CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	1 crisprs	NA	6	8
NZ_CP041294	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-p3, complete sequence	0 crisprs	NA	0	0
NZ_CP041296	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-p2, complete sequence	0 crisprs	NA	0	0
NZ_CP041293	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-p5, complete sequence	0 crisprs	NA	0	0
NZ_CP041298	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-p4, complete sequence	0 crisprs	NA	0	0
NZ_CP041295	Acinetobacter indicus strain 80-1-2 chromosome, complete genome	3 crisprs	cas14j,DEDDh,csa3,cas3,WYL,c2c9_V-U4	1	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041297_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041297_1

16719-16926

Orphan

Consensus_repeat	Method
ACCTAAAAATCGCCTATGCGATTACTCAC	PILER-CR
CCTAAAAATCGCCTGTGCGATTACTCAC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP041297_1

>merge|NZ_CP041297|1|16719-16926|PILER-CR,CRISPRCasFinder
CCTAAAAATCGCCTGTGCGATTACTCACGATACATGGAAATCTTGGATTACTCCAGTCAACCTAAAAATCGCCTGTGCGATTACTCACAGATTTCCATGAAGGAATTTTATTCTCTTAGACCTAAAAATCGCCTATGCGATTACTCACCGTATCTTGGCATTTGATAAATGCCGTTTGAACCTAAAAATCGCCTATGCGATTACTCAC

>NZ_CP041297|1|1|16719-16926|PILER-CR
CCTAAAAATCGCCTGTGCGATTACTCACG	ATACATGGAAATCTTGGATTACTCCAGTCAA
CCTAAAAATCGCCTGTGCGATTACTCACA	GATTTCCATGAAGGAATTTTATTCTCTTAGA
CCTAAAAATCGCCTATGCGATTACTCACC	GTATCTTGGCATTTGATAAATGCCGTTTGAA
CCTAAAAATCGCCTATGCGATTACTCAC

>NZ_CP041297|1|1|16719-16926|CRISPRCasFinder
CCTAAAAATCGCCTGTGCGATTACTCAC	GATACATGGAAATCTTGGATTACTCCAGTCAA
CCTAAAAATCGCCTGTGCGATTACTCAC	AGATTTCCATGAAGGAATTTTATTCTCTTAGA
CCTAAAAATCGCCTATGCGATTACTCAC	CGTATCTTGGCATTTGATAAATGCCGTTTGAA
CCTAAAAATCGCCTATGCGATTACTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041297.1\|WP_168370873.1\|13046_13625_-\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	unknown	unknown	gnl\|CDD\|182350
NZ_CP041297.1\|WP_122902235.1\|7150_7357_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379188
NZ_CP041297.1\|WP_168370876.1\|18103_19429_+\|ISNCY-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP041297.1\|WP_122902233.1\|7829_10736_-\|relaxase/mobilization-nuclease-domain-containing-protein	unknown	unknown	gnl\|CDD\|367497
NZ_CP041297.1\|WP_099143682.1\|22375_23083_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271193
NZ_CP041297.1\|WP_033134782.1\|17211_17526_-\|BrnA-antitoxin-family-protein	unknown	unknown	gnl\|CDD\|373040
NZ_CP041297.1\|WP_005086328.1\|17488_17800_-\|BrnT-family-toxin	unknown	unknown	gnl\|CDD\|225481
NZ_CP041297.1\|WP_001366550.1\|24587_25325_+\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|239736
NZ_CP041297.1\|WP_168370875.1\|16369_16624_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP041297.1\|WP_024160783.1\|23272_24439_+\|tetracycline-inactivating-monooxygenase-Tet(X)	unknown	unknown	gnl\|CDD\|223727
NZ_CP041297.1\|WP_122902234.1\|7554_7809_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041297.1\|WP_001067784.1\|20534_21239_-\|IS6-like-element-IS1006-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP041297.1\|WP_168370877.1\|19582_20515_+\|SEL1-like-repeat-protein	unknown	unknown	gnl\|CDD\|223861
NZ_CP041297.1\|WP_168370872.1\|11729_13025_-\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|176454
NZ_CP041297.1\|WP_122902244.1\|10732_11053_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041297.1\|WP_168370871.1\|11327_11702_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041297.1\|WP_168370874.1\|14029_14389_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041297.1\|WP_001120888.1\|25756_27250_+\|IS91-family-transposase	unknown	unknown	gnl\|CDD\|377437
NZ_CP041297.1\|WP_000743213.1\|25321_25546_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041297.1\|WP_168370870.1\|4031_6908_+\|HsdR-family-type-I-site-specific-deoxyribonuclease	unknown	unknown	gnl\|CDD\|223683

