMIVQTLPTAIFMLKSYFDTIPVDLEEAAMIDGLNRVQIIFHIIIPLSLSGIISVFVYAFMIGWNDYLFASIFLSDSANFTLPIGLNALFSTPDYVWGRMMAASLVTALPVVIMYAISEHFIKGDATAGGVKG
>NZ_CP051128.1|WP_098935138.1|1287216_1288098_+|sugar-ABC-transporter-permease
MKTNIRKKTDIKLALALLFPSIFLLLLLVAYPMVANIQISFFDQPINPRLSATFVGLKNYIDILTDAEFFKSLGITLLYMLLTVGGSTAVGLGIAIFFNRPFKFRKTARSLIILSYVTPSISLVFAWKYMFNNGYGVVNYLGDDVLHLFDQAPLWFDNPISSFFLVSLFAIWRYFPYAFISFLAILQTIDSTLYEAAEIDGASAWGKFKIVTLPAIMPVLLTVITLRSIWMFYMFTDVYLLTNKVDILGIYLYKTAFAFNDLGKAASISVILFIILFIVIMIARKRVNLNGNG
>NZ_CP051128.1|WP_168241763.1|1285892_1287191_+|sugar-ABC-transporter-substrate-binding-protein
MFKKGLSLAIILLVAFALTACGSNQNADGKTTIEFMHSSVEQERLAVINELVATFEKENPDIKIKQIPVEEDSYNTKIITLASAGKLPTVLEVGQDYAKVMDKEVLIDKDAVKEIITQVGKENYYDGALKLMSTENGKSYTGVPISGWVQGIWYNKEMLAAKGFEEPKNWDDVITIAKAFTDKENKKYGIAMPTVEGGFSEQAFSQFALSNNANVLDNKGKLNMNTPEMKEALTYYKKLSQYTMPGSNDTTEVKDAFMNGTAPMAIYSTYILPPVFEEGNAQNIGFSIPSEKTKAVFGTVSALTIASFLEKDQKEAASKFVAFMSKPENMTKWVLMSPGGAQPVSKLVTENENYQANEVVKAFGDLSTEIAASFNDIQVFGLVDSKNFLKMGDVTSSGAIPKLVNNITVGKKEINSEMKKAEKTLEDVLKKE
>NZ_CP051128.1|WP_168241762.1|1284195_1285881_+|sugar-phosphorylase
MRKIKERLSFIYDNQEIDSILESIEVRIANTKTKSLKLRKQNWDEKDLVLITYGDQFYEDNNPTLDTFKKMFDQYLADKFEIVHLLPFYPYSSDDGFSVIDYKKVNPIIGNWEHIENLSKSARIMFDDVCNHISAKSDWFQEYLTGNPEYQNFFVEMDPTVDLSAVTRPRALPLLTKFILENGEEKHIWTTFSEDQIDLNFSNPQVLLKMIDVLLFYLEQGAEYIRLDAIGFMWKEVGTTCIHHEKTHEIVKLFRDVVDEAAKGTVIITETNVPHKDNVAYFGNGDDEAHMVYQFPLPPLVLNALHNGNGVALTKWASELPQTEKETTFFNFLASHDGIGLNPIRGIIPEEEILEMVEDLKKEGALVNYKKNPDGSESPYEINVTYMDALNKQSDDDEIRVKRFLVAHSILLTLPGVPAVYIQSVLGSRNDYDGVSKTGMNRSINRQKYNLTEIEKELANTDSLRYKVFSELTKILQSRKNETLFHPNAAMEVIDFGEKVFAFKRVNQHDDSLLVVNNLTNETVKCEITGRFINIVNGDKVEFHEDLMLNPYEFMWLRPID
>NZ_CP051128.1|WP_168241770.1|1296382_1296580_-|hypothetical-protein
MSVVYGKIILEVSIQDSKLENLLKVIKGINKYNIELYEIDILTSSGNVYSLKVDDVDVEWYLKEK
>NZ_CP051128.1|WP_168241771.1|1296771_1297743_-|site-specific-integrase
MKKLYNENIKIEYLMCIPENRRTVYKYALCRSYDTEDVVGKDLYEFNTNEIKDALINADHSTFNSIKLTLHVFEDYINWAIKSGKTQSNINPILSIKNDELKTYLSKKKILFSKYEIQDMQKKMVNAQDKVILQLLFEGVNGHGLSELLNLTQSDVDQANQILKLNDDKYGKRSVKVSEKCLTFVMEALNQTHYQNKNGTSMGNNPELPLVKNNYVLRTATTRVQNFKRADKHLIYRRISTIADFFGYKYLTAKNIEKSGMIAFAVVLYLERKKLDNLELSIIGNQFGVRKVVMNGHEIFNFSLLKEFINATTISDLYNINIT
>NZ_CP051128.1|WP_168241772.1|1297744_1299094_-|hypothetical-protein
MKKNELRGNLIEVVTNIKEDKKLVNKIKKGLKEYKILPGQVQSYFNNPDILWEVDIESVYLFLEQIYSATENPKIKPSIYFSPREIKEIRTNFVGYHTNSIVFPYTFRNVLKGTEDDFILYIKASEIKCLFENGLLQYNPETQREMRQSKGKDSNEIIETPKIIEKSIIEMEELLNKGEMISTIITLNARLGSTDDESGEELQYAEDSMTLTVTKGTLLDVLDGFHRINAIVRAIRKDPSLEAMFKLNILHLGKSMAQQYFRQLNTTNPVGKGQLKKLGESRQADFIAKQVQYNSELKNKVAASDSIAPYSNFLVTFKTLSDAIDEVFKVEDKRTAINIANYLIEFINELFFAFPNEFLGEVAVVRKNSLINTNSMFYGYITLARRMKDECIQLNKLFEIIKCIDFSRQNKVWIESDILNQSQKISKSIKKLIYKFFNDIDLSKYQEGG
>NZ_CP051128.1|WP_168241773.1|1299464_1300691_-|glucose-1-phosphate-adenylyltransferase
MTKKQCIAMLLAGGRGTRLKELTHYIAKPAVPFGGKYRIIDFPLSNCSNSGIDTVGVLTQYQPHTLQNYIGDGKHWNLNRKNGGVTILPSFQCGLGERWYEGTAHAIYQNLRFIESYNPAYVLIISGDHIYKMDYSKMLKQHKETSADATISVINVPWREANRFGIMNIDPDSKKILNFEEKPEQPKSNLASMGIYIFNWKLLKKYLEQEEKKPFSTKDFGKDIIPSLINDNCKLYAYRFKGYWKDVGTIRSLWEANMDLLSFKSNPILQNENWTIYTHETSQPPLYLDGKASTHKSLVSEGCKVFGSVENSVLFCGVTVGKGAVIKNSVILPNTIIGENAVINQAVVGSGTVIEANVKVGEEQPFSEITLIGDNQTIQVNKIKKALLLNLSKAPFSHNERNDSHRLT
>NZ_CP051128.1|WP_168241774.1|1300882_1301269_-|hypothetical-protein
MTKQTTAFLRIDFKNLYKKPVLEIYDYFIQYLGEPDYIEKCADQIHWFHFKSFRIEELNNQWGITIPLLKPVVDYDSIDIFMQLAEELKNKLINIYKTIPFQDDEVEIFLDYTIHHSIPLPWTELIKE
>NZ_CP051128.1|WP_168245910.1|1301466_1302384_+|NAD-dependent-epimerase/dehydratase-family-protein
MNVIVTGGAGFIGSNLVDRLINEGFDTYVIDNLSTGKRQFLNPRAKFYQSDILDAQKLKGVFEEVKPKAVFHFAAQIDVQTSIHNPNLDSQINILGTINIIELCKKYNSKLIYSSSAAVYGTPLNLPVSEQHPIHPLSNYGISKYTPELYIRCYAHLYNVKYTILRYANVYGPRQMPKGEGGVISIFINKMMNNDIPVVFGDGEHTRDFIYVEDVVAANLAALKTEKNGTYNIGTNKRISINELIEKLNTILNKKVVPEYKQERLGDINHSCLDNQLAKVELNWQPKYSIIEGLTKTCQFSEKIQ
>NZ_CP051128.1|WP_168241775.1|1302564_1302909_+|DUF4183-domain-containing-protein
MRKRESTIQYPPPFLNFPVIEKQEYYVSRKQVDTIEFYALSDGFKRVYTEKDALMGYGKQKILDPRNVSFINLFINGILQPKTCYLIEEGKITFLTDDIPAKGAPIILQMFKFY
>NZ_CP051128.1|WP_168241776.1|1303082_1304297_-|glycosyltransferase-family-4-protein
MKVLLATYWAVPHLGGVWTYMVQLKEKLESLGHEVDLLGYGHDNSYVHMVNQERKVEKSEWFSMLSDNAESFISFHINPLVQYTETQQNFYTKAVSYLGLEKYDIIHTQDVISTASINRIRPAHTALVATLHGCVAHEIRQQLTTIHNSPTSYLARLYFDELEHIGATSPEYTIVANKWLKNILTNEFNVPDEQLKLSNYGYDTESFIKKMKEENSFQKPSDKKVIIYTGRLVELKGVQFLISALSKLKEIRTDWVCWIVGEGDKQADLQIQSRTLGLEENIIFHGKRDDVPFLLSLSDIFVLPSLIENQPLAVIEAQIAERAIIVSDTGGLPEMVEHGVTGIVTPAGDSEVLCKNLNLLLSNERYRKIIGSNAQKWGMKHWIPEEAVEKVLNVYQSAISKRRK
>NZ_CP051128.1|WP_168245911.1|1304552_1305644_+|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MKIMTILGTRPEIIRLSLIIKKLDKYAEKHILVHTGQNYTSSLSDIFFQQLGIRDPDYILSDEQMSLGQQLSTMYKNLETIFIKEKPDKVLVLGDTNSGLSAILAERMGIPVFHMEAGNRCFDLEVPEEKNRRIIDTISSFNFPYTPQSKENLINEGIPRNRIIVSGNPINEVLEHFKSEIKHSKILEKLKLKEGSYFLVTIHRAENVDYEDRLLEIIKGINLVAEAYKKRVICSLHPRTKSRIQSSSAITVHPLVEFHEPFSFFDFIKLEKNAFCVLTDSGTVQEECCLFHVPTVTIRKSTERPETLECGSNILSGIDANQIVACVHIMVNLPKTWSFPEGYAYKNVADKIIKLLLGGMKVV
>NZ_CP051128.1|WP_168241777.1|1305636_1306623_+|SDR-family-NAD(P)-dependent-oxidoreductase
MFNNQIVLVTGGTGSWGHELVRQLLTYNPKEIRIFSRNESNQFKMKQEFDNNPKLNFIIGDIKDKDALFEACQTVKYVFHLAALKHVPVCEDQPDEAMKTNVTGTQNVIDAAIECKVQKVIYISTDKASDPANFYGLSKAMGEKLIIHSNLRNTNTRFVCIRGGNVLGTSGSVIHVFKKQINEKQKIGITDVKMTRFFLTVHEAIKLVFKATFDSVGGEIFVMKMPACKIIDLAHVLIDASTKKNVQIETLGIRPGEKIHEQLLSEYESKMTYIYDEEYYVILPAIHIEGLKEHYAGYKRVNLESYNSSTGLLSKDEIKEMLLKGRFI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051128_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051128_2

1330689-1330919

Orphan

Consensus_repeat	Method
AAACTAATCAAACGATTGATTAAAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP051128_2

>merge|NZ_CP051128|2|1330689-1330919|CRISPRCasFinder
TTACTAATCAAACGTTTGATTGGAACGGGATGAGGCCTTGGTGTGTAGGGGTTTTTAGGGTAAAGGATTTTTCTTGATAAACTAATCAAACGATTGATTAAAAGGGTCTGAGGCCTTGGTGTATAAGGTTTTTATGAGGTTGGTAATTTTTTATAAAAAAAACTAATCAAACGATTGATTAAAAAGAGCAGAAAATTTACCTGAAAAAATTAATCAAACGTTTGATTAAAT

>NZ_CP051128|2|2|1330689-1330919|CRISPRCasFinder
TTACTAATCAAACGTTTGATTGGAA	CGGGATGAGGCCTTGGTGTGTAGGGGTTTTTAGGGTAAAGGATTTTTCTTGAT
AAACTAATCAAACGATTGATTAAAA	GGGTCTGAGGCCTTGGTGTATAAGGTTTTTATGAGGTTGGTAATTTTTTATAAAAA
AAACTAATCAAACGATTGATTAAAA	AGAGCAGAAAATTTACCTGAAA
AAATTAATCAAACGTTTGATTAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051128.1\|WP_168241800.1\|1335437_1336397_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP051128.1\|WP_168241795.1\|1328934_1330149_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341042
NZ_CP051128.1\|WP_168241799.1\|1334682_1335450_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
NZ_CP051128.1\|WP_168241798.1\|1333341_1334205_+\|ParM/StbA-family-protein	unknown	unknown	gnl\|CDD\|212669
NZ_CP051128.1\|WP_168241792.1\|1323836_1324868_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|239584
NZ_CP051128.1\|WP_168241791.1\|1322015_1323461_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP051128.1\|WP_088085274.1\|1328648_1328843_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168241797.1\|1332006_1332972_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176189
NZ_CP051128.1\|WP_168241790.1\|1319936_1320920_+\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|367154
NZ_CP051128.1\|WP_168241802.1\|1337763_1338396_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|188632
NZ_CP051128.1\|WP_168241794.1\|1325526_1327200_-\|ribonuclease-J	unknown	unknown	gnl\|CDD\|223668
NZ_CP051128.1\|WP_168241796.1\|1330955_1331708_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|100107
NZ_CP051128.1\|WP_168241804.1\|1339693_1340335_+\|3-hexulose-6-phosphate-synthase	unknown	unknown	gnl\|CDD\|240077
NZ_CP051128.1\|WP_168240859.1\|1334191_1334431_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168241801.1\|1336398_1337682_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP051128.1\|WP_168241803.1\|1338574_1339552_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380632
NZ_CP051128.1\|WP_168241793.1\|1324949_1325465_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|381157
NZ_CP051128.1\|WP_168245916.1\|1330162_1330582_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP051128.1\|WP_168245914.1\|1320943_1321846_+\|NAD-dependent-epimerase/dehydratase-family-protein	unknown	unknown	gnl\|CDD\|187570
NZ_CP051128.1\|WP_168245915.1\|1327351_1328239_-\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107