Protein	Function_ID	Function_description	E-value
NZ_CP041297.1\|WP_168370873.1\|13046_13625_-\|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	1.44298e-36
NZ_CP041297.1\|WP_122902235.1\|7150_7357_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|379188	pfam13443, HTH_26, Cro/C1-type HTH DNA-binding domain. This is a helix-turn-helix domain that probably binds to DNA.	7.0821e-15
NZ_CP041297.1\|WP_168370876.1\|18103_19429_+\|ISNCY-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.15935e-07
NZ_CP041297.1\|WP_122902233.1\|7829_10736_-\|relaxase/mobilization-nuclease-domain-containing-protein	gnl\|CDD\|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	7.58746e-11
NZ_CP041297.1\|WP_033134782.1\|17211_17526_-\|BrnA-antitoxin-family-protein	gnl\|CDD\|373040	pfam14384, BrnA_antitoxin, BrnA antitoxin of type II toxin-antitoxin system. BrnA is family of antitoxins that neutralizes the toxin BrnT, pfam04365. It consists of 3 alpha-helices and a C-terminal ribbon-helix-helix DNA binding domain. As in other toxin-antitoxin systems, BrnA negatively autoregulates the brnTA operon and has higher affinity for the DNA operator when complexed with BrnT. It dimerizes with two molecules of its toxin BrnT.	5.30787e-19
NZ_CP041297.1\|WP_005086328.1\|17488_17800_-\|BrnT-family-toxin	gnl\|CDD\|225481	COG2929, COG2929, Uncharacterized protein conserved in bacteria [Function unknown].	4.30856e-31
NZ_CP041297.1\|WP_001366550.1\|24587_25325_+\|recombinase-family-protein	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	1.49475e-56
NZ_CP041297.1\|WP_168370875.1\|16369_16624_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	5.3393e-10
NZ_CP041297.1\|WP_024160783.1\|23272_24439_+\|tetracycline-inactivating-monooxygenase-Tet(X)	gnl\|CDD\|223727	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion].	5.52875e-35
NZ_CP041297.1\|WP_001067784.1\|20534_21239_-\|IS6-like-element-IS1006-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.08648e-71
NZ_CP041297.1\|WP_168370877.1\|19582_20515_+\|SEL1-like-repeat-protein	gnl\|CDD\|223861	COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only].	3.76197e-45
NZ_CP041297.1\|WP_168370872.1\|11729_13025_-\|DUF4113-domain-containing-protein	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	2.15636e-141
NZ_CP041297.1\|WP_099143682.1\|22375_23083_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271193	cd01193, INT_IntI_C, Integron integrase and similar protiens, C-terminal catalytic domain. Integron integrases mediate site-specific DNA recombination between a proximal primary site (attI) and a secondary target site (attC) found within mobile gene cassettes encoding resistance or virulence factors. Unlike other site specific recombinases, the attC sites lack sequence conservation. Integron integrase exhibits broader DNA specificity by recognizing the non-conserved attC sites. The structure shows that DNA target site recognition are not dependent on canonical DNA but on the position of two flipped-out bases that interact in cis and in trans with the integrase. Integron-integrases are present in many natural occurring mobile elements, including transposons and conjugative plasmids. Vibrio, Shewanella, Xanthomonas, and Pseudomonas species harbor chromosomal super-integrons. All integron-integrases carry large inserts unlike the TnpF ermF-like proteins also seen in this group.	5.09149e-68
NZ_CP041297.1\|WP_001120888.1\|25756_27250_+\|IS91-family-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	3.74932e-45
NZ_CP041297.1\|WP_168370870.1\|4031_6908_+\|HsdR-family-type-I-site-specific-deoxyribonuclease	gnl\|CDD\|223683	COG0610, COG0610, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	1.36758e-162

>NZ_CP041297.1|WP_168370875.1|16369_16624_+|helix-turn-helix-domain-containing-protein
MATRKEIGEKIKLARKNLGYTQKNVSEKSGVNKTTISEIENGHFTGSFDLFEKVLSCVDLQFEVVPKKHTLPQWDEIELLFREN
>NZ_CP041297.1|WP_168370874.1|14029_14389_-|hypothetical-protein
MSPHSQQIDRSRLLAKASWKAAEQLGLKPEQFLRILNLEGVDGEFSELQTLDPNSQSGEIALIVIRIYRAVYSLNGGDIKWMHHFLNSPNSLTGGVPIEQMESMNGLLSVLKAVEAFPC
>NZ_CP041297.1|WP_168370873.1|13046_13625_-|translesion-error-prone-DNA-polymerase-V-autoproteolytic-subunit
MNNKRGGIREGAGRKLKYNEPTKTVRVPISKVIEIKDYLNKADSQCLNDVALITSVQPSTYMQIPLAAEKIAAGFPSPAQDYVDKTLDMNEHLISNEATTFIVKVASLSMRDAGIEIDDELVVDRSLEAKHEDIVIALIDNDFTVKRLMIEGDYHWLKAENPDCSDIHLRDGQEMVIWGVVTYVIKPFRKRK
>NZ_CP041297.1|WP_168370872.1|11729_13025_-|DUF4113-domain-containing-protein
MAYTNKIFALVDINNCYVSCERIFNPGLNNKPVIVLSNNDGCAVALSQEAKDLGIKMGVPFFQIKDIVEQHKVQVLSSNYALYAEMSRRFMKVLSDFVTPEEQEVYSIDECFLDLTAYTKKYDLTDYAQTIRQRIFTWLGLPVCIGLGRTKTEAKMANHIAKKNTYFNGVCNLVAMDFCAIESLYETIEAGEIWGVGRKHTNKLNSLNIYSVLDFVMASPFMIRDQFSIVMHRTLLELHGVSCIELEHTQAPRKQIVASRSFGQRIYHIDDLKEAMSLYVQDAVARLRGENMLCGYMIGFVQSNPFDTHRPYYSKSAALTLPEPTDNVLTLCKIAIKMIDDLYQKDVGFKKCGVILTCLEPKSSHIYDLFTDMKQVDLDNILMDSLEEIHHKFGKTKLALGASMLPNRTWNMSRDQLSQNYFQWDQLLCVK
>NZ_CP041297.1|WP_168370871.1|11327_11702_+|hypothetical-protein
MMQDQNVLELDIQNPDNINSEFSTDNSFEAPQESNSKASKLVEKNQKIYSKNDSKNFENILLCYIKELNEKTITRNQLLTQHKQTLLQLFGLGATTGEVLDFLKRNNFTGISEENLKEFLKKKK
>NZ_CP041297.1|WP_122902244.1|10732_11053_-|hypothetical-protein
MKKALRNKQIIIRLTEDEHRQITASCEVLHMNQADYIRKKIFNESQIILLEKQEIHDVRVIGIILAKIFEQLKGKRIIDDEVMEIKNLIEEIKMIVRRLNERVGKS
>NZ_CP041297.1|WP_122902233.1|7829_10736_-|relaxase/mobilization-nuclease-domain-containing-protein
MIIKVIPNTIDTSVDQRVHGLSDYIHDPKQARAHYLSEYIHQLHPSFDQDLLSEKCVYSNSRNFLEVPIYQKTETSKTISSNSRVIDPIVLKYQKIEMSQTASLNSRVIDPIVHMVGSFKKFEVPTVEQFEEQIDILAKHLGAEELQMQYAMHLDTDNVHFHLIVNKVHPFKKNEHHENKVIDLGEGWILNAVHRATAEIEAKQGWEPEPNPVFIYNHETGQCEKNPDYVPQPDAEKIYSKIRDQEHRHQQKSRMSSEIAVGTNYQRYIESDIQQVMSSAKNWKDWHERLAEIGILYEKKRNGSIFKIQTSEKQTLTFKASLFCNKQVTLKNLEKRWGDFTHPDVDHKIIPLIKLSDNIQHVQSAKTTLHSYHLFKNEDFLVKDLHDAYLIMKSEKDSISTKRKNGYQKISLKNEIYKHDKHHFLNDLQQQFTEQSSDVIFTLLHYHHIADQINSRALQRKKYNVQHESLSQKTSQTLQKSFPFSSSFDSSKITSYADFLKFFPPSHHLLMQQQFLFDQRQSKNFICQDNPEIKTARIIFDQHQPNEPIAIQNQYGILVFSNYSLTRLQQCIKALDSNQKETLRGTSEFKELFHIALQHRTQNIADINKERVLPSFEHLSQNNIESCFTELFKRFMSTHASQSTAIIKTCLLLNCCGIKMKSLQSTLENCIDQNKLLNLSSENQSILLLRVRNLVYTQPIKLNKQYFNSTEIEQTWQLYFNLQTSPPILDEKQKYRTKMISSIPIPELTLIPKNQANRTFQHTENLPELDFLQMQQYFEYSRRTQLKKKQEAEFLNTFEPKKQISIPPQQTQKILFPRKKYIIEYKFGQKFYLDQKKIAFFETKDSTHIAVVSEQNVHIRDALFLAKEKYGTVYVYGDENFKSQVKLIAEEYNIPIVLQQESNQVIIQQESPPLPVPQTLPLSLEERDSSLPTVEERAEDFYSRQTVGYTTSKKKNIHSQDNDLNYGL