Protein	Function_ID	Function_description	E-value
NZ_CP051128.1\|WP_168241800.1\|1335437_1336397_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	9.65217e-117
NZ_CP051128.1\|WP_168241795.1\|1328934_1330149_-\|MFS-transporter	gnl\|CDD\|341042	cd17489, MFS_YfcJ_like, Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.62367e-84
NZ_CP051128.1\|WP_168241799.1\|1334682_1335450_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	2.36923e-09
NZ_CP051128.1\|WP_168241798.1\|1333341_1334205_+\|ParM/StbA-family-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	1.45741e-27
NZ_CP051128.1\|WP_168241792.1\|1323836_1324868_+\|fatty-acid-desaturase	gnl\|CDD\|239584	cd03507, Delta12-FADS-like, The Delta12 Fatty Acid Desaturase (Delta12-FADS)-like CD includes the integral-membrane enzymes, delta-12 acyl-lipid desaturases, oleate 12-hydroxylases, omega3 and omega6 fatty acid desaturases, and other related proteins, found in a wide range of organisms including higher plants, green algae, diatoms, nematodes, fungi, and bacteria. The expression of these proteins appears to be temperature dependent: decreases in temperature result in increased levels of fatty acid desaturation within membrane lipids subsequently altering cell membrane fluidity. An important enzyme for the production of polyunsaturates in plants is the oleate delta-12 desaturase (Arabidopsis FAD2) of the endoplasmic reticulum. This enzyme accepts l-acyl-2-oleoyl-sn-glycero-3-phosphocholine as substrate and requires NADH:cytochrome b oxidoreductase, cytochrome b, and oxygen for activity. FAD2 converts oleate(18:1) to linoleate (18:2) and is closely related to oleate 12-hydroxylase which catalyzes the hydroxylation of oleate to ricinoleate. Plastid-bound desaturases (Arabidopsis delta-12 desaturase (FAD6), omega-3 desaturase (FAD8), omega-6 desaturase (FAD6)), as well as, the cyanobacterial thylakoid-bound FADSs require oxygen, ferredoxin, and ferredoxin oxidoreductase for activity. As in higher plants, the cyanobacteria delta-12 (DesA) and omega-3 (DesB) FADSs desaturate oleate (18:1) to linoleate (18:2) and linoleate (18:2) to linolenate (18:3), respectively. Omega-3 (DesB/FAD8) and omega-6 (DesD/FAD6) desaturases catalyze reactions that introduce a double bond between carbons three and four, and carbons six and seven, respectively, from the methyl end of fatty acids. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXX(X)HH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within the homologue, stearoyl CoA desaturase. Mutation of any one of four of these histidines in the Synechocystis delta-12 acyl-lipid desaturase resulted in complete inactivity.	2.66889e-72
NZ_CP051128.1\|WP_168241791.1\|1322015_1323461_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	1.05024e-143
NZ_CP051128.1\|WP_168241797.1\|1332006_1332972_+\|quinone-oxidoreductase	gnl\|CDD\|176189	cd05286, QOR2, Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone and 1,4-naphthoquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	3.46476e-146
NZ_CP051128.1\|WP_168241790.1\|1319936_1320920_+\|polysaccharide-biosynthesis-protein	gnl\|CDD\|367154	pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein. This is a family of diverse bacterial polysaccharide biosynthesis proteins including the CapD protein, WalL protein, mannosyl-transferase, and several putative epimerases (e.g. WbiI).	2.41347e-125
NZ_CP051128.1\|WP_168241802.1\|1337763_1338396_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|188632	cd00452, KDPG_aldolase, KDPG and KHG aldolase. KDPG and KHG aldolase. This family belongs to the class I adolases whose reaction mechanism involves Schiff base formation between a substrate carbonyl and lysine residue in the active site. 2-keto-3-deoxy-6-phosphogluconate (KDPG) aldolase, is best known for its role in the Entner-Doudoroff pathway of bacteria, where it catalyzes the reversible cleavage of KDPG to pyruvate and glyceraldehyde-3-phosphate. 2-keto-4-hydroxyglutarate (KHG) aldolase, which has enzymatic specificity toward glyoxylate, forming KHG in the presence of pyruvate, and is capable of regulating glyoxylate levels in the glyoxylate bypass, an alternate pathway when bacteria are grown on acetate carbon sources.	3.97542e-70
NZ_CP051128.1\|WP_168241794.1\|1325526_1327200_-\|ribonuclease-J	gnl\|CDD\|223668	COG0595, COG0595, mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair].	0
NZ_CP051128.1\|WP_168241796.1\|1330955_1331708_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|100107	cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).	3.82428e-09
NZ_CP051128.1\|WP_168241804.1\|1339693_1340335_+\|3-hexulose-6-phosphate-synthase	gnl\|CDD\|240077	cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS). KGPDC catalyzes the formation of L-xylulose 5-phosphate and carbon dioxide from 3-keto-L-gulonate 6-phosphate as part of the anaerobic pathway for L-ascorbate utilization in some eubacteria. HPS catalyzes the formation of D-arabino-3-hexulose-6-phosphate from D-ribulose 5-phosphate and formaldehyde in microorganisms that can use formaldehyde as a carbon source. Both catalyze reactions that involve the Mg2+-assisted formation and stabilization of 1,2-enediolate reaction intermediates.	2.27206e-71
NZ_CP051128.1\|WP_168241801.1\|1336398_1337682_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.80652e-85
NZ_CP051128.1\|WP_168241803.1\|1338574_1339552_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380632	cd19977, PBP1_EndR-like, periplasmic ligand-binding domain of putative repressor of the endoglucanase operon and its close homologs. This group includes the ligand-binding domain of putative repressor of the endoglucanase operon from Paenibacillus polymyxa and its close homologs from other bacteria. This group belongs to the LacI-GalR family repressors and are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding.	6.00313e-111
NZ_CP051128.1\|WP_168241793.1\|1324949_1325465_+\|response-regulator-transcription-factor	gnl\|CDD\|381157	cd19930, REC_DesR-like, phosphoacceptor receiver (REC) domain of DesR and similar proteins. This group is composed of Bacillus subtilis DesR, Streptococcus pneumoniae response regulator spr1814, and similar proteins, all containing an N-terminal REC domain and a C-terminal LuxR family helix-turn-helix (HTH) DNA-binding output domain. DesR is a response regulator that, together with its cognate sensor kinase DesK, comprises a two-component regulatory system that controls membrane fluidity. Phosphorylation of the REC domain of DesR is allosterically coupled to two distinct exposed surfaces of the protein, controlling noncanonical dimerization/tetramerization, cooperative activation, and DesK binding. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	7.51705e-58
NZ_CP051128.1\|WP_168245916.1\|1330162_1330582_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	1.7696e-18
NZ_CP051128.1\|WP_168245914.1\|1320943_1321846_+\|NAD-dependent-epimerase/dehydratase-family-protein	gnl\|CDD\|187570	cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs. GDP-mannose 4,6 dehydratase, a homodimeric SDR, catalyzes the NADP(H)-dependent conversion of GDP-(D)-mannose to GDP-4-keto, 6-deoxy-(D)-mannose in the fucose biosynthesis pathway. These proteins have the canonical active site triad and NAD-binding pattern, however the active site Asn is often missing and may be substituted with Asp. A Glu residue has been identified as an important active site base. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.39259e-50
NZ_CP051128.1\|WP_168245915.1\|1327351_1328239_-\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	6.82608e-171

>NZ_CP051128.1|WP_168245916.1|1330162_1330582_-|MarR-family-transcriptional-regulator
MNTSQKFFHQLLMLYRPFENKLNIHLAEHHLHRAQWSILYYLFNNGSATLVELSHYLYVEKPTVTRTMNRLEELAYVEQVPSNDKREKRTQLKELGRKVYTEVRVTIDQYETDILKGISEHEQLEAIRIMGEIRKNIIK
>NZ_CP051128.1|WP_168241795.1|1328934_1330149_-|MFS-transporter
MTQPRAKLWTKDFTIVSTVNFFVTLVFYLLIVIIGVYAVDEFGASTSQAGLVTGIFIVGSLIGRLLIGRFIESIGRKKTLFIGIILFILTLLLYFVNFGITFLLITRLLHGIAGGMVGTATGTIVAQIIPAARKAEGIGYFSMSATLATAIGPFIGLYMTQHTDFQMIFIFSLVLGVISLITAFFVDVPPLTVSVKTSEVKGFKLSNYIEPKALPIAVITLVVAFCYSSVLSFINFYAIEIDLVSTASFFFLVYSIAVLLSRPITGRLMDLKGANFIMYPGFVLLAAGLFLLSSASISITLLLAGVLIGLGFGNMQSSTQAVAVKVTPPHRMGLATSTFFIFLDAGLGFGPYILGFIIPLTGFSSLYVILGIVALATSILYYFLHGKKERSGRTIMTGPTPDPN
>NZ_CP051128.1|WP_088085274.1|1328648_1328843_-|hypothetical-protein
MIIFNKIALSFVVFFSFSIIINTYLGEKERVQSNVIYFVMNGFAYIVSALEVEKDKLSLETAEI
>NZ_CP051128.1|WP_168245915.1|1327351_1328239_-|4-hydroxy-tetrahydrodipicolinate-synthase
MNFGQVLTAMVTPFDQNGEVDFNATRILVDYLIENGTDGIVVAGTTGESPTLTTEEKVALFKLVVDAVNGRVPVIAGTGSNNTRASISLTKLAEETGVDGIMLVAPYYNKPSQEGMYQHFKAIAESTPLPIMLYNIPGRSVVNLSVETLVRLSQIPNIVALKEASGNLDAMADIISQAPSDFTLYSGDDGLALPVLAIGGAGVVSVASHVIGNEIQEMINHFKNGHVQEAASAHRRLLPIMKALFAAPNPAPVKAALNMNGVNVGGLRLPLLPLTTEEQRTLQGVLPASNVKVLI
>NZ_CP051128.1|WP_168241794.1|1325526_1327200_-|ribonuclease-J
MRTNNNKLSIFALGGINEIGKNMYVVQYADDIFIVDCGGKFPDESLLGIDLIIPDITYLEENQEKIRALIVTHGHEDHIGGIPYILRKLNIPIYATHFTLGLIELKIDEHRLHGNTKLMTIDSNSKLEFGETTVSFFRVSHSVPDCLGIVFHTPEGNVVHTGDFKFDLTPVNNQHSDIHKMADIGQHGVLVLISESTNAERKGLTPSEQMIGGNLDEAFMKADGKIFISTFASNVNRVQQVVAAAIKANRKIALLGRSMVNVVSVAIERGYLTIPEGMIIEPREVDRLSPEKVVILCTGSQGEPMAALSRLASGNFRDVSVYPGDTVILAASPIPGNEKDVSRIIDNLFQLGAKVIYGSGSSTGMHVSGHGYQEDLKLMLTLMKPTYFIPIHGEYRMLHHHRLLAESVGVEKGNTFIIKNGDVVDVENQVARQTRSIPAGDTYVDGMGVGDVGDIVLRDRKQLSEDGMLVIVITISKGDRRIISGPDTITRGFVYARNSDELLKEINRLAKKTINDLQSENIRQWNVIKQNIKKSVGQYVFTQTKRKPMILPIIIEI
>NZ_CP051128.1|WP_168241793.1|1324949_1325465_+|response-regulator-transcription-factor
MIRIVIAEDQEMLLGAIGSLLNLEEDMEVVGQASNGEEALALVHRLQPDVCIMDIEMPEMSGLEAAESLKACGCKVIILTTFARSGYYGRALQAGVSGYLLKDSPSEELAGSIRSIINGQRIYCPELIDEDSNQNEQSIQEFQPLAERKTKISTVRNYLTTILDRIKLPTG
>NZ_CP051128.1|WP_168241792.1|1323836_1324868_+|fatty-acid-desaturase
MTLQNTKTLKKQVAPFEQSTTKESVWQIINTVVPFIGLWYLAYLSLSVSYWLALVPIVVAAGFLTRIFIIFHDCTHHSFFKSRRANRIVGTAMGVLTVFPFDQWGHEHSVHHATSGNLDKRGTGDIWTLTVDEYLAAPLRLRLAYRFYRNPLVMLGLGPIYVFLLKNRFNRKGAKQKERNNTYLTNVLIVALIALLCWAIGWQAFLLVQGSIFMISGAAGIWLFYVQHTFEDSYFEEDKEWEYVKAAVEGSSFYKLPKVLQWLTGNIGFHHVHHLSPRVPNYKLEEAHNNTPPLQNVPTISLATSLKSIRFRLWDEERKNFVSFREVKALAKKRFSVQVKPEI
>NZ_CP051128.1|WP_168241791.1|1322015_1323461_-|DEAD/DEAH-box-helicase
MSEKSFTDYNLSEEITRALAILKYDTPTDVQTEVIPLALNNQDLVVKSQTGSGKTASFAIPICDMMEWEERKPQALILTPTRELAVQVRDDVTNIGRFKRIKAMAVYGKEPFSKQKEELQQKTHVVVGTPGRVMDHIDRETLVLDEIKYLIIDEADEMLNMGFIDDVEAIIKELPSDRVTMVFSATLPKDVENLCHKYMNNPVNVEIASSGVTTDTIEHLLIEGKEEDKLSLLKDVTVVENPDSCLIFCRTKEHVDTVYSELESSNYSCERLHGGLDQQDRFAVMDGFKMGNFRYLIATDVAARGIDIDNVTLVINYDVPMEKESYVHRTGRTGRAGNEGKAITFATPYEGKFVRAIERYIGFEIPKMEAPKPAEVARAKEAFEEKISGRRVVRNNKTARINQGITKLHFNGGKKKKMRAVDFVGTIAKIPGVTADDIGIITIQDQMTYVDILNGKGSLVLQALENATIKGKKLKVSKAIK
>NZ_CP051128.1|WP_168245914.1|1320943_1321846_+|NAD-dependent-epimerase/dehydratase-family-protein
MNQRPKLLITGASGFTGEHACKHFSGLGYDITAVTRNRPFDGCKGIKTEYCELTNKNNVNHLIKKVKPDFLLHLAGLNHVGDSWNDPITTLETNLLSSLYIIDAIRQLNPTCKIVIVGSSLQTSPNEISNLTHPYSLSKTLQVLISQAWVKLYKMNIVIAKPSNIIGPGSSNGVNSIFANKIAQMEKNMLDKVLVVNNLNSKRDFIDVRDVISAYEVLFNKGIAGEVYEISSGKSHSIRDLIQIYKNLTDIDFEVRALTDGVDDLVVEEKPLKLIQLGWNPIFAINSSLIDTLNYFRHKS
>NZ_CP051128.1|WP_168241790.1|1319936_1320920_+|polysaccharide-biosynthesis-protein
MFKDAVILVTGGTGSWGKELTLQILTYNPKEIIIFSRNEDSQVKMRREIEDSRLSFRIGDIRDRDALFQACKGVDYVFHLAALKHVPVCEEFPKEALKTNVTGTQNVIDAAIFNEVKKVINVSTDKAADPANFYGFTKAISEKLIIHANLFSSKTKFVCVRGGNVLGTNGSVLHLFIDQIKMKNEITITDKRMTRFFLTKEDAIKLLLKAATDGKGGEIFVINMPACRIIDLAEVLIEYFGKEVNIIETGSRPGEKLHEVLVSHHEIEDTVVYNQEYLVVLPEVNISEVRELYSNCQPINMSSYSSNDDLMTHEEIKKLLIKSKFLQ
>NZ_CP051128.1|WP_168241796.1|1330955_1331708_-|class-I-SAM-dependent-methyltransferase
MDRNKFSAIAHRNHAFSNPISEAKIMKMLGIVSPKASDKVIDIGAGKCELLIRLVENYHVSPTAIELYDGSIEEAKRNASNRIPEGSIEFIVEDASTAVERCEPDGYDFGICIGSTHALGGMEPTLKTLKRLVKKNGHILIGEGYWKQTPSPEYLEALGGADESECKSHADTVKAGEELGLIPLWSYVANDDDWDDYEWLYSMSVENYCLENPDDPDYEAMLQRIRTWRRTYLAWGRDTLGFGLYLYRNN
>NZ_CP051128.1|WP_168241797.1|1332006_1332972_+|quinone-oxidoreductase
MKALMFKTFGGPEVLEYGDIEEPVIGSDEILLSMKAIGLNFADIYRRKGNYHLAGEPPYILGYEGAGIVAKTGSDVQGISIGDRMAFADVPYANAELVAVPVGKAIPVPDTISFEEAASVLLQGLTAHYLTKDSYAVKKNDTVLVHAAAGGVGQLLVQIVKLLGGTAIGLTSSIEKRAAAVEAGADQVFLYKDDWKEKVLEETNGKGVDVVYESVGSTLQESFEVTRTGGTVVFYGMAGGDPALVDPRMLMDTSKTLTGGDLWNVLTSREERIARSNELFRWIEEGKLIVSEPTVFPLHDGKEAHRYLESRKSMGKILLIP
>NZ_CP051128.1|WP_168241798.1|1333341_1334205_+|ParM/StbA-family-protein
MTHKWILAIDAGAYEVKGRTRDDVFKFRSTIGPYRHLHLVNADSSQMEAGDYIVEYGDEKLFVGNIAWRECHAIREPRDISKAHEETKIRVLVAVHQYGKTEGNCVVIGQPIRGMVNKDRESMEYMLKGEHTITVNNVRKTFYIEEVKVAPEGSGAYFSMEDRPEDIANIIDAGSGTFNYLRVEDGYFIDRKSGTLAFGAETDMEMTEKQMAVAILAELRGKWNLYEPTYLCGGIAEYLLPYIKEHFSNIKLIRPVLYRTNGHKAYSPQYANAFGFYSMGKAVFVDE
>NZ_CP051128.1|WP_168240859.1|1334191_1334431_+|hypothetical-protein
MLMNELNRKIKSVPFNLDDPYERELLEHCNQYIHFATYIKRLIQRDMEQGVGVIRKEYEKVEVKLEKSIDMSKLKSFGL
>NZ_CP051128.1|WP_168241799.1|1334682_1335450_+|sugar-phosphate-isomerase/epimerase
MENVIVPLNAYDRFEVLKKGQTSFIRHIAESGAFGIEIRRELLSDQDPPLDSIRNEIEQYQLFTVYSAPIELWKKDHGLNEKELNEIFHEGIALGAKWIKVSLGHFHKGQSNVIELNTFLNQYQGIQLLVENDQTLHGGNINQLTSFFESASEQDTPVKMTFDAGNWYYSGQDVDDALSKLSPYVHYLHLKQVEDDHGEFITVPLQKDGSHSWEKVMNSLPSEIAKALEFPIEPKEKTKEFIQMITESEALSCNS
>NZ_CP051128.1|WP_168241800.1|1335437_1336397_+|sugar-kinase
MQQLDVITFGEAMAMFMANHPGSLHEVGQFTRELAGAETNVAIGLARLGLRSGWASKVGNDAFGRFIIERLKNENVDIDHVLIDKNYPTGFQLKSMVLEGDPEVQYFRKGSAASHLNSKDFNEDYFQNARHLHMTGIPLALSESARAFARHALSFMKKNGKKVSFDPNLRPTLWASQEEMVKEINEAAFLADYVLPGIAEGEILTGFKEPREIASFYLEKGVDLVVIKLGAEGAFYKTATEEGTVRGFHVETVVDTVGAGDGFAVGVISGLLEGLHVHDAVSRGNAIGSLAVQSPGDNDGYPTKEELAKYIENNLQGVK
>NZ_CP051128.1|WP_168241801.1|1336398_1337682_+|MFS-transporter
MKQTIAKQRWLRLIPIAFITYSLAYLDRANYGFGAASGLAEDLHITAGTSSLLGSLFFLGYFFFQVPGAAFAEKKSAKVLIFWSLIAWGLLASFTGMITNIKLLFVIRFALGVVESAVMPSMLVLLSNWFTKAERSRANTFLILGNPATVLWMSIVSGYLVNSVGWRWMFIAEGLPAVIWAFIWWKVVNDKPRDAKWLTEQEKNDFEQQLAKEQEGIKPVKNYGEAFKSKPVILLSAQYFLWSIGVYGFVMWLPSIIKAAPNMDIVKTGWLSSVPYILAIILMLVASYFSDKTLNRNAFVWPFLLIGAVAFYASYAIGTDHFWISFVLLVIAGGAMYAPYGPFFAIIPEILPRNVAGGAMALINSMGALGSFVGSYIVGYLNDSTGGFGASYIFMAGSLFLSAILTIWAVKAAKKERNKPSDVIMSA
>NZ_CP051128.1|WP_168241802.1|1337763_1338396_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MGVEDIKKRAVVAVIRGANMETIIPMAHALKEGGVTALEITMETPKALAIIEKAADVFGDEIFVGAGTVLDAETARAAILSGAKFVFSPTVRKETIEMTKRYGVISVPGAFTATEILTAYEYGADVIKVFPAGSVGPGYFKNLAGPLPHIPLMPTGGIDMENAKDYIRAGAVAVGVGSSLVNPKKALTDDYLGLITENARKLMEEVQSAR
>NZ_CP051128.1|WP_168241803.1|1338574_1339552_+|LacI-family-DNA-binding-transcriptional-regulator
MEKVTMADVAKAADVSKSTVSQYLNKRFEYMGEKTKLKIEAAIEELGYQPNFIARSLKQKRTSMVGIIVANITHFFSTEISRAIEDFCHQHDLHAIVCNADDDPEKEKKYIEMLRAKQVDGLIIFPTGQNNDLYKTMVRQGYPVVFVDRRVENLDVFSVITDNTHSTSMAVQSFIERGHQNIAFAVQSLTVSTRIDRLEGYKRALTDAGLKVNPDFIIEASITEMKSKLEKLFSLEVKPTAIFAANDRVFLAVAEFIKEKGIKLGKELELIVFDNIPFAHLLEDPISFISQPASEMGHKAAELLFEQINKENTSPGVFVFPSKLV
>NZ_CP051128.1|WP_168241804.1|1339693_1340335_+|3-hexulose-6-phosphate-synthase
MKIQLALDRMEIAEAIELTRKVEDSIDWIEVGTSLIKEFGVASIKEMKQAFPNKEIVADIKTIDNARYEFELCFDAGADIATVMGVSPLVTIDTCMEVAHRYQKKVMIDLLNTSDQQKRDLRKYKEAIFCEHVSKDQQEELGSQNHGTKPSDFSEFQVAAAGGITLDSIEDLVRSLNPSVVIIGSAITKADNPTAAAAQFKQLILQTEGNRTC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051128_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051128_3