>NZ_CP041297.1|WP_122902234.1|7554_7809_+|hypothetical-protein
MVTSNELWVSRKAKLLGYKLIKELNVGMGFGIASYLDVNHCYNNHQAVLVWLEHFLEDYPEIQSIDPLKTEFLKNFPESFYELA
>NZ_CP041297.1|WP_122902235.1|7150_7357_-|helix-turn-helix-transcriptional-regulator
MIRCKLANLMGERKILKLSDVVHATGINRNTLTNMYYDRAVRIELPVADKLCEFFGCTMNDLFEYSDN
>NZ_CP041297.1|WP_168370870.1|4031_6908_+|HsdR-family-type-I-site-specific-deoxyribonuclease
MTVQSEYQLENELISQLKQLGYASVTLKDERQLLSNLKTQVERANGLAPLSETEWKQVISFLNTGIVFERAKNLRDLFPVKFDDGTSKHLFFLSDDPSKNIYQVTNQITIDHRDYNGRTSRFDVTILVNGLPLVQIELKKRGMEIAEAFNQTLRYTREAYWAGQGLFGFIQLFVISNGANTRYYSNGTTGIEFAFPWADISNKHINEIVDFAEAFLNQQHLTQMLTQYMVMLETTKSLMVLRPYQIYAVQKIVQHVQTSKNNGYIWHTTGSGKTLTSFKASQIIMKMPDVEKVLFVVDRNDLDTQTSREFNAFKADSVDSTDSTHTLVKQLDQRHDKLIVTTIQKLNRAISNDRYQEYINYLKDKKVVFIFDECHRSQFGDTHQNIKKFFANAQMFGFTGTPIFEENSQSKAGLKLTTDYLFHECLHKYVIVDAIRDRNVLQFQIDYRGKFTAKGMQNNLGYEDEVEGIDTKELYDTPKRLEMIARYIVDNNDIKTRNREFTAMFCVSSVETLTQYYEMFEKVQAEKQKQDEEQGRLFKPLTIATIFSYAANEAVPVDEQNGLIQEEAADIPSQINQSSRDKLDRYIAQYNQQFKTNYNSGDQFYAYYRDIADRVKKKQIDILLVVNMFLTGFDSKPLNTLYVDKNLKYHGLIQAFSRTNRVYNDKKPFGNIICFRNLKRATDEALALFSNKDAQKVVLVPSFEEIKQDYDAAVQKLLKITPDYQSVDDLMTEDQQLEFIKAFREVMRYNAQLQTFIEYDQNQTALDKQHFANFASKYADLCRDVRKTTKKEKVSVLDDVDFQLDLLHSDRINVGYIINLLQMALDSGDEAKRKKYEAQVYDLIGNDVNLHDKQELIQKFIEENMPKMINGQSVQSAFSAFWDTEKEQAYQHLCEVENLKPEVMKNVLEHYEFTKRLPRKEELKDLPNYKVKLFERDNVFSNLLVKTQQLIEKFYVSF
>NZ_CP041297.1|WP_033134782.1|17211_17526_-|BrnA-antitoxin-family-protein
MSKTVTYKMDLNNPPVLSEEQKARLEALAKRPDSEIDFSDIPELDESFWKNAVQNPFYKPTKQVTTVRIDADVMQWLKAQGKGYQTRMNKILRDAMLNDLKNHP
>NZ_CP041297.1|WP_005086328.1|17488_17800_-|BrnT-family-toxin
MEIEFSWDEHKAEINLKKHGVAFEDATLVFYDAHALYKQDRFENGEYRWQAIGMVHGQAVLLVAHTVQDHNGMDHIRIISARQAEKKERKQYEQNRYLQNGFE
>NZ_CP041297.1|WP_168370876.1|18103_19429_+|ISNCY-family-transposase
MSDKELKRLSVLQEICDQRITQSQAAQLLHISERQIRRLLQKYKAQGPAALAHAGRGQISNSKLPEELRLKCLNIVSDQLHGFGPTLAHEKLTTVHGFDLSVETLRSWMIAADLWMPRSKRLKRPYQPRYNRDCFGELIQIDGSHHDWFEGRAAKCCLLVFIDDATGKLQHLRFCESESTFDYMISTRLYVEQHGKPLAFYSDKHSVFRVNQSSKKDTKITQFGRVLSTLNIDIIFANSPQAKGRVERANRTLQDRLIKEMRLKGICSIEQANVWLPCFIEQFNQKFAKMAFNPKNLHRPIMETAEELDDIFTWREPRRVTNSLTITYDKCVYLLENKEENQSLMGKYIEFLEYPDGTVAIEYQGRKINYSIFDKLSQLNQREIVENKRLSSVLAHIQQQHEELEQQNKRSRSQSMPRRRAQKTAIQQRNLNPVLDLEMSV
>NZ_CP041297.1|WP_168370877.1|19582_20515_+|SEL1-like-repeat-protein
MLHKKNIFLSLMLALSFSSAFAQVNSFDKTLASATQGDASAQYNLGVMYANGQGVAQNYAKAFEWYSKAATQGYAVAQYNLGVMYDNGQGVAQSDLKAFEWYSKAAAQGYAAAQYNLGVMYAKGQGVAQSDLKAFEWFNKSAAQGHALAQYNLGVMYTNGQGVAQSDLKAFEWFNKSAAQGYAAAQYNIGAMYEYGQGVAQNYAKAFEWYSKAAAQGHASAQTNLGVMYASGKGVEQSYARAFEWFNKSAAQGNASGYYNLGLMYDKGNGVKQNFAKAFELYNKAATDGNRNAQYTLGIMGTVANRDLSR
>NZ_CP041297.1|WP_001067784.1|20534_21239_-|IS6-like-element-IS1006-family-transposase
MNPFHGRHFQGEIILWAVRWYCKYGISYRELQEMLAERGVNVDHTTIYRWVQRYAPEIEKRLRWYWRNPTDLSSWHIDETYVKVNGRWSYLYRAVDQRGDTIDFYLSSRRNTKSAYCFLGKILNNVKKWQIPQVINTDKAPTYGRALSRLKREGKCPPDLEHRQIKYKNNVIECDHGKLKRIIRATLGFKSMKTAYATIKGIEVMRALRKGQASSFYYGQPQGEVCLINRVFGL
>NZ_CP041297.1|WP_099143682.1|22375_23083_+|tyrosine-type-recombinase/integrase
MNEGHIQSFLRHLVMERKVSISYQNQAINAIKFYYERVLGGQRKTYFIERPKKEKTLPVVMSEEETIRVLRAIENVKHKAILMTIYSAGLRISECINLKIKDIDSKRMQIRIEQSKGKRDRYTILSEKTLIILRTYFMEYKPKDYLFEGQKGGAYSSRSIQNIFKAAVLKAKIQKEVTVHTLRHSFATHLLENGTSLRYIQSLLGHSSSKTTEVYTHITTKGMEQLKSPMDLLDI
>NZ_CP041297.1|WP_024160783.1|23272_24439_+|tetracycline-inactivating-monooxygenase-Tet(X)
MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVILANGGMSKIRSFVTDTQVEETGTFNIQADILQPEINCPGFFQLCNGNRLMAGHQGILLFANPNNNGALYLGISFKTPDEWKNKIPLDFQDRNSVADFLLKRFSKWSEVYKQLIRSVSTFQCLPTRKFPLNNDWKSNRPLPITMIGDAAHLMSPFAGQGVNTGLLDALILSENLTNGEFTSIENAIENYEQQMFVYAKDTQDESTENETEMFSPNFSFQKLLNL
>NZ_CP041297.1|WP_001366550.1|24587_25325_+|recombinase-family-protein
MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVAGIYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGARLAVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELARQAGRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQHGAFVEDALTEADALAAVGQDERQEERA
>NZ_CP041297.1|WP_000743213.1|25321_25546_+|hypothetical-protein
MKKPNQDDEPFFITEEIAAEMIAGGYEFELPPIPCTIRLRDVLERMTDAELALQPGEIADQERERCRRKPCSTS
>NZ_CP041297.1|WP_001120888.1|25756_27250_+|IS91-family-transposase
MPHVAARTASRDRDTGRYQSHRPEQTLLYQIVDEYYPAFAALMAEQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAFSCKRRGFCPSCGARRMAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVLGIVYRVIATHLVKKAGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGSARFRWVKAPTSPELTQLTHTIAHRVGRYLERQGLLERDVENSYLASDAVDDDPMTPLLGHSITYRIAVGSQAGRKVFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCRYISRPAVSEKRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTRFHGVFAPNSRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETCSGCGGAMKVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041297_1	1.1\|16748\|31\|NZ_CP041297\|PILER-CR	16748-16778	31	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16747-16777	0	1.0
NZ_CP041297_1	1.2\|16808\|31\|NZ_CP041297\|PILER-CR	16808-16838	31	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16807-16837	0	1.0
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16867-16897	0	1.0