3658809-3658930

Orphan

Consensus_repeat	Method
AAGCTCTCTCCATGAAGGGATCATTCTTTTGTGTTTTTTAGAATG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051128_3

>merge|NZ_CP051128|3|3658809-3658930|CRISPRCasFinder
AAGCTCTCTCCATGAAGGGATCATTCTTTTGTGTTTTTTAGAATGGTCGTTCTCGTATATGGGTCTTTCCTTACTTAAAGCTCTCTCCATGAAGGGATCATTCTTTTGTGCTTTTTAGAATG

>NZ_CP051128|3|3|3658809-3658930|CRISPRCasFinder
AAGCTCTCTCCATGAAGGGATCATTCTTTTGTGTTTTTTAGAATG	GTCGTTCTCGTATATGGGTCTTTCCTTACTTA
AAGCTCTCTCCATGAAGGGATCATTCTTTTGTGCTTTTTAGAATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051128.1\|WP_168243596.1\|3652791_3653133_+\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP051128.1\|WP_168246096.1\|3665304_3666132_+\|nickel-import-ATP-binding-protein-NikD	unknown	unknown	gnl\|CDD\|223521
NZ_CP051128.1\|WP_168243602.1\|3656458_3656704_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168246094.1\|3657793_3657922_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
NZ_CP051128.1\|WP_168243611.1\|3668764_3669697_+\|VCBS-repeat-containing-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168243610.1\|3667063_3668380_+\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240541
NZ_CP051128.1\|WP_168243601.1\|3655665_3656136_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168243597.1\|3653134_3653449_+\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|224987
NZ_CP051128.1\|WP_168243606.1\|3661871_3663497_+\|nickel-ABC-transporter,-nickel/metallophore-periplasmic-binding-protein	unknown	unknown	gnl\|CDD\|173854
NZ_CP051128.1\|WP_168246095.1\|3660543_3661542_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP051128.1\|WP_168243599.1\|3654115_3654976_+\|DUF5050-domain-containing-protein	unknown	unknown	gnl\|CDD\|379846
NZ_CP051128.1\|WP_168243598.1\|3653651_3654020_+\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366664
NZ_CP051128.1\|WP_168243600.1\|3655129_3655426_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168243604.1\|3658098_3658677_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP051128.1\|WP_168243612.1\|3669915_3671484_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224839
NZ_CP051128.1\|WP_168243608.1\|3664455_3665289_+\|nickel-ABC-transporter-permease-subunit-NikC	unknown	unknown	gnl\|CDD\|131837
NZ_CP051128.1\|WP_168243607.1\|3663514_3664459_+\|nickel-ABC-transporter-permease-subunit-NikB	unknown	unknown	gnl\|CDD\|131836
NZ_CP051128.1\|WP_168243605.1\|3659057_3659756_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181335
NZ_CP051128.1\|WP_168243609.1\|3666158_3666968_+\|nickel-import-ATP-binding-protein-NikE	unknown	unknown	gnl\|CDD\|131816
NZ_CP051128.1\|WP_168243603.1\|3657051_3657594_+\|DUF3231-family-protein	unknown	unknown	gnl\|CDD\|371599

Protein	Function_ID	Function_description	E-value
NZ_CP051128.1\|WP_168243596.1\|3652791_3653133_+\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	2.92676e-22
NZ_CP051128.1\|WP_168246096.1\|3665304_3666132_+\|nickel-import-ATP-binding-protein-NikD	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	5.79812e-130
NZ_CP051128.1\|WP_168246094.1\|3657793_3657922_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	3.41031e-16
NZ_CP051128.1\|WP_168243610.1\|3667063_3668380_+\|MATE-family-efflux-transporter	gnl\|CDD\|240541	cd13136, MATE_DinF_like, DinF and similar proteins, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli DinF is a membrane protein that has been found to protect cells against oxidative stress and bile salts. The expression of DinF is regulated as part of the SOS system. It may act by detoxifying oxidizing molecules that have the potential to damage DNA. Some member of this family have been reported to enhance the virulence of plant pathogenic bacteria by enhancing their ability to grow in the presence of toxic compounds. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	5.7303e-134
NZ_CP051128.1\|WP_168243597.1\|3653134_3653449_+\|multidrug-efflux-SMR-transporter	gnl\|CDD\|224987	COG2076, EmrE, Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism].	3.34733e-28
NZ_CP051128.1\|WP_168243606.1\|3661871_3663497_+\|nickel-ABC-transporter,-nickel/metallophore-periplasmic-binding-protein	gnl\|CDD\|173854	cd08489, PBP2_NikA, The substrate-binding component of an ABC-type nickel import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel transport system, which functions in the import of nickel and in the control of chemotactic response away from nickel. The ATP-binding cassette (ABC) type nickel transport system is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, the initial nickel receptor. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP051128.1\|WP_168246095.1\|3660543_3661542_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	9.62031e-107
NZ_CP051128.1\|WP_168243599.1\|3654115_3654976_+\|DUF5050-domain-containing-protein	gnl\|CDD\|379846	pfam16472, DUF5050, Domain of unknown function (DUF5050).	1.49468e-56
NZ_CP051128.1\|WP_168243598.1\|3653651_3654020_+\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|366664	pfam01476, LysM, LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.	1.76176e-13
NZ_CP051128.1\|WP_168243604.1\|3658098_3658677_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.86717e-09
NZ_CP051128.1\|WP_168243612.1\|3669915_3671484_-\|hypothetical-protein	gnl\|CDD\|224839	COG1928, PMT1, Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].	1.04581e-24
NZ_CP051128.1\|WP_168243608.1\|3664455_3665289_+\|nickel-ABC-transporter-permease-subunit-NikC	gnl\|CDD\|131837	TIGR02790, Nickel_transport_system_permease_protein_nikC., nickel ABC transporter, permease subunit NikC. This family consists of the NikC family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikB. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases. [Transport and binding proteins, Cations and iron carrying compounds].	4.48536e-127
NZ_CP051128.1\|WP_168243607.1\|3663514_3664459_+\|nickel-ABC-transporter-permease-subunit-NikB	gnl\|CDD\|131836	TIGR02789, Nickel_transport_system_permease_protein_NikB, nickel ABC transporter, permease subunit NikB. This family consists of the NikB family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikC. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases. [Transport and binding proteins, Cations and iron carrying compounds].	7.1705e-173
NZ_CP051128.1\|WP_168243605.1\|3659057_3659756_+\|SDR-family-oxidoreductase	gnl\|CDD\|181335	PRK08264, PRK08264, SDR family oxidoreductase.	1.45251e-101
NZ_CP051128.1\|WP_168243609.1\|3666158_3666968_+\|nickel-import-ATP-binding-protein-NikE	gnl\|CDD\|131816	TIGR02769, Nickel_import_ATP-binding_protein_NikE, nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. [Transport and binding proteins, Cations and iron carrying compounds].	1.72325e-111
NZ_CP051128.1\|WP_168243603.1\|3657051_3657594_+\|DUF3231-family-protein	gnl\|CDD\|371599	pfam11553, DUF3231, Protein of unknown function (DUF3231). This bacterial family of proteins has no known function.	7.33802e-23