NZ_CP041297_1	1.4\|16747\|32\|NZ_CP041297\|CRISPRCasFinder	16747-16778	32	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16747-16778	0	1.0
NZ_CP041297_1	1.5\|16807\|32\|NZ_CP041297\|CRISPRCasFinder	16807-16838	32	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16807-16838	0	1.0
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP041297	Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence	16867-16898	0	1.0
NZ_CP041297_1	1.1\|16748\|31\|NZ_CP041297\|PILER-CR	16748-16778	31	NZ_CP044459	Acinetobacter indicus strain B18 plasmid pB18-4, complete sequence	23187-23217	2	0.935
NZ_CP041297_1	1.1\|16748\|31\|NZ_CP041297\|PILER-CR	16748-16778	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	206854-206884	2	0.935
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	58264-58294	2	0.935
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	275948-275978	2	0.935
NZ_CP041297_1	1.4\|16747\|32\|NZ_CP041297\|CRISPRCasFinder	16747-16778	32	NZ_CP044459	Acinetobacter indicus strain B18 plasmid pB18-4, complete sequence	23187-23218	2	0.938
NZ_CP041297_1	1.4\|16747\|32\|NZ_CP041297\|CRISPRCasFinder	16747-16778	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	206854-206885	2	0.938
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	58263-58294	2	0.938
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	275947-275978	2	0.938
NZ_CP041297_1	1.2\|16808\|31\|NZ_CP041297\|PILER-CR	16808-16838	31	NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	63467-63497	3	0.903
NZ_CP041297_1	1.2\|16808\|31\|NZ_CP041297\|PILER-CR	16808-16838	31	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	281151-281181	3	0.903
NZ_CP041297_1	1.5\|16807\|32\|NZ_CP041297\|CRISPRCasFinder	16807-16838	32	NZ_CP044456	Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence	63467-63498	3	0.906
NZ_CP041297_1	1.5\|16807\|32\|NZ_CP041297\|CRISPRCasFinder	16807-16838	32	NZ_CP039144	Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence	281151-281182	3	0.906
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	81800-81830	8	0.742
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	266090-266120	8	0.742
NZ_CP041297_1	1.3\|16868\|31\|NZ_CP041297\|PILER-CR	16868-16898	31	NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	1494719-1494749	8	0.742
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	81800-81831	8	0.75
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	266090-266121	8	0.75
NZ_CP041297_1	1.6\|16867\|32\|NZ_CP041297\|CRISPRCasFinder	16867-16898	32	NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	1494718-1494749	8	0.75