>NZ_CP051128.1|WP_168243604.1|3658098_3658677_+|TetR/AcrR-family-transcriptional-regulator
MARSKEFEENVVLDKAMKLFWAQGYEKTSLTDLVEHMGIHRRSLYDTFGDKHTLFLKAMDRFRDKVSAELTGEVKRSKTAAEALQFIFSFMINGEENSPSGCLMVNSAVELAMRDADVDSKSTESFTLSEQLLKDIILWGQEEGEFTSDYDAGELAEHLHTVCVGLRVMTRTSIPKEKLHRIANLSIKLLDK
>NZ_CP051128.1|WP_168246094.1|3657793_3657922_+|universal-stress-protein
MEENYQLIIMGSRGLGNIKGLLLGSVSQKVSQLSHCPVLIIK
>NZ_CP051128.1|WP_168243603.1|3657051_3657594_+|DUF3231-family-protein
MVNILETVIDAMKSLTVQDEDQPLHVGEVMSCWIYLAGLELAKVSVQSGINTTEDEELKAILEEDMKLGTSQREQLHDFMIKEGIPLPPAPADMPKSDSNSIPLGVKFTDDVIANELSLKIVSLIMRAAGAASESIRTDVGLLFIQFQTEKFAFATRLKHLMRKRGWIKVPPFYVPPGSQ
>NZ_CP051128.1|WP_168243602.1|3656458_3656704_+|hypothetical-protein
MGRDFYAGIFSFIVGVFAIYMFFHATKERFLNSKTYEQIKYITPLPISFNFFLIKILFMIGGLLCLAVGIYGIMGGFLQIN
>NZ_CP051128.1|WP_168243601.1|3655665_3656136_+|hypothetical-protein
MDNKKTFALAMLIVPWLTVPFMGKKSFFRFLPVASFVNLFISVLSVIANKKKWWVNKNPLSPGFVDFTYILGPFFVATLWVFKLTYGNFFKYLITNIVIDAICAYPFGQIWEKVGVFKFKKLNHTIWYFICVSLAIIIYGYQYIVEKSINKNQDAV
>NZ_CP051128.1|WP_168243600.1|3655129_3655426_+|hypothetical-protein
MPYIYEVNGVRNLLFLKYIETYMELGDVLEIYRVPNQHAFEEYKQRMEEEPEPIEVNVGCYTYRTIYGLYQLNSKEWLEELSHRNYITHYGITTFVKY
>NZ_CP051128.1|WP_168243599.1|3654115_3654976_+|DUF5050-domain-containing-protein
MEGLGNTTGNILNSGIVGKENEWLYYNKRQGTALYGTLSKIKTDLTMDTPLMANDDPTYINVLNGWVYYRNGRDNGKIYKIKIDSTERTKLTDDSSTDIMVAGNWIYYANQSDGAKLYKLNVDGTGRIKLNEDQSSAINLIGNWIYYQNVSDGQKPYKVKIDGTEKTKLNDTSAYNIQINGYWIYFRNPADENRIYKMTLDGSNKIKLSDVPTSTFNVSNGWIYYTTVDVPGGDLYKMKLDGTGKTFLNEHFVTNTNIFDDWIYYTRTEKMVYRIKTDGTQKQTLY
>NZ_CP051128.1|WP_168243598.1|3653651_3654020_+|LysM-peptidoglycan-binding-domain-containing-protein
MNRNLNLSYVVQPGDNLYSIALKFNTSVESIVFLNHLVRPIIYIGQTLLIPEPASKKGIEARQLQYKPVTAYTADRPILVNGVDINTGLYPVLNFQPTLLFMFQLPSLAGLGPRLYGMRQIR
>NZ_CP051128.1|WP_168243597.1|3653134_3653449_+|multidrug-efflux-SMR-transporter
MAWVYLILAGVFEVVGVTGMNKVAKDKNLQSYMVLFLGFILSFSFLSLAMKSLPMGISYAVWTGIGTVGGTIIGMLFYGEAKDWRRILFIGMILVAVVGLKITI
>NZ_CP051128.1|WP_168243596.1|3652791_3653133_+|multidrug-efflux-SMR-transporter
MNRNWVLVILAGLIEVLWAIGLKHSSNWLSWTGTVLLLYLSFAILVKAIKSLPVATVYAIFTGIGTAGTVVVEMLVFGEAFSWTKVLFILLLLSGVVGLKLVTTESSKKDGAV
>NZ_CP051128.1|WP_168243605.1|3659057_3659756_+|SDR-family-oxidoreductase
MKISEQVAFVTGANRGFGRHLALELLSRGAKVYAGARNPESIDIPGVIPVKLDITNPQEVAAAAMVAKDVTLLINNAGSSTGASLIDGDLDKIHLEFNTHFFGTLSMVRTFAPILANNGGGSILNILSALSWVSSGTVGAYTAAKAAEWALTNDLRLNLYPQNVRVAGLHVGFMETDMTSSLEVPKSNPEDIAKIAIDGLESDSFEIVADDVSRKIQRDFAGGVSAIYPHLS
>NZ_CP051128.1|WP_168246095.1|3660543_3661542_+|NADP-dependent-oxidoreductase
MRAAQMQKYSKEVRVELNDVKIPEFNSREVLVKVKAAGVNPLDILILNGSIRMISDYDLPLTLGNELSGVIEAVGKDVENFHVGDHIYARLPVNQIGAFAEYAAVNEDAISIMPKNLSFIEAAAVPLTALTAYQALNDVLNAQPNKKLFIPGGTGGLGAMAIPIAKSMGLYVITSGSERGRSRTLSIGADRFINYHEENYANILYDIDYVIDTLGAKEIKAELGILKPQGKLVSLKAVPNYRFAVDNNFPMWKKLLFGLVGARVDFLARKHKNEYHFLFVHANGSQLQRITNLVEKENITPSIDSIYNFNDINKALIKVSTGHSQGKVIVTF
>NZ_CP051128.1|WP_168243606.1|3661871_3663497_+|nickel-ABC-transporter,-nickel/metallophore-periplasmic-binding-protein
MSYAINSRNILLTLIFILLLSSVLLGCTNASDKDATSENEKDNMLTIAWARDVGEMNPHVYNPSQLFAQSMVYEPLVSYGVGGELKPHLAKSWEISEDGKVYTFHLRQDVKFSDGTSFNAEIVKKNFDTILSHMELHSWLGFLSKIENMEVIDDNTFKMTLTEAYYPTIQELAVVRPVRFLGEAGFPENGDTSKGIVKPVGTGPWILEEYKADEYAIFKRNENYWGELPKVEKIQVKVIPDAETRVLAFEKGELDLIYGEGVISLDAFKQLESTDKYETSISEPVATRQLVMNTNREQLSDERVRQALHYGFNKEAMVKGITSGLEEAADFILPTNLPYTSEINVTKIGYDVKKAEALLDEAGWTLPKGKTVREKNGQPLEIEMMYDSAESIQKAMAETLQSEWAAIGVKLNIVGVELAVQVQRFKDNKFDINFFSNYGAPYDPHTFINIVAKEGFGFNEAISAYPNKEELLQQMALVPQTTDENERQQLYTSILTSLQDQGAILPISYIKKTAIYQKDVKNFNFSANRDENPFTGIIIEQ
>NZ_CP051128.1|WP_168243607.1|3663514_3664459_+|nickel-ABC-transporter-permease-subunit-NikB
MGNYIIKRIMSIIPVFLLAALLTTGMIHFSPVDPAEAYLTAAHIEPTDEILAQKRHEFGLDQPFFIQYVNTIMKICQLDFGISYVSNKPVWDEVIYRIPATLQLALGSLFIAVLVSVPLGFLAGVKKNSSIDHFSRILSFFGASIPSFWLGYLLIFFFSVKLDLFPVEGFGTWQHLVLPSITLALPLIAMYTRLLRASILENLQEPYVLFARTRGIKEKTIMAKHVLRIAISPMITGLGMNLGKLLTGTIIVETVFSWPGFGRYFIEAIFNRDIPIIQCYVLIAASLFIISNLIVDLIQMFIDPRISRKEGQQR
>NZ_CP051128.1|WP_168243608.1|3664455_3665289_+|nickel-ABC-transporter-permease-subunit-NikC
MITSIRRIFISQKVIPICTIVLGILFIITLLAPWIAPNDPIAVNIAYKLQPPSWEYPLGTDHLGRCNLSRLLYGGRISLGFAMLIFISSLTIGLMIGTFSGYKGGWVDQVLMRFCDGVMAFPSLILILGLVGIFGPGLSQVILALMLVQWVYYARMFRGMVLSLKEQNFIAAAKISGSSQWKIIKNHIVPNVLPPLVVMGTLEMGWAIMDISAMSFLGLGVQPPTPEWGAMIHEGKSYIRTNPELMLFPGLMIMLVIVTFNLLGEALSERYGVKRRS
>NZ_CP051128.1|WP_168246096.1|3665304_3666132_+|nickel-import-ATP-binding-protein-NikD
MGTEQSNVLQVRDLHVQVKTKTGAATLVEDINFELKRGEVLGLVGESGCGKTVTSMSILQLLNRKTTTIEGSIVLKGRELNGLREKEMRMIRGKDIAFIMQNPMNAFTPVFTIGHQFIETIRSHTQWNKKQATELAIEAMHHVNLPDPVKLLKSYPFQLSGGMLQRVMIAIAACLHPAVIIADEPTTALDVNNQKKVLYHLDKIRSEYGSAILLISHDLGVISEMADEVAVMQNGRIVEKAGVFQLFDEPQHEYTKKLLNARSIVHLDEPVIHLA
>NZ_CP051128.1|WP_168243609.1|3666158_3666968_+|nickel-import-ATP-binding-protein-NikE
MSLLQVNEVTHSFGSPTFFNWKDRSKKILSDISLSIEEGTCLGLLGTSGAGKSTLGRVILGLERPQCGQVLFQGHDIYTADKHSRQKIRRDLQAVFQDSYSSVNPRMTAERIIAEPLENYEKLTVAEQKRTVIELLERVGLSEKDLKKYPNQFSGGQLQRINIARAISLKPKMIVLDESVSSLDMVNQTLILGLLKELKADFGLSYLFITHDIKAAYTISDKLGVLEKGKLVELYDEKKQFFTSEHPVVNEMRDSMLAEHPRFRSVRRT
>NZ_CP051128.1|WP_168243610.1|3667063_3668380_+|MATE-family-efflux-transporter
MNHRAYLTLAIPLTISTMTTPLLGAVDTAVVGQLPDPAYIGGVAVGTLIFNTLYWVFGFLRVSTSAFAAQANGASDQAQGVLALSRPFLLAVVVGVCFILLQWPIQYVALILFSNDSDVSQFAAEYFRIRIWGAPFTLLNYVILGWLMGMAKIKESLCLQVLMNVLNMILAILFVHVFSFAVKGVAAAALIAEVTAFILGMFIVMKASPFKWMLPSFQVLIDTQSMKKMFNVNKDLFIRTICLLVVFNMFTAKGASFGTNFLAANAVLFQIHYIMAYFFEGFANATSILVGKAVGANDKDLYKKTLTLSKQWSVITAFVIACIYGLFQKQIIALFTNLPSVIELSTTYGTWLILYPFAACFGLVIYGAFTGATEIAPVRNSMIYAMIVYILIQITATPIWHNHGLWLAFILYTFGRSGFLIMYTPRLNKRLLSINKGI
>NZ_CP051128.1|WP_168243611.1|3668764_3669697_+|VCBS-repeat-containing-protein
MDTIDFNKELHHYYTKIRETNHPYYWYCLAKTQARAGLTIEALQTIDMALSFPNPYPSKHKLFEIRAGLQSADSRQIYTNSPSIVTVKRGDIDGDGIKDNVYLTAYKTPDSPFWKDITLVVQNGRTHQYDHIHFKNNSGYTPTLFLGDLTGNKGEDILVVIDTGGSGGTVYSYIFSYMNGQIMQIFDSDAFNDSYKYDVTYENQYKAKVISYHLREKYILELTYKGKEYLSEIYNPQGILKAPINGWVNPLSGLYPIDFNRDNRYELEAYQRIAGRYNADSLGYVQTVLKWNGQEFVPDRQTVAIFGGEL
>NZ_CP051128.1|WP_168243612.1|3669915_3671484_-|hypothetical-protein
MTNQLQPGQELLANQQITANNERAFLIMQGDGNFVLYEIHKGQHIPVWASGTNGSGAVKAIMRDNGSLVVCKENGQEVWSSTGTEWNAGAYLILQDDGNAVIYTNQGKALWDSGTWRHFRKLGFDPAVHGFLFPNKFVNSIANIPGYGQVTTQGRCGGMAFAALDYFLKGIPVPKYTGNLFNAQVPPDGHWLADYIYSRLMDSFLVPSSIKYVHWTLASDHSTVFGGKGVTRWTKEEEFPKLRSLIDAGRPVVLGLIDATNLGEIGSKNHQVLAYGYEWHSKADIMKVFVYDNNTIRSEVVLSSERGNPHFDATNTDPWRGFFVIDYQQKTPPVFTSKPPAANDTVRYGQTIKVGHLWTGLKLHSHALNYGHSGSSGQQQVTCFKGADDNDLWRIKGPNGTQANHRNGEVVRHGDVIRLEHVLTQRNLHSHYGHPSPVTGQQEVTCFGSGGQGDDNDNWRVEVEGGGQWSAERRVRLVHLNTNHTLHSHRGHSHPQWTAGQQEVTGFDGRDDNDWWWLLEIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051128_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051128_4

5045060-5045138

Orphan

Consensus_repeat	Method
CAAAATTTGTCCTCATGGTGTGTTCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051128_4

>merge|NZ_CP051128|4|5045060-5045138|CRISPRCasFinder
CAAAATTTGTCCTCATGGTGTGTTCATGAGGACAGAAATGCTAAGCAAAATTCAAAATTTGTCCTCATGGTGTATTCAT

>NZ_CP051128|4|4|5045060-5045138|CRISPRCasFinder
CAAAATTTGTCCTCATGGTGTGTTCAT	GAGGACAGAAATGCTAAGCAAAATT
CAAAATTTGTCCTCATGGTGTATTCAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051128.1\|WP_168244678.1\|5055486_5056548_-\|DUF2515-domain-containing-protein	unknown	unknown	gnl\|CDD\|371209
NZ_CP051128.1\|WP_168244670.1\|5036229_5037573_-\|3'-terminal-RNA-ribose-2'-O-methyltransferase-Hen1	unknown	unknown	gnl\|CDD\|274962
NZ_CP051128.1\|WP_168244675.1\|5051754_5052525_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
NZ_CP051128.1\|WP_088088526.1\|5054423_5054864_-\|peptidylprolyl-isomerase	unknown	unknown	gnl\|CDD\|223725
NZ_CP051128.1\|WP_168244676.1\|5052632_5053385_-\|exodeoxyribonuclease-III	unknown	unknown	gnl\|CDD\|197321
NZ_CP051128.1\|WP_168244682.1\|5059887_5061213_-\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|188097
NZ_CP051128.1\|WP_168244680.1\|5058609_5059116_-\|mismatch-specific-DNA-glycosylase	unknown	unknown	gnl\|CDD\|381679
NZ_CP051128.1\|WP_168244672.1\|5040344_5040536_-\|YbxH-family-protein	unknown	unknown	gnl\|CDD\|375142
NZ_CP051128.1\|WP_168244671.1\|5037692_5040266_-\|RNA-helicase	unknown	unknown	gnl\|CDD\|350671
NZ_CP051128.1\|WP_168244668.1\|5032261_5033536_-\|LysM-peptidoglycan-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|119353
NZ_CP051128.1\|WP_168244677.1\|5053529_5054330_-\|divergent-polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|377404
NZ_CP051128.1\|WP_168244674.1\|5044154_5044802_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|341387
NZ_CP051128.1\|WP_168244667.1\|5028855_5029578_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168246207.1\|5030526_5031915_-\|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase	unknown	unknown	gnl\|CDD\|334815
NZ_CP051128.1\|WP_168244681.1\|5059188_5059764_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|376838
NZ_CP051128.1\|WP_168246208.1\|5055107_5055464_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051128.1\|WP_168244669.1\|5033635_5036233_-\|polynucleotide-kinase-phosphatase	unknown	unknown	gnl\|CDD\|274963
NZ_CP051128.1\|WP_098935093.1\|5043321_5044137_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|377080
NZ_CP051128.1\|WP_168244679.1\|5056698_5058564_+\|squalene--hopene-cyclase	unknown	unknown	gnl\|CDD\|239222
NZ_CP051128.1\|WP_168244673.1\|5040649_5043319_-\|pyruvate,-phosphate-dikinase	unknown	unknown	gnl\|CDD\|236446

Protein	Function_ID	Function_description	E-value
NZ_CP051128.1\|WP_168244670.1\|5036229_5037573_-\|3'-terminal-RNA-ribose-2'-O-methyltransferase-Hen1	gnl\|CDD\|274962	TIGR04074, Methyltransferase_type_12, 3' terminal RNA ribose 2'-O-methyltransferase Hen1. Members of this protein family are bacterial Hen1, a 3' terminal RNA ribose 2'-O-methyltransferase that acts in bacterial RNA repair. All members of the seed alignment belong to a cassette with the RNA repair enzyme polynucleotide kinase-phosphatase (Pnkp). Chemically similar Hen1 in eukaryotes acts instead on small regulatory RNAs. [Transcription, RNA processing, Protein synthesis, tRNA and rRNA base modification].	5.87035e-97
NZ_CP051128.1\|WP_168244675.1\|5051754_5052525_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.45336e-26
NZ_CP051128.1\|WP_088088526.1\|5054423_5054864_-\|peptidylprolyl-isomerase	gnl\|CDD\|223725	COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones].	1.97877e-60
NZ_CP051128.1\|WP_168244676.1\|5052632_5053385_-\|exodeoxyribonuclease-III	gnl\|CDD\|197321	cd09087, Ape1-like_AP-endo, Human Ape1-like subfamily of the ExoIII family apurinic/apyrimidinic (AP) endonucleases. This subfamily includes human Ape1 (also known as Apex, Hap1, or Ref-1) and related proteins. These are Escherichia coli exonuclease III (ExoIII)-like AP endonucleases and they belong to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. AP endonucleases participate in the DNA base excision repair (BER) pathway. AP sites are one of the most common lesions in cellular DNA. During BER, the damaged DNA is first recognized by DNA glycosylase. AP endonucleases then catalyze the hydrolytic cleavage of the phosphodiester bond 5' to the AP site, and this is followed by the coordinated actions of DNA polymerase, deoxyribose phosphatase, and DNA ligase. If left unrepaired, AP sites block DNA replication, and have both mutagenic and cytotoxic effects. AP endonucleases can carry out a variety of excision and incision reactions on DNA, including 3'-5' exonuclease, 3'-deoxyribose phosphodiesterase, 3'-phosphatase, and occasionally, nonspecific DNase activities. Different AP endonuclease enzymes catalyze the different reactions with different efficiences. Many organisms have two AP endonucleases, usually one is the dominant AP endonuclease, the other has weak AP endonuclease activity; for example, Ape1 and Ape2 in humans. Ape1 is found in this subfamily, it exhibits strong AP-endonuclease activity but shows weak 3'-5' exonuclease and 3'-phosphodiesterase activities. Class II AP endonucleases have been classified into two families, designated ExoIII and EndoIV, based on their homology to the Escherichia coli enzymes exonuclease III (ExoIII) and endonuclease IV (EndoIV). This subfamily belongs to the ExoIII family; the EndoIV family belongs to a different superfamily.	2.41324e-155
NZ_CP051128.1\|WP_168244682.1\|5059887_5061213_-\|sodium:proton-antiporter	gnl\|CDD\|188097	TIGR00931, Uncharacterized_Na+/H+_antiporter_HI_1107, Na+/H+ antiporter NhaC. A single member of the NhaC family, a protein from Bacillus firmus, has been functionally characterized.It is involved in pH homeostasis and sodium extrusion. Members of the NhaC family are found in both Gram-negative bacteria and Gram-positive bacteria. Intriguingly, archaeal homolog ArcD (just outside boundaries of family) has been identified as an arginine/ornithine antiporter. [Transport and binding proteins, Cations and iron carrying compounds].	3.21231e-36
NZ_CP051128.1\|WP_168244680.1\|5058609_5059116_-\|mismatch-specific-DNA-glycosylase	gnl\|CDD\|381679	cd10028, UDG-F2_TDG_MUG, Uracil DNA glycosylase family 2, includes thymine DNA glycosylase, mismatch-specific uracil DNA glycosylase and similar proteins. Uracil DNA glycosylase family 2 consists of thymine DNA glycosylase (TDG), which removes uracil and thymine from G:U and G:T mismatches in double-stranded DNA. It includes mismatch-specific uracil DNA glycosylase (MUG), the prokaryotic homolog of TDG. Escherichia coli MUG is highly specific to G:U mismatches but also repairs G:T mismatches at high enzyme concentration. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil in DNA can arise as a result of misincorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations. Thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other..	7.96657e-81
NZ_CP051128.1\|WP_168244672.1\|5040344_5040536_-\|YbxH-family-protein	gnl\|CDD\|375142	pfam17340, DUF5370, Family of unknown function (DUF5370). This is a family of unknown function found in Bacillaceae.	2.50426e-34
NZ_CP051128.1\|WP_168244671.1\|5037692_5040266_-\|RNA-helicase	gnl\|CDD\|350671	cd17913, DEXQc_Suv3, DEXQ-box helicase domain of Suv3. Suppressor of var1 3-like protein (Suv3) is a DNA/RNA unwinding enzyme belonging to the class of DexH-box helicases. It localizes predominantly in the mitochondria, where it forms an RNA-degrading complex called mitochondrial degradosome (mtEXO) with exonuclease PNP (polynucleotide phosphorylase), that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. Suv3 plays a role in the RNA surveillance system in mitochondria; it regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. It also confers salinity and drought stress tolerance by maintaining both photosynthesis and antioxidant machinery, probably via an increase in plant hormone levels such as gibberellic acid (GA3), the cytokinin zeatin (Z), and indole-3-acetic acid (IAA). Suv3 is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	1.40528e-56
NZ_CP051128.1\|WP_168244668.1\|5032261_5033536_-\|LysM-peptidoglycan-binding-domain-containing-protein	gnl\|CDD\|119353	cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.	5.67521e-98
NZ_CP051128.1\|WP_168244678.1\|5055486_5056548_-\|DUF2515-domain-containing-protein	gnl\|CDD\|371209	pfam10720, DUF2515, Protein of unknown function (DUF2515). This family is conserved in Firmicutes. Several members are annotated as YppC. The function is not known.	1.96731e-146
NZ_CP051128.1\|WP_168244674.1\|5044154_5044802_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|341387	cd04617, CBS_pair_CcpN, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains of CcpN repressor. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.94187e-64
NZ_CP051128.1\|WP_168244677.1\|5053529_5054330_-\|divergent-polysaccharide-deacetylase-family-protein	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	3.19488e-87
NZ_CP051128.1\|WP_168246207.1\|5030526_5031915_-\|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase	gnl\|CDD\|334815	pfam02113, Peptidase_S13, D-Ala-D-Ala carboxypeptidase 3 (S13) family.	5.80786e-145
NZ_CP051128.1\|WP_168244681.1\|5059188_5059764_-\|YitT-family-protein	gnl\|CDD\|376838	pfam02588, YitT_membrane, Uncharacterized 5xTM membrane BCR, YitT family COG1284. This is probably a bacterial ABC transporter permease (personal obs:Yeats C).	3.48608e-20
NZ_CP051128.1\|WP_168244669.1\|5033635_5036233_-\|polynucleotide-kinase-phosphatase	gnl\|CDD\|274963	TIGR04075, Ser/Thr_phosphatase_family_protein, polynucleotide kinase-phosphatase. Members of this protein family are the bacterial polynucleotide kinase-phosphatase (Pnkp) whose genes occur paired with genes for the 3' terminal RNA ribose 2'-O-methyltransferase Hen1. All members of the seed alignment belong to a cassette with the Hen1. The pair acts in bacterial RNA repair. This enzyme performs end-healing reactions on broken RNA, preparing from the RNA ligase to close the break. The working hypothesis is that the combination of Pnkp (RNA repair) and Hen1 (RNA modification) serves to first repair RNA damage from ribotoxins and then perform a modification that prevents the damage from recurring. [Transcription, RNA processing].	0
NZ_CP051128.1\|WP_098935093.1\|5043321_5044137_-\|kinase/pyrophosphorylase	gnl\|CDD\|377080	pfam03618, Kinase-PPPase, Kinase/pyrophosphorylase. This family of regulatory proteins has ADP-dependent kinase and inorganic phosphate-dependent pyrophosphorylase activity.	2.88418e-149
NZ_CP051128.1\|WP_168244679.1\|5056698_5058564_+\|squalene--hopene-cyclase	gnl\|CDD\|239222	cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.	1.91545e-151
NZ_CP051128.1\|WP_168244673.1\|5040649_5043319_-\|pyruvate,-phosphate-dikinase	gnl\|CDD\|236446	PRK09279, PRK09279, pyruvate phosphate dikinase; Provisional.	0

>NZ_CP051128.1|WP_168244674.1|5044154_5044802_-|helix-turn-helix-transcriptional-regulator
MVIIKLSKRQDEILQIVKQNGPITGKDIAEKLSLTRAALRPDLAILTMSGNLDARPRVGYFYNESFEAKQQAKRFIHQKVTDYKAHPIVVEKSTSVYDAIVQLFLEDVGTLYAVDTKGNLAGVVSRKDLLRASLGNQNLNELPVSVIMTRMPNIITINPEETLLEAAKKMIHNRIDSLPVVKEIEEQKSTYLLVGRITKTTITRAYLEIMENNSN
>NZ_CP051128.1|WP_098935093.1|5043321_5044137_-|kinase/pyrophosphorylase
MVQKEVVYVVSDSVGETAEFVVKAVATQFNGGQVEIRRNSYVDDFEDIEDIILLAKKGRTIIAYTIVIPSLKEYLDRRAKEESIFAVDLLSPLMNAFETSFNKQPHHRPGLMRKLDEEYFRKIEAIEFAVKYDDGRDPRGIIKADIVLVGISRTSKTPLSMYLAHKRFKVANVPLVPEVPPPDELFEIPRKNCIGLIISPDKLNEIRKERLKALGLASQANYASFGRILEELDHAEKVMKRLGCPVIDVSNKAVEETAGLILDVLKKERSY
>NZ_CP051128.1|WP_168244673.1|5040649_5043319_-|pyruvate,-phosphate-dikinase
MEKFVYLFHEGNGNMKGLLGGKGANLAEMTRIGLPVPYGFTITTQACNAFYEASKTIPTFVEVQTLEALTRLEEKMGKKLGDPKNPLLVSVRSGSVFSMPGMMDTILNLGMNDETVIGVAELTNNPRFAYDSYRRFIQMFSNVVLDIDTYYFEQLLEEIREEKGYSSDPEMSADDWKEVIIGYKGIVKKHKRKDFPQDPKEQLFLAIHAVFNSWNNQRAIVYRRLNKIADHLGTAVNIQSMVFGNMGNDSGTGVAFTRNPSTGEHVLYGEYLINAQGEDVVAGIRTPQPIATLKDEMPGVYKQFTDTCKRLEQHYEEMQDIEFTVEGGKLFILQTRNGKRTAQAAIRIAVEMVEEGIIDKKTALLRVDPEQLDQLLHRRIDDKFEKRVLAKGLPASPGAATGQVVFNADEAEQLNNDGKKVILVRPETTPDDIHGIVASQAILTSRGGMTSHAAVVARGMGKACICGCEALKIDLKAKQFTIGETVINYGDIITIDGSTGEIMLGEIPMIDPELSDEFQMLLAWADQERKLGVRANADNPEDAKKAFEFGAGGIGLCRTEHMFMDLKRIPTVQKMILAETYNERMEALNQLLPMQQGDFEGIFEAMQGLPVTIRLLDPPLHEFLPDKEELLVEVTKLQILDPQSPELKKKEQLLKKVRQLDEFNPMLGHRGCRLGMIYPEIYEMQAKAIFYAAAKLADKGIEVQPEIMIPLVGHVNELKDMRKLVIDAALLVQEETGKSFKYTIGTMIEIPRAALTADKIAEEADFFSFGTNDLTQTTFGYSRDDAEGKFLQAYIENKVLPENPFAVLDQDGVGKLVETGVKLGRGTKPSLKTGICGEHGGEKSSIEFCYKTGLDYVSCSPYRVPLARLAAAQATIRHEQNKQEVFTTA
>NZ_CP051128.1|WP_168244672.1|5040344_5040536_-|YbxH-family-protein
MGAIERSGYRFVPEFSVIQQNGAIHVYNQDNFIEEIKFHFSGKFPELDQIEDLVDQYCSQHQL
>NZ_CP051128.1|WP_168244671.1|5037692_5040266_-|RNA-helicase
MNKLTTIYPQAIEHTKLKVYEDINHYFETKETLPTIEQYLTDRSHYVEQIWTNVWLNKSTNDVPRNEKKQYLTDKGFEVQGIDKKLINKLFRDEMRTYHVFDTMGWVHETFLGKEQEWEKQYQEAKVNFIKREEQKQLEEQKQLIRSEIEDAAVGILEEQYELFYLYVRYFVAIQLVADLQNNVKFQSVDTFALEEKLVDEGHFNPSAYTTVATFFEELTGDIHKTLNWGRSFYEYQTYFFVYESLIADYLSELIPEKILEQLSEKLKDDFHETFLEKLSASFVKGSIAQVLYDVEGYFIEDIQAEYLSDLIRLAEIPFDAMVHKEIFEKDFQAREQKQKEAQEELGRKKAEEERMMKEIFATEYDPSLQRQVRYVLHIGETNTGKTHHALERMKDAYSGLYLAPLRLLALEVFDKLNAEGTPCSLKTGEEEKITPGANHTSCTVEMFHEKEFFEIIVIDEAQMITDKDRGFSWYKAITKANAEEVHIIGSRNSKTMLLQLLGNSNIEVHEYSRDTPLEVETKEFHIKHIKKGDALICFSRRRVLETASRLQNDGHTVSMIYGSMPPETRKKQIQQFNTGKTKVIVATDAIGMGLNLPIRRIVFLENDKFDGTRRRLLTSQEVKQIAGRAGRKGIYNIGKVAFTSDIRKMRNLLLQEDEPVHTFAIAPTNSVFERFQRYYHDLGTFFELWGKFESPTGTKKASLAEEKSLYQMVAGTEIEARLSLMDLYGFLHLPFSKNEPVLTKQWEEKMYAIIHGSELPEPIVKERSLEELELSYKAIGLHLLFLYRLGERTTAIYWERLREEVSDKVQDRLKTDINKFVKKCKTCGKKLPWDHSFPTCEACYAAKTRRYRYDEY
>NZ_CP051128.1|WP_168244670.1|5036229_5037573_-|3'-terminal-RNA-ribose-2'-O-methyltransferase-Hen1
MQLSLTVRGPGVEAVSYLIAKNPNNLYERGEKGLTVRLVYPIFSSEEVQFLIYVKTDPIDLVKNSPDSFDITHYINDREFAASSIFVSSIRKALGTALNGKPAEEYASWVEHSFEMELTFGPIATDLSIRELESLFAPMGYTIKMEYGESFIRDKSSARFITLFGKQTLQNAFKHISILIPVIDNYKHYFIDEKELEKLDRYGEGWLEEHPQKALILKRSLRFQKVISQSRFYEKETKIDEKHEPPKIRLNDLRYEAIIKYIEDLPKKATIVDFGAGEGKLSVQFGFIKGVQEILSVEPSNKARLKALERFDYAKAKRGFVEPKSLAGSLFYYDERLSNKDVMVLCEVIEHIDEYRLTRVFETIFKDYRPEVLIVTTPNQEYNAVYDMNEEMRHHDHRFEWTRAQLHQKVEDLTKIYPYQVSYKGIGEENQLYGHPTQMVIFRREEG
>NZ_CP051128.1|WP_168244669.1|5033635_5036233_-|polynucleotide-kinase-phosphatase
MMAKINLPHAGIVLLVGPSNSGKTTLINQLMQEQQIYASEVVSSDQFRVLVSDVEFIDWNRRPKYEADALFNEYQQISKEAFEAMDYIIAKRCRLNKLTFIDATHLRDYEREKYLQMAKRYHVPAIAIVLNLAETELLRRDLERDFPRGKNRIKQQYQHFKKTLRSIKKEGFRRCYIFGEEELQVLNVNRLGNPLLIDVGNGIDFIGDIHGCFEEFSEILLKLGYIENEEGYFIHPEGRKILSLGDVMSRGPRSIETLQFFQKHVAAGLAYMIDSNHGWKIARWLNGKNVKLAHGDENVKAEFDEYEGKFGKDEADRLKEQIRDMLLEAKSHYIIQKNGVNVAVAVHAGIKDHYIGKQSPRISDFCRYGDSDGFDENGKPVRKDWSIAHQSSELILWGHDPRTQPLLVNNTLNIDQGVVFGGNLTAYCFPERKFVSVKAKADYANVSDNPLKVLESKRLAPPNIAKFLEGYSVLTELYGEIAIYADSTKSALDDLSHYTLPLEEIVYLPPTMSPTPKPSSLAGYLEHPIEAFEYYQANGVDTMVVEKKHMGSRGILFLFKNKETAKEYIGRETLGLIYTRTGRAFFKKELEEQILQVLNIDLNGYFEKNNTDFILMDAEILPWNLKAKELIMNQYAHVGEMALLDRSKLQEQLKKALDNGKDVSSWLEETDEKILNAQVFNEVYQKYCWETEGLAGIQIAPFHTLAHSNETFFDKPHTWHMEKNKEFSVLSDLFVETEYRIVNNEDSMKSAIEWWEEMTEDGHEGFVVKPESYVARHKGKLLQPAIKVRGRKYLHIIYGIDYLQPENLSRLKRRNAGKKQRNALKEFVLGVEAVNRFVRRESLERYHECVLGVLALESDPIDPRL
>NZ_CP051128.1|WP_168244668.1|5032261_5033536_-|LysM-peptidoglycan-binding-domain-containing-protein
MAVHVVIAGENLWAISTRYGVSIQTIVELNGLPSANSIVPGLALYLPDILPPLRYYQIKAGDHIWQLAQQFRVDPSVILAANPGINPNLLVIGQIINIPSPIRLSLETLGFLVPSSESANLATINSLANQLTYLAIVAYSFTEEGYAFNVSEDAALVARSNQLKIIPLLMVRNLAGNDFSAELAGRVLENPTYRGNLVASLVNLTRQRGFGGVSIDFEFIPPARRNDFNLFLTELKRSLDGLILQVNVHAKTADIPTNRIIGAYDYASIGNVADIVAVMTMDYGYPGGPPNPIAPIPWLEQVIQYSVTQINSRKLQIAVALYGYDKVVGTNATQAFSVLAAQNKAISLPENIEFDITASAPWFRYWQGNEEHVVWFEDIRSFIEKYRLIDMYQLAGTTFWQISLPAPQNWDYLSKNINVVKKNV
>NZ_CP051128.1|WP_168246207.1|5030526_5031915_-|D-alanyl-D-alanine-carboxypeptidase/D-alanyl-D-alanine-endopeptidase
MYGYENMTQQINQLISNEPALKGAIAGISIRTATDGKIIYAHQGDVRLRPASNMKLLTAAAALTILGEDHTFTTELHTDGTAKKKTLNGNLYLKGKGDPTLLKSDFDKMAEDIQKRGIKKIKGNLVGDDSWYDNVRYSLDLPWSDETTHYGAQISALTASPTRDFDAGSVKVLVQPGTKKGDKPIVKITPKTFYLKINNHAVTVPEDGKKDITIEREHARNIITIEGTIPTKAKTEKEWIGVWEPTRYAVSLLNQSLTEHGIQVTGKLKTGLVPDTARILTTHQSMPLSELLVPFMKLSNNVHAEILIKEMGRVVKGEGSWEKGLSVLKNEITKFEVNPKTLVLRDGSGVSHVDLIPANQLTQLLFAVQKEKWFPSYLHSLPVAGESEKMVGGTLRNRMKDSLVRGKVYAKTGTISTVSSISGYVKTKSGQTLIFSILLNNLMEDSKGKKVEDKMITILANQ
>NZ_CP051128.1|WP_168244667.1|5028855_5029578_+|hypothetical-protein
MSLEWFDRVCGELQEHLESICEEYDQVGQMTVERAAKHPRIEFYVDTADVDTEELERDYFCSLFFDPQNEEFYIDTFDVDSGHTAKVILSDIEDLIEEVHASLHDYMNGDDHYTDDGVYLQTSEVFDDDEVETVYVEDDEEEEYYEAEQVNSDDIFEEIDVDWSTPEVTAFKHEDEVEVTYQFGLVQATGDGVLKRVNRIWTTDDELIKDESHFIFSKEEATTIIAMIASHMDQLSEFEF
>NZ_CP051128.1|WP_168244675.1|5051754_5052525_-|class-I-SAM-dependent-methyltransferase
MDIKKDVQQQFGKSADSYVSSTIHKDGNDLQKLLEMAMTTGEEELLDVATGGGHAANAFASCVKKVTAFDLTPEMLAAAQKYILGNGHQNVEFIIGDAEVLPFSEGVFDIVTCRIAPHHFPNVNKFVDEVHRVLKPSGQFLLDDNVVPEEEDYDLFYNTIEKWRDYSHFRAWKKSEWLRMLEISGFEIFEWHRFEKTFHYEPWCNRMNLPEDEKDKLTQFILSASPKVKEKFKIIIRDNQIISFVGEAVLLRAIKR
>NZ_CP051128.1|WP_168244676.1|5052632_5053385_-|exodeoxyribonuclease-III
MKLVSWNVNGLRACVKKGFLDYFDEMDADIFCVQETKLQEGQISLELAGYHQYWNYAIKKGYSGTAVFTKNKPLSVRYGVGTDETEGEGRILTLEFDDFFLVNVYTPNSQRDLARINYRLDWEDRILLHLKDLDKLKPVVLCGDLNVAHQEIDLRNPKSNNGNSGFTEEERGKMTSLLAEGFVDSYRHFNPEQEGAYTWWSYMAKVREKNIGWRIDYFIVSERLRERLKNVDIHCNVMGSDHCPVILEMD
>NZ_CP051128.1|WP_168244677.1|5053529_5054330_-|divergent-polysaccharide-deacetylase-family-protein
MKKFIYMLIPFMVFTFQQPTSAEKNGPKELKAAIIIDDFGGGTGGVRDFLEGEIPITAAVMPFTEHSTEHAEWAHKYGIEVMIHLSMEPKRGKRSWLGPRPITNDLSPAEVRQIVEDAIKDVPYAVGINNHMGSLAVENKEIVRAIVEVAKERRLFIIDSATSPNSKFPEIAKELGVPILKRDVFLDDISSSAHVRKQMIRLAKVTEIKGTGIAIGHVGITGKVCSIGVFQAMDEFNKRNIKVVPVSKLFSGKLPEKYFIPYKKGR
>NZ_CP051128.1|WP_088088526.1|5054423_5054864_-|peptidylprolyl-isomerase
MAKKGHFLMENGEKIEFDLYPEAAPGTVENFESLVNKGFYNGLTFHRVIPGFVSQGGCPEGRGTGGPGYTIKCETEGNPHKHVPGALSMAHAGKNTGGSQFFIVHESQPHLNGVHTVFGQVTSGLETAKSMRNGDKMVEVKVYDQE
>NZ_CP051128.1|WP_168246208.1|5055107_5055464_-|hypothetical-protein
MASLFATYLDLFFVGKHIYRFPVRPLPTIFSINIVFTLVVLPVLVFVFLRMMNQVNKWGKVGLILFISLLMPILEKLTEVFGWFDHTENWSHLYTFFGYLLFLTILYSFYTWMAIRKG
>NZ_CP051128.1|WP_168244678.1|5055486_5056548_-|DUF2515-domain-containing-protein
MKGKQSSLPPKITRGEASLLEQIKTETKEHNLNNVTRTKAYLDFYLHFPKIHWAFLGHMVSRNGGWNMTDLKGDFLTRLVSKKERETFFAFLERGNWLIFQDVYPQFLLYRESLKQHKPLFHLSSYLNISTFMETIWNHFWLHQETYILAIALIINEQSYLEKRVVQNPLYQKGVLNKFEFILQDLLSFNHILFPYGKRNLAGQTLHRFESLNERILLGKRLYDVLFKNKERFKLVLEWAKTHPHTGSRKDYWPHIFNNINEGIPGFAYQTRLKACQLRPRARKIYSPALEYAWKNVSQTEAEKGDWFEDDRVVDYLMDDNEKIDGEIKNEYCKTLERLELAAIAKKAISILD
>NZ_CP051128.1|WP_168244679.1|5056698_5058564_+|squalene--hopene-cyclase
MSNTKKGIDWIIKKLRKDQSPDGSWNYPFETGQSTDAYMIILLRTLELNDEELIQGLVSRILSKQGENGAWKLYYDEDEGNLSSTVEAYYALLYSGYVKKDDKRLRAAKRFIVSKGGLEEVSIFTKVMLSLTGQYIWPDFSPLPVESLLLPHYFPINFYSFSVFGRANLTPIILLADKKFFIKTKKSPNLSELHLHRNQDKPWFRSAEYRSLLSFIEEGVKRLMGLPEQLHQLAIERAKKYMLDHLEPDGTFYSYYSSTFLMIFALLSLGYKKTDPVISKAVKGLIAMKCDINGSPHMQYTTANVWNTSLIGYALQSAGVLADDPMVMKANRYLLDHQQHKFGDWVIHNPKTMPGGWGFSDVNTMNPDVDDTTASLRSISRIVPHERHAWDRGLSWLLSMQNDDGGWAAFEKNINTKLFEFLPIEKGEFLLTDPSCADITGRTLEFLGNYTNLSRDHKAINKGVNWLLKNQLKDGSWYGRWGICYLYGTWGAVTGLLAAGVPTSHTAIQKAVNWIQGIQNEDGGWGESCHSDSEKAYVPLRASTLTHTAWALDTLLTTSEKPTTQIRKGISYLIASLEKQDWTTNYPKGQGMAGGFYIHYHSYRYIFPLMAMSHYHKKFES
>NZ_CP051128.1|WP_168244680.1|5058609_5059116_-|mismatch-specific-DNA-glycosylase
MKPISDHLKENLKVLFVGFNPSIRSSELGHHYANPNNRFWRILYEAGLTSRKYDATEDAKLLDLGYGFTNIVQRPTKAADEITKEEYVEGREILKKKVEQLMPQVVCFVGKGVYQQYSGLKVIQWGKQPNGFVPGVVDFVAPSSSGLVRMKMEEIVDIYKGLVPILTQ
>NZ_CP051128.1|WP_168244681.1|5059188_5059764_-|YitT-family-protein
MLKKLAIIGFGSTMIGIGINGFILPLHLINGGFLGISLLLKYIWGFKTGITFIFLNIPVYMFAFKSDPIYFINGVIGALCTGLMIELFVPLNGIFHLPILSSVIVGAVIIGSGVGVMLRNHISPGGMDLLALMIAKWSKVNVGVIMFAMDAVIIITGLFLLQDVKLFYSLIIVAIVGLLASIITTINIERN
>NZ_CP051128.1|WP_168244682.1|5059887_5061213_-|sodium:proton-antiporter
MDINFSLKQVLLLLIVTLTGVVWSVIFHHPLVAGFFPGYLMLVWLVKKKEISIKQILHISILGVNKTKIVILILFLVSFLLPSWYLSGTIQQMVKIALHFIIPNHFFVLSFLSAMVFSMLLGTTVGTLSAIGIPIIGTAIVLHLPVEMVAGALVSGAFVGDRTSPFSSAHQLLSHTVELPVKRQWNAMLVTTLLAIILCFCFYGMADYLISETTASNSQPLSLHEISVIKLIPPIILIVFVLLQFSIIYAFLTSILSASVIALFGGISYTKLVFSLWGGIEGLGGGFLHMYELLLFLALAGAYNGLLEEMNVIQPYLDKWLQSSRSLTGDTLKTLLATFLITLIAANQTLPIILTGRSFLPHWSSNYGKEELARVMGDSTMLFPGIVPWSVLAIMCSTIVGIPIMDYLPFALFLWILPILTILVSLVKQARRSKPTRTAIV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051128_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051128_5