1. spacer 1.1|16748|31|NZ_CP041297|PILER-CR matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

gatacatggaaatcttggattactccagtca	CRISPR spacer
gatacatggaaatcttggattactccagtca	Protospacer
*******************************

2. spacer 1.2|16808|31|NZ_CP041297|PILER-CR matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

agatttccatgaaggaattttattctcttag	CRISPR spacer
agatttccatgaaggaattttattctcttag	Protospacer
*******************************

3. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cgtatcttggcatttgataaatgccgtttga	Protospacer
*******************************

4. spacer 1.4|16747|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

gatacatggaaatcttggattactccagtcaa	CRISPR spacer
gatacatggaaatcttggattactccagtcaa	Protospacer
********************************

5. spacer 1.5|16807|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

agatttccatgaaggaattttattctcttaga	CRISPR spacer
agatttccatgaaggaattttattctcttaga	Protospacer
********************************

6. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP041297 (Acinetobacter indicus strain 80-1-2 plasmid p80-1-2-tetX3, complete sequence) position: , mismatch: 0, identity: 1.0

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cgtatcttggcatttgataaatgccgtttgaa	Protospacer
********************************

7. spacer 1.1|16748|31|NZ_CP041297|PILER-CR matches to NZ_CP044459 (Acinetobacter indicus strain B18 plasmid pB18-4, complete sequence) position: , mismatch: 2, identity: 0.935

gatacatggaaatcttggattactccagtca	CRISPR spacer
gatacatggaaatcttggattactccaatta	Protospacer
***************************.*.*

8. spacer 1.1|16748|31|NZ_CP041297|PILER-CR matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 2, identity: 0.935

gatacatggaaatcttggattactccagtca	CRISPR spacer
gatacatggaaatcttggattactccaatta	Protospacer
***************************.*.*

9. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP044456 (Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence) position: , mismatch: 2, identity: 0.935

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cgtattctggcatttgataaatgccgtttga	Protospacer
*****..************************

10. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 2, identity: 0.935

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cgtattctggcatttgataaatgccgtttga	Protospacer
*****..************************

11. spacer 1.4|16747|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP044459 (Acinetobacter indicus strain B18 plasmid pB18-4, complete sequence) position: , mismatch: 2, identity: 0.938

gatacatggaaatcttggattactccagtcaa	CRISPR spacer
gatacatggaaatcttggattactccaattaa	Protospacer
***************************.*.**

12. spacer 1.4|16747|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 2, identity: 0.938

gatacatggaaatcttggattactccagtcaa	CRISPR spacer
gatacatggaaatcttggattactccaattaa	Protospacer
***************************.*.**

13. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP044456 (Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence) position: , mismatch: 2, identity: 0.938

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cgtattctggcatttgataaatgccgtttgaa	Protospacer
*****..*************************

14. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 2, identity: 0.938

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cgtattctggcatttgataaatgccgtttgaa	Protospacer
*****..*************************

15. spacer 1.2|16808|31|NZ_CP041297|PILER-CR matches to NZ_CP044456 (Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence) position: , mismatch: 3, identity: 0.903

agatttccatgaaggaattttattctcttag	CRISPR spacer
aagtttctatgaaggaattttattctcttag	Protospacer
*..****.***********************

16. spacer 1.2|16808|31|NZ_CP041297|PILER-CR matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 3, identity: 0.903

agatttccatgaaggaattttattctcttag	CRISPR spacer
aagtttctatgaaggaattttattctcttag	Protospacer
*..****.***********************

17. spacer 1.5|16807|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP044456 (Acinetobacter indicus strain B18 plasmid pB18-1, complete sequence) position: , mismatch: 3, identity: 0.906

agatttccatgaaggaattttattctcttaga	CRISPR spacer
aagtttctatgaaggaattttattctcttaga	Protospacer
*..****.************************

18. spacer 1.5|16807|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP039144 (Acinetobacter sp. 10FS3-1 plasmid p10FS3-1-1, complete sequence) position: , mismatch: 3, identity: 0.906

agatttccatgaaggaattttattctcttaga	CRISPR spacer
aagtttctatgaaggaattttattctcttaga	Protospacer
*..****.************************

19. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP046163 (Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence) position: , mismatch: 8, identity: 0.742

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cttatcgtggcattttataaatgccggggag	Protospacer
* **** ******** **********   ..

20. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP046066 (Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence) position: , mismatch: 8, identity: 0.742

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cttatcgtggcattttataaatgccggggag	