5675403-5675477

Orphan

Consensus_repeat	Method
GGCAAAGCTCGAAAGCTTTGCCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051128_5

>merge|NZ_CP051128|5|5675403-5675477|CRISPRCasFinder
GGCAAAGCTCGAAAGCTTTGCCCTCACCAGGCGTTACCTTCCTGGTAGAAGGCAAAGCTCGAAAGCTTTGCCCTC

>NZ_CP051128|5|5|5675403-5675477|CRISPRCasFinder
GGCAAAGCTCGAAAGCTTTGCCCTC	ACCAGGCGTTACCTTCCTGGTAGAA
GGCAAAGCTCGAAAGCTTTGCCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051128.1\|WP_168245216.1\|5686527_5687820_-\|GTPase-ObgE	unknown	unknown	gnl\|CDD\|237046
NZ_CP051128.1\|WP_168245210.1\|5679621_5680719_-\|quinolinate-synthase-NadA	unknown	unknown	gnl\|CDD\|236489
NZ_CP051128.1\|WP_168246254.1\|5683328_5684477_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|179511
NZ_CP051128.1\|WP_168245200.1\|5667172_5668720_+\|stage-V-sporulation-protein-B	unknown	unknown	gnl\|CDD\|274343
NZ_CP051128.1\|WP_168246253.1\|5669690_5670053_+\|TIGR04086-family-membrane-protein	unknown	unknown	gnl\|CDD\|274969
NZ_CP051128.1\|WP_168245202.1\|5670149_5670443_-\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|235518
NZ_CP051128.1\|WP_168245199.1\|5666737_5667034_-\|post-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379375
NZ_CP051128.1\|WP_168245203.1\|5670472_5671612_-\|tRNA-guanosine(34)-transglycosylase-Tgt	unknown	unknown	gnl\|CDD\|234642
NZ_CP051128.1\|WP_168245212.1\|5681537_5683121_-\|L-aspartate-oxidase	unknown	unknown	gnl\|CDD\|236147
NZ_CP051128.1\|WP_168245214.1\|5685122_5685980_-\|prephenate-dehydratase	unknown	unknown	gnl\|CDD\|237013
NZ_CP051128.1\|WP_168245215.1\|5686038_5686488_-\|ACT-domain-containing-protein	unknown	unknown	gnl\|CDD\|179848
NZ_CP051128.1\|WP_168245209.1\|5676292_5677282_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|223584
NZ_CP051128.1\|WP_168245207.1\|5674765_5675311_-\|regulator	unknown	unknown	gnl\|CDD\|370208
NZ_CP051128.1\|WP_168245213.1\|5684531_5685068_+\|transcription-repressor-NadR	unknown	unknown	gnl\|CDD\|224740
NZ_CP051128.1\|WP_168245201.1\|5668766_5669426_-\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
NZ_CP051128.1\|WP_168245211.1\|5680720_5681569_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	unknown	unknown	gnl\|CDD\|181221
NZ_CP051128.1\|WP_168245204.1\|5671639_5672668_-\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	unknown	unknown	gnl\|CDD\|234666
NZ_CP051128.1\|WP_168245206.1\|5673712_5674324_-\|Holliday-junction-branch-migration-protein-RuvA	unknown	unknown	gnl\|CDD\|234645
NZ_CP051128.1\|WP_168245205.1\|5672697_5673702_-\|Holliday-junction-branch-migration-DNA-helicase-RuvB	unknown	unknown	gnl\|CDD\|234619
NZ_CP051128.1\|WP_168245208.1\|5675491_5676187_-\|spore-cortex-protein-CoxA	unknown	unknown	gnl\|CDD\|378211

Protein	Function_ID	Function_description	E-value
NZ_CP051128.1\|WP_168245216.1\|5686527_5687820_-\|GTPase-ObgE	gnl\|CDD\|237046	PRK12297, obgE, GTPase CgtA; Reviewed.	0
NZ_CP051128.1\|WP_168245210.1\|5679621_5680719_-\|quinolinate-synthase-NadA	gnl\|CDD\|236489	PRK09375, PRK09375, quinolinate synthase NadA.	5.88215e-160
NZ_CP051128.1\|WP_168246254.1\|5683328_5684477_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|179511	PRK02948, PRK02948, IscS subfamily cysteine desulfurase.	4.77701e-158
NZ_CP051128.1\|WP_168245200.1\|5667172_5668720_+\|stage-V-sporulation-protein-B	gnl\|CDD\|274343	TIGR02900, Stage_V_sporulation_protein_B, stage V sporulation protein B. SpoVB is the stage V sporulation protein B of the bacterial endopore formation program in Bacillus subtilis and various other Firmcutes. It is nearly universal among endospore-formers. Paralogs with rather high sequence similarity to SpoVB exist, including YkvU in B. subtilis and a number of proteins in the genus Clostridium. [Cellular processes, Sporulation and germination].	1.3337e-170
NZ_CP051128.1\|WP_168246253.1\|5669690_5670053_+\|TIGR04086-family-membrane-protein	gnl\|CDD\|274969	TIGR04086, hypothetical_protein, putative membrane protein, TIGR04086 family. Members of this family of strongly hydrophobic putative transmembrane protein average about 125 amino acids in length and occur mostly, but not exclusively, in the Firmicutes. Members are quite diverse in sequence. The function is unknown.	8.4085e-20
NZ_CP051128.1\|WP_168245202.1\|5670149_5670443_-\|preprotein-translocase-subunit-YajC	gnl\|CDD\|235518	PRK05585, yajC, preprotein translocase subunit YajC; Validated.	3.71446e-37
NZ_CP051128.1\|WP_168245199.1\|5666737_5667034_-\|post-transcriptional-regulator	gnl\|CDD\|379375	pfam13797, Post_transc_reg, Post-transcriptional regulator. This family includes post-transcriptional regulators.	1.79373e-24
NZ_CP051128.1\|WP_168245203.1\|5670472_5671612_-\|tRNA-guanosine(34)-transglycosylase-Tgt	gnl\|CDD\|234642	PRK00112, tgt, queuine tRNA-ribosyltransferase; Provisional.	0
NZ_CP051128.1\|WP_168245212.1\|5681537_5683121_-\|L-aspartate-oxidase	gnl\|CDD\|236147	PRK08071, PRK08071, L-aspartate oxidase; Provisional.	0
NZ_CP051128.1\|WP_168245214.1\|5685122_5685980_-\|prephenate-dehydratase	gnl\|CDD\|237013	PRK11898, PRK11898, prephenate dehydratase; Provisional.	9.44759e-149
NZ_CP051128.1\|WP_168245215.1\|5686038_5686488_-\|ACT-domain-containing-protein	gnl\|CDD\|179848	PRK04435, PRK04435, ACT domain-containing protein.	3.72546e-78
NZ_CP051128.1\|WP_168245209.1\|5676292_5677282_-\|phosphotransferase	gnl\|CDD\|223584	COG0510, ycfN, Thiamine kinase and related kinases [Coenzyme transport and metabolism].	2.18226e-05
NZ_CP051128.1\|WP_168245207.1\|5674765_5675311_-\|regulator	gnl\|CDD\|370208	pfam08955, BofC_C, BofC C-terminal domain. The C-terminal domain of the bacterial protein 'bypass of forespore C' contains a three-stranded beta-sheet and three alpha-helices. Its exact function is, as yet, unknown.	2.31325e-36
NZ_CP051128.1\|WP_168245213.1\|5684531_5685068_+\|transcription-repressor-NadR	gnl\|CDD\|224740	COG1827, COG1827, Predicted small molecule binding protein (contains 3H domain) [General function prediction only].	2.9676e-52
NZ_CP051128.1\|WP_168245201.1\|5668766_5669426_-\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	5.45445e-72
NZ_CP051128.1\|WP_168245211.1\|5680720_5681569_-\|carboxylating-nicotinate-nucleotide-diphosphorylase	gnl\|CDD\|181221	PRK08072, PRK08072, carboxylating nicotinate-nucleotide diphosphorylase.	2.76545e-166
NZ_CP051128.1\|WP_168245204.1\|5671639_5672668_-\|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA	gnl\|CDD\|234666	PRK00147, queA, S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional.	0
NZ_CP051128.1\|WP_168245206.1\|5673712_5674324_-\|Holliday-junction-branch-migration-protein-RuvA	gnl\|CDD\|234645	PRK00116, ruvA, Holliday junction branch migration protein RuvA.	4.2977e-85
NZ_CP051128.1\|WP_168245205.1\|5672697_5673702_-\|Holliday-junction-branch-migration-DNA-helicase-RuvB	gnl\|CDD\|234619	PRK00080, ruvB, Holliday junction branch migration DNA helicase RuvB.	0
NZ_CP051128.1\|WP_168245208.1\|5675491_5676187_-\|spore-cortex-protein-CoxA	gnl\|CDD\|378211	pfam09580, Spore_YhcN_YlaJ, Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ). This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain.	6.05781e-06

>NZ_CP051128.1|WP_168245207.1|5674765_5675311_-|regulator
MRFKWMAWYRYSLAGFAVLLFMFIFNAKGMTIIAAASQMDTQKKTEPLHMTVILERVYLDGEISQEVVHETCWSAENFWAKYDQWQLTDIDESTMVFRKQVNDISPLLKANGFFGITEDGVLSIFNGRPDQLRIIQSFFQIDIMKLESAKQEELLQGIPIKTKDRFVEVLETFKPYSLKKE
>NZ_CP051128.1|WP_168245206.1|5673712_5674324_-|Holliday-junction-branch-migration-protein-RuvA
MYEFIKGTVDFVGPEYIVVENSGIGYQISTPNPFIYASKMETMVTVYTYHYVREDVMALYGFETREEKKLFTKLLNVSGIGPKGALAILASGEVQQVVTAVENEDESFLVKFPGVGKKTARQMILDLKGKLQDIVPDYFPNLFNTDQLHLHTQATNSNLEEAILALKALGYSEKEIKKISPELRKEQMSTDQYIKKALQRLLK
>NZ_CP051128.1|WP_168245205.1|5672697_5673702_-|Holliday-junction-branch-migration-DNA-helicase-RuvB
MDDRIISSEVNESEISIEQSLRPQTLRQYIGQDQVKENLDIYIKAAKMRKETLDHVLLYGPPGLGKTTLAVIIANEMGVNIRTTSGPAIERPGDLAAILTALEPGDVLFIDEIHRLQRTIEEVLYPAMEDFCLDIVIGKGPSARSVRLDLPPFTLVGATTRAGSLSAPLRDRFGVLSRLEYYKEDQLKNIVLRTAEVFGTEIDDLSAQEIARRSRGTPRIANRLLRRVRDFAQVRGNGTIELALAREALELLQVDRLGLDHIDHKLLKGIIERFRGGPVGLDTIAASIGEEAETIEDVYEPYLLQIGFLQRTPRGRVVTPLVYHHFGMDLPATD
>NZ_CP051128.1|WP_168245204.1|5671639_5672668_-|tRNA-preQ1(34)-S-adenosylmethionine-ribosyltransferase-isomerase-QueA
MKVDLFDFHLPEELIAQVPLQNRTDSRLMVLDKESGEIKHEVFKNVIDYLREGDCLVLNDTKVLPARLFGVKKDTGAKIEVLLLKQLEGDQWETLIKPAKRVKEGTEIDFGDGLLTAVCTGTSDHGGRILDFKYEGIFYEVLDQLGEMPLPPYIKEQLEDRDRYQTVFAREPGSAAAPTAGLHFTDSLLEEIKEKGVHIAFITLHVGLGTFRPVSVDDVLEHDMHSEFYIVTEGTARLLNEVRSNGGRIITVGTTSTRTLETIASANDGRFIEGSGWTNIFIYPGYEFKAIDGMITNFHLPKSTLIMLVSALAGREHVLHAYQTAVSERYRFFSFGDAMFII
>NZ_CP051128.1|WP_168245203.1|5670472_5671612_-|tRNA-guanosine(34)-transglycosylase-Tgt
MTAIRYELIKTCKQTGARLGRVHTPHGSFDTPAFMPVGTLATVKTMSPEDLKEMGAGIILSNTYHLWLRPGHEIIREAGGLHKFMNWDRAILTDSGGFQVFSLSEFRKIEEEGVHFRNHMSGEKLFLSPEKAMEIQNALGSDIMMAFDECPPYPATYEYMQKSVERTSRWAERCLNAHSRPNDQGLFGIVQGGEYEELRKQSAKDLVSLDFPGYAVGGLSVGEPKDIMNRMLEHTTPLLPTNKPRYLMGVGSPDSLIDGSIRGIDMFDCVLPTRIARNGTLMTSTGRLVVKNAQFTRDFGPLDENCDCYTCRNYSRAYIRHLIKCDETFGIRLTSYHNLYFLLRLMEKVRQAIMEDRLGDFREEFFEQYGFNKPNAKNF
>NZ_CP051128.1|WP_168245202.1|5670149_5670443_-|preprotein-translocase-subunit-YajC
MSGGIGTIVPLILMFVLFYFLLIRPQQKRQKAVQKMQSDLKKGDKVVTIGGLHGFIDSIDENKAVIKCGDGSRLTFDRNAIREVTADASEGSVNLTK
>NZ_CP051128.1|WP_168246253.1|5669690_5670053_+|TIGR04086-family-membrane-protein
MYGLIFILVFAVICSLIFAFILKFTSAREVSLQYVITALSFIGLFGGGFLSGGKRKEKGWLIGGLTGLIYSIVVFLFQYLGYDRLFNAEQVIYHTCYTLIAMMGGILGVNISTNNSRRSA
>NZ_CP051128.1|WP_168245201.1|5668766_5669426_-|DUF421-domain-containing-protein
MEDYLTIVFRTLLLYAVILVIFRVMGKREIGELSILDLVVFIMIGEMAVVAIERIHTPLFHTIIPMVLLMLIQITLAIFSLKSKKFRNLIDGQPSIIINRGKIDENAMRKQRYNFDDLMTQLREKNIRSIADVEFAILESSGSLSVIEKLRNNNNEPELGDITIPLILDGNIEEENLKRINKTNLWLRQELKKQGYRDVKKISFCSYENGKFFIDLQDE
>NZ_CP051128.1|WP_168245200.1|5667172_5668720_+|stage-V-sporulation-protein-B
MSKFLKGTFILLIAGLVTRVLGFINRIVIARSIGEEGVGLYMMAFPTFILVVTLTQLGLPVAISKNVAEAEAKGNFAEIKKILVVSLATTISLSLIFTPALILLAPILSKTLFTDPRTFYPLIAIAPVVPVIAISSVLRGYFQGRQNMRPSAISQILEQFVRITLIAMMTKAFLPYGIEYAAAAAMVSSVIGELVSLIYLMTAFKLKKRFRLRKNFFQFVHSGKQTFKELMDIALPTMGSRMIGSVAWFFEPIVVVHSLALAGVITVEATKQYGALTGFAMPLLMLPSFITFSLATSLVPAISEANTQNNKKLIEYRLQQALRFAFLSGGLAVVVLYVLANPLMELMYGSAKGSYFIRLMAPFFLFYYYQGPLQAVLQALNLARAAMINSLIGAIVKTAVIFLLASQASFGINGVALGIIVGFVLVTVLHFATVLKKISFSFYVRDYLKGFLVMGATGWLGYWLFENTFLTEPLTIKVIFSLMAMSISYLIMIILLGLIKKEELKRIPWLRNLFA
>NZ_CP051128.1|WP_168245199.1|5666737_5667034_-|post-transcriptional-regulator
MDNSHRFEHFRTQVQPAVASKLTEFQLLGIDSVTEKELWDFLIKKKWKKVKEEMKLYEIIQEILSVKASDYLSFATIEAYKTTEFSFDDEDELKELLK
>NZ_CP051128.1|WP_168245208.1|5675491_5676187_-|spore-cortex-protein-CoxA
MNKKQWMIPLSAALMLGLAGCANDNNRAGVNKNNNNSLRPVGYYSNENHPTSDNDLFRDDDGAITEMMDHSLGDEDQVTNENRRRQLQSQDENGNPKNPSSPLASKDRNFFQHDNRFSTSDMNYHGHLNAKTGNAGVVTDSDFQDNFTNKVRNKVEAIPNVQTVRSVAYGNTVIVSVVLNDQDKAAATKSAIKRVVRPYANGRTVKVITDEGTLGRDRNFNKDSQHEKGGR
>NZ_CP051128.1|WP_168245209.1|5676292_5677282_-|phosphotransferase
MRAFNTANNKKGDDDYFDRLLSYFQSKFYDRILQMIPIRKSVIFLRTDKNDYVIKGYHTNSRLRLQEAFTATLKKEGFKKTYLFLTSPVRDQLFFEGTYFGCMEYIPPNKNVFSFHTHKNRQEGMELLEQFHQTTASFESRYRTLLPKGHLIEKWTERLNVFSNNLPYLGYFINEPFISEMLSWAKWSLEGMKNNRVFFQKEPTVILHGDVAHHNFLRDTEGQLHLIDFDLISIGPASFDYLQYANRILPFIDWSFERLSSLKQIKKYLHEEAFLFALAYPADIFREWNRMIREKSYTDHTKYKQVMDLTISQFYARKKFIDHLRELLD
>NZ_CP051128.1|WP_168245210.1|5679621_5680719_-|quinolinate-synthase-NadA
MNILATLQKNIMIPEKYKQMTREELENRVMEVKKQLGSRLFIPGHHYQKDEVVQFADATGDSLQLAQLSAENTEAEFIVFCGVHFMAETADILTSEQQKVILPDMRAGCSMADMADIQQTERAWETLQEIFGDTILPLTYVNSTAAIKSFVGANGGATVTSSNAETMVKWAFEMKERILFLPDQHLGRNTAADLGVGLDEMAIWNPINHVLEYEGDFSKIKVILWKGHCSVHENFTVQNVSDTRSQYPDMKIIVHPECRREVVELADMAGSTSYIIKAIESAEPGTAWAIGTEMNLVNRLIKNHPDKKIISLNPHMCPCLTMNRIDLPHLVWSLDTLEETNNIIKVSPEIAENAKLALERMLKNS
>NZ_CP051128.1|WP_168245211.1|5680720_5681569_-|carboxylating-nicotinate-nucleotide-diphosphorylase
MNTLKLRSQLEKFFMEDIGEQDITTDLIFGDSTNGEIVFLSKDDGVFCGEEIIKTGFQLLNNEISTQVFVKDGQSIKYGDKLAHVSGKIADLLKGERVILNLIQRMSGIATLTRQTVHTLDSGHTKVCDTRKTTPGLRMLEKYAVRTGGGFNHRFGLYDGVMIKDNHISFAGSITKAVEAIRKNAGHMVKVEVETETEAQVIEAVNAGADVIMFDNRTPDEIKELIKLVPANIITEASGGIQLANIADFRDTGVDYISLGYLTHSYKALDISVKVLWNKGDE
>NZ_CP051128.1|WP_168245212.1|5681537_5683121_-|L-aspartate-oxidase
MTNDDVLIIGSGIAALQLAVQLNNELNVRILTKGKLRTANSYLAQGGIAAALGENDHPSKHIVDTLEAGRFHNNQEAVQQVINAAPDLIKNIARQGDIFDKDQTGELFLGMEGAHSEKRIVHGGGDATGKNVMEFLISQLKRKKNITVEENVFAYELLLNSEQKRCVGVKAKTSTGAIQRFYGNHVIIATGGCGQLYTYTSNAKTVSGDGIAMAYLAGADIVDMEFIQFHPTLLSINGETKGLISEAVRGEGATLVTEDGTPIMEGVHPLKDLGPRHVVSQRIFEFIKKGKQIYLDISKIEEFSKRFPSITSICEDNGIRIADGKIPVAPGSHFLMGGIKTDLIGRSSIDGLYAIGEASCTGLHGANRLASNSLLEGLFQGEQLSKWINEAGKETQVFVQDYFYYPTKEEKMNLPAIEKIKALMMERVGIVRNKANLKKQQAWVSQYKAEKIHLDTCSTQDMTKVFMLIIANLITESALKRTESRGGHFRSDYPKEENHSWLRKSIIHNYNQGMEKSNEHIETALAT
>NZ_CP051128.1|WP_168246254.1|5683328_5684477_+|IscS-subfamily-cysteine-desulfurase
MKYFDFAATTPLNPEAAEVYLKVATEYFGNSSSLHDIGGQSAALLENCREELANLVGVDKNGIFFTSGGSEGNFLAIEALLSSPKKKGNHIIAGVAEHSSVHGALNRLKEAGYDITLLPLHSNGLINLEQLVKSITSETILMTLQHVNSEIGTIQPIAEIAKICKDHNIHLHSDFVQSFGKIDLKSIAPHVSSFSFSGHKIYGPKGIGGVYVDPRIKWQSFFPGTSHEKGFRPGTVNVPAIAAMTVAAQKITGSLQADHNKYRLLRKAFMDTLEPIKEQVKIYQGDEGSQLASIIGLRISGIEGQWMMLECNRLGFAISTGSACQIGMQSPAKVTQALGLTTAEAKEFIRISFGHSTSLEDVIQLGESIVKIVNSFKATSVI
>NZ_CP051128.1|WP_168245213.1|5684531_5685068_+|transcription-repressor-NadR
MVEQKKILGEERRSLILQQLKDSPVPLTGSELANRTNVSRQVIVGDITLLKAKNEPIIATSQGYIYLRQNSSTYSFERTIACRHLPEDTERELNLLVDHGVLVKDVKIEHTVYGDLTASIMVSNRQEVKQFLENMQKTNASLLSELTEGIHLHTISASSTQVLDNAEAALKAEGFMIE
>NZ_CP051128.1|WP_168245214.1|5685122_5685980_-|prephenate-dehydratase
MKVGYLGPKATFTELAVKKVFQGFELVPYQTIPASVDAIVDKEVDLAVVPIENALEGSVNITLDYLTHVVQIPIIGEITLPIKQHLMVHPDNMDNWRDVSKVYSHSHAIAQCHKFLHNQLKGVPFESVSSTAAAAQMVMEQPALKAAAIANELAAKEYGLAIVQRNIHDFDYNHTRFVVLTKENFDFQAMSGSSHYKTTLMVTLPEDDQAGALHQVLSAFAWRKLNLSKIESRPMKTGIGNYFFIIDIEMEFDEVLIPGAMAELEALGCSVKLLGSYPSVMVKLD
>NZ_CP051128.1|WP_168245215.1|5686038_5686488_-|ACT-domain-containing-protein
MENADKKFYLVREDVLPEAMKKTLDVKEMLERGKAESIADAVHKADLSRSAFYKYRDTVFPFSSIKKEKIISLFFHLEDRSGTLSKLLSVVANSGCNIVTLHQTIPLQSRANVTLSLNTSNITMEIDELLKELRKLEFVEKVEVLGTGV
>NZ_CP051128.1|WP_168245216.1|5686527_5687820_-|GTPase-ObgE
MFVDQTKIYVKAGDGGNGMVAFRKEKYIPKGGPAGGDGGKGANVVFEVNEGLRTLMDFRYQRHFKAPRGEHGMSKNQHGAGAKDMIVKVPPGTVVIDEKTNEVIADLVENGQQAIIARGGRGGRGNSRFATPANPAPELSENGEPGQEREVILELKLLADVGLVGFPSVGKSTLLSVVSSARPKIAEYHFTTIVPNLGMVETEDGRSFVMADLPGLIEGASEGVGLGHQFLRHIERTRVIVHVIDMAAMEGRDPYEDYLTINKELKEYNLRLTERPQVIVANKMDMPEAEENLKKFKEQLEEDYPIFPISAVTRKGLRELLFAVADKIEETPEFPLEHEEEETTGVHRVLYKHEAEPEAFRITREPDGSFVVSGEKTDKLFKMTDFSREESVRRFARQLRGLGVDEALRERGAKDGDIVKLMEFEFEFIE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1091018 : 1099306

Prochlorococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168241642.1\|1091018_1092317_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	24.7
WP_098934681.1\|1092420_1093134_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	2.4e-46	45.4
WP_168241643.1\|1093126_1093381_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_168241644.1\|1093377_1094061_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_168241645.1\|1094044_1096270_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-159	40.9
WP_168241646.1\|1096245_1097658_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-50	32.5
WP_098934677.1\|1097672_1098707_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	6.5e-61	47.7
WP_168241647.1\|1098703_1099306_+	phosphoribosylglycinamide formyltransferase	R9S626	Prochlorococcus_phage	4.0e-18	32.8

DBSCAN-SWA_2

2804069 : 2846320

Bacillus_phage(36.36%)

terminase,transposase,integrase

attL 2841914:2841937|attR 2854881:2854904

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168242912.1\|2804069_2805053_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_168242913.1\|2805727_2806018_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168242914.1\|2806048_2808577_+	DUF927 domain-containing protein	Q4ZE73	Staphylococcus_phage	2.3e-83	33.7
WP_168242915.1\|2809176_2809467_+	hypothetical protein	NA	NA	NA	NA
WP_168242916.1\|2809616_2809796_+	hypothetical protein	NA	NA	NA	NA
WP_168242917.1\|2809782_2810325_+	hypothetical protein	NA	NA	NA	NA
WP_168242918.1\|2810433_2810784_+\|terminase	P27 family phage terminase small subunit	A0A0S2SXN4	Bacillus_phage	1.6e-11	34.2
WP_168242919.1\|2810987_2811077_+	hypothetical protein	NA	NA	NA	NA
WP_168242920.1\|2811166_2811553_+	hypothetical protein	NA	NA	NA	NA
WP_168242921.1\|2811558_2812143_+	hypothetical protein	NA	NA	NA	NA
WP_168242922.1\|2812281_2812620_+	YolD-like family protein	NA	NA	NA	NA
WP_168242923.1\|2812782_2814003_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	5.0e-20	28.7
WP_168242924.1\|2814009_2815059_+	5-methylcytosine-specific restriction endonuclease system specificity protein McrC	NA	NA	NA	NA
WP_168242925.1\|2815200_2815497_-	hypothetical protein	NA	NA	NA	NA
WP_168242926.1\|2815647_2816619_+	HNH endonuclease	NA	NA	NA	NA
WP_168242927.1\|2816630_2816948_+	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_168242928.1\|2817172_2817811_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_168242929.1\|2818199_2819228_+	DNA (cytosine-5-)-methyltransferase	A0A0K2FH18	Enterobacter_phage	1.5e-41	31.8
WP_168242930.1\|2819216_2819957_-	HNH endonuclease	NA	NA	NA	NA
WP_168242931.1\|2819980_2820322_-	helix-turn-helix transcriptional regulator	A0A1W6JPB6	Staphylococcus_phage	1.7e-05	31.3
WP_168242932.1\|2820878_2822009_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	2.8e-81	44.2
WP_168242933.1\|2822089_2823058_-	hypothetical protein	NA	NA	NA	NA
WP_168242934.1\|2823189_2823390_+	hypothetical protein	NA	NA	NA	NA
WP_168242935.1\|2823486_2823717_+	helix-turn-helix domain-containing protein	A0A1B0T6C2	Bacillus_phage	5.7e-10	45.3
WP_168242936.1\|2823691_2824549_+	DNA primase	A0A173H0P8	Pseudoalteromonas_phage	5.2e-40	41.1
WP_168242937.1\|2824538_2826212_+	hypothetical protein	NA	NA	NA	NA
WP_168242938.1\|2826208_2826628_+	hypothetical protein	NA	NA	NA	NA
WP_168242939.1\|2826788_2827010_+	hypothetical protein	NA	NA	NA	NA
WP_168242940.1\|2827042_2827420_+	hypothetical protein	NA	NA	NA	NA
WP_168242941.1\|2828040_2828724_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_168246033.1\|2829027_2829603_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_168242942.1\|2829804_2829993_+	hypothetical protein	NA	NA	NA	NA
WP_168242943.1\|2830277_2831252_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_168242944.1\|2831910_2832903_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_168242945.1\|2832923_2833166_+	DUF896 domain-containing protein	NA	NA	NA	NA
WP_168242946.1\|2833162_2833642_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_168242947.1\|2833757_2833988_+	hypothetical protein	NA	NA	NA	NA
WP_168242948.1\|2834530_2835619_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_168242949.1\|2835615_2836707_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_168246034.1\|2836699_2838199_-	spore germination protein	NA	NA	NA	NA
WP_168242950.1\|2839198_2839399_+	cold-shock protein	Q9AZD3	Lactococcus_phage	5.3e-20	71.2
WP_168242951.1\|2839754_2840978_-\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	6.3e-47	30.6
WP_168242952.1\|2841383_2841863_+	hypothetical protein	NA	NA	NA	NA
2841914:2841937	attL	NA	NA	NA	NA
WP_168242953.1\|2843998_2844877_+\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	2.7e-31	29.9
WP_168242954.1\|2845045_2846320_+\|transposase	IS110 family transposase	NA	NA	NA	NA
2854881:2854904	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2851314 : 2920817

Paenibacillus_phage(25.0%)

transposase,integrase

attL 2855645:2855661|attR 2929295:2929311

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168242958.1\|2851314_2852434_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.7e-97	63.0
WP_168242959.1\|2853485_2854046_+	hypothetical protein	NA	NA	NA	NA
WP_168242960.1\|2854941_2855415_-	hypothetical protein	NA	NA	NA	NA
WP_168242961.1\|2855426_2856431_-	DUF3231 family protein	NA	NA	NA	NA
2855645:2855661	attL	NA	NA	NA	NA
WP_168242962.1\|2856817_2858047_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	7.8e-05	22.6
WP_168242963.1\|2858503_2858935_+	DUF192 domain-containing protein	A0A1B1IUW8	uncultured_Mediterranean_phage	4.8e-10	39.3
WP_168242964.1\|2859501_2860599_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_168242965.1\|2860627_2861818_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
WP_168242966.1\|2861834_2863319_-	spore germination protein	NA	NA	NA	NA
WP_168242967.1\|2863831_2864335_+	hypothetical protein	NA	NA	NA	NA
WP_088087141.1\|2864880_2865069_+	hypothetical protein	NA	NA	NA	NA
WP_168242954.1\|2865523_2866798_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_168242968.1\|2867127_2868248_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.2e-97	63.0
WP_168242969.1\|2869809_2870892_+	HupE/UreJ family protein	NA	NA	NA	NA
WP_168242970.1\|2870987_2874629_+	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_168246035.1\|2874817_2875171_+	hypothetical protein	NA	NA	NA	NA
WP_168246036.1\|2876136_2877087_+\|integrase	site-specific integrase	A0A142F1N9	Bacillus_phage	4.2e-30	33.2
WP_168242971.1\|2877188_2877362_-	hypothetical protein	NA	NA	NA	NA
WP_168242972.1\|2878342_2879596_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_168242973.1\|2880085_2880730_-	YitT family protein	NA	NA	NA	NA
WP_168242974.1\|2880750_2881191_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_088086607.1\|2881319_2881772_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168242975.1\|2881797_2882316_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168242976.1\|2883104_2883701_-	hypothetical protein	NA	NA	NA	NA
WP_168242977.1\|2884170_2884371_+	hypothetical protein	NA	NA	NA	NA
WP_168242978.1\|2884728_2885001_-	YqhV family protein	NA	NA	NA	NA
WP_168246037.1\|2885394_2885472_+	hypothetical protein	NA	NA	NA	NA
WP_168242979.1\|2885508_2886189_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_168242980.1\|2886656_2887151_-	hypothetical protein	NA	NA	NA	NA
WP_168242981.1\|2887456_2887861_+	transcriptional regulator Spx	NA	NA	NA	NA
WP_168242982.1\|2887983_2888409_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168242983.1\|2888466_2888865_+	DoxX family protein	NA	NA	NA	NA
WP_168242984.1\|2888955_2889894_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_168242985.1\|2889917_2890526_+	flavin reductase family protein	NA	NA	NA	NA
WP_168242986.1\|2890563_2891508_+	ring-cleaving dioxygenase	NA	NA	NA	NA
WP_168242987.1\|2891507_2892119_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_168242988.1\|2892141_2892567_+	DoxX family protein	NA	NA	NA	NA
WP_168242989.1\|2892782_2893253_+	hypothetical protein	NA	NA	NA	NA
WP_168242990.1\|2893603_2894317_+	pirin family protein	NA	NA	NA	NA
WP_168242991.1\|2894316_2894592_+	hypothetical protein	NA	NA	NA	NA
WP_098932266.1\|2894680_2895334_+	alkylhydroperoxidase	NA	NA	NA	NA
WP_168242992.1\|2895470_2896388_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_168242993.1\|2896532_2898050_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	8.1e-44	28.1
WP_168242994.1\|2898118_2899639_+	aldehyde dehydrogenase	NA	NA	NA	NA
WP_168242995.1\|2899684_2900893_+	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_168242996.1\|2901069_2902974_+	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	4.9e-131	38.4
WP_168242997.1\|2903136_2904408_+	MFS transporter	NA	NA	NA	NA
WP_168242998.1\|2904508_2905150_+	hypothetical protein	NA	NA	NA	NA
WP_168242999.1\|2905168_2905723_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
WP_168246038.1\|2905743_2906823_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_168243000.1\|2907162_2907939_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_168243001.1\|2908088_2908208_+	hypothetical protein	NA	NA	NA	NA
WP_168243002.1\|2908314_2909535_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168243003.1\|2909993_2914136_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	2.3e-24	32.9
WP_168243004.1\|2914598_2915219_+	chromate transporter	NA	NA	NA	NA
WP_168243005.1\|2915236_2915779_+	chromate transporter	NA	NA	NA	NA
WP_088086642.1\|2916311_2917139_+	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
WP_168243006.1\|2917139_2918174_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_168243007.1\|2918448_2919153_+	DUF421 domain-containing protein	NA	NA	NA	NA
WP_168243008.1\|2919356_2920817_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
2929295:2929311	attR	NA	NA	NA	NA

DBSCAN-SWA_4

4914432 : 4972439

Bacillus_phage(28.57%)

transposase,integrase

attL 4911204:4911219|attR 4976525:4976540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4911204:4911219	attL	NA	NA	NA	NA
WP_168246199.1\|4914432_4915350_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	5.3e-30	34.6
WP_168240866.1\|4915343_4915520_-	hypothetical protein	NA	NA	NA	NA
WP_168244575.1\|4915456_4915777_-	hypothetical protein	NA	NA	NA	NA
WP_168244576.1\|4916005_4916476_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168244577.1\|4916876_4917062_+	spore germination protein	NA	NA	NA	NA
WP_168244578.1\|4917160_4917628_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_168244579.1\|4917649_4918195_-	GerAB/ArcD/ProY family transporter	NA	NA	NA	NA
WP_168244580.1\|4918501_4919221_-	hypothetical protein	NA	NA	NA	NA
WP_168244581.1\|4919694_4920873_-	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_168244582.1\|4920959_4921874_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_168244583.1\|4922086_4922875_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_168246200.1\|4922879_4923152_-	hypothetical protein	NA	NA	NA	NA
WP_168244584.1\|4923282_4923741_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_168244585.1\|4923746_4924529_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_168244586.1\|4924984_4925701_-	flavin reductase family protein	NA	NA	NA	NA
WP_168244587.1\|4926178_4927027_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_168244588.1\|4927312_4927513_+	hypothetical protein	NA	NA	NA	NA
WP_168244589.1\|4927675_4928224_-	6-phospho-3-hexuloisomerase	NA	NA	NA	NA
WP_168244590.1\|4928227_4928863_-	3-hexulose-6-phosphate synthase	NA	NA	NA	NA
WP_168244591.1\|4930205_4930697_-	hypothetical protein	NA	NA	NA	NA
WP_168244592.1\|4930710_4931334_-	DUF1738 domain-containing protein	NA	NA	NA	NA
WP_168244593.1\|4932115_4932388_+	hypothetical protein	NA	NA	NA	NA
WP_168244594.1\|4932433_4932625_-	hypothetical protein	NA	NA	NA	NA
WP_168244595.1\|4932681_4933134_-	DNA repair protein RadC	NA	NA	NA	NA
WP_168244596.1\|4933893_4934277_+	YolD-like family protein	NA	NA	NA	NA
WP_088090879.1\|4935099_4935327_-	DUF2187 family protein	NA	NA	NA	NA
WP_168244597.1\|4935374_4935596_-	hypothetical protein	NA	NA	NA	NA
WP_168244598.1\|4935949_4936453_-	hypothetical protein	NA	NA	NA	NA
WP_168244599.1\|4936987_4937167_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
WP_168244600.1\|4937272_4937503_-	hypothetical protein	NA	NA	NA	NA
WP_168244601.1\|4938147_4938363_-	hypothetical protein	NA	NA	NA	NA
WP_088090819.1\|4939074_4939203_-	YhfH family protein	NA	NA	NA	NA
WP_168244602.1\|4940828_4941350_-	hypothetical protein	A0A0A0RMX2	Bacillus_phage	1.5e-21	40.4
WP_168244603.1\|4942036_4942771_-	hypothetical protein	NA	NA	NA	NA
WP_168244604.1\|4942889_4943063_-	hypothetical protein	NA	NA	NA	NA
WP_168244605.1\|4943606_4943759_+	hypothetical protein	NA	NA	NA	NA
WP_168244606.1\|4943816_4944011_+	RNA polymerase	A0A2I7S8R6	Vibrio_phage	1.1e-06	54.0
WP_168244607.1\|4944500_4944899_+	hypothetical protein	NA	NA	NA	NA
WP_168246201.1\|4945277_4946255_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_168246202.1\|4953224_4953758_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-09	30.5
WP_168244608.1\|4953750_4954224_-	hypothetical protein	NA	NA	NA	NA
WP_168240867.1\|4954660_4954822_+	hypothetical protein	NA	NA	NA	NA
WP_168244609.1\|4954931_4955843_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_168243563.1\|4956341_4957565_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.3e-47	30.0
WP_168244610.1\|4958562_4958919_-	DUF2019 domain-containing protein	NA	NA	NA	NA
WP_168244611.1\|4959140_4961048_-	S8/S53 family peptidase	NA	NA	NA	NA
WP_168244612.1\|4961555_4962779_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_168244613.1\|4962929_4963400_-	hypothetical protein	NA	NA	NA	NA
WP_168244614.1\|4963660_4964575_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.6e-05	36.8
WP_168244615.1\|4964720_4966016_+	MFS transporter	NA	NA	NA	NA
WP_168244616.1\|4966323_4967259_-	hypothetical protein	NA	NA	NA	NA
WP_168244617.1\|4967483_4967801_+	hypothetical protein	NA	NA	NA	NA
WP_168244618.1\|4967972_4968392_-	DUF4279 domain-containing protein	NA	NA	NA	NA
WP_168244619.1\|4968786_4970010_+\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	2.8e-47	30.0
WP_168246203.1\|4970143_4970368_-	hypothetical protein	NA	NA	NA	NA
WP_168241956.1\|4971164_4972439_-\|transposase	IS110 family transposase	NA	NA	NA	NA
4976525:4976540	attR	NA	NA	NA	NA

DBSCAN-SWA_5

5364513 : 5379796

Acanthamoeba_polyphaga_lentillevirus(50.0%)

coat,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098931580.1\|5364513_5365203_-\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_168246236.1\|5365317_5366274_-	asparaginase	NA	NA	NA	NA
WP_168244934.1\|5366273_5367254_-	YpdA family putative bacillithiol disulfide reductase	NA	NA	NA	NA
WP_168244935.1\|5367349_5368627_-	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
WP_168244936.1\|5368870_5369452_-	genetic competence negative regulator	NA	NA	NA	NA
WP_168244937.1\|5369527_5370310_-	metallophosphoesterase	NA	NA	NA	NA
WP_168244938.1\|5370334_5370703_-	hypothetical protein	NA	NA	NA	NA
WP_168244939.1\|5370899_5371130_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_168244940.1\|5371126_5371387_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_168244941.1\|5371408_5371978_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_168244942.1\|5372008_5372464_-	YpbF family protein	NA	NA	NA	NA
WP_168246237.1\|5372555_5373080_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_168244943.1\|5373265_5373871_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_168244944.1\|5373867_5375382_-	ATP-dependent DNA helicase RecQ	J2YAJ8	Acanthamoeba_polyphaga_lentillevirus	1.1e-56	31.9
WP_168244945.1\|5375381_5376419_-	RQC domain-containing protein	NA	NA	NA	NA
WP_024030326.1\|5376680_5376929_+	ferredoxin	A0A127AYY7	Bacillus_phage	1.2e-16	49.3
WP_168244946.1\|5377221_5377806_-	ECF transporter S component	NA	NA	NA	NA
WP_168244947.1\|5378335_5379796_-\|transposase	IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

6200812 : 6210188

Bacillus_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168245624.1\|6200812_6201556_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.0e-17	28.9
WP_168245625.1\|6201665_6202999_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-28	33.9
WP_168245626.1\|6203146_6204520_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	6.0e-30	32.4
WP_168245627.1\|6204497_6205208_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-36	38.8
WP_168245628.1\|6205553_6206918_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.4e-39	36.9
WP_168245629.1\|6206953_6208471_-	flotillin family protein	A0A2I2L4B2	Orpheovirus	2.9e-09	29.0
WP_168245630.1\|6208485_6209028_-	hypothetical protein	NA	NA	NA	NA
WP_088089532.1\|6209453_6210188_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-37	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP051128

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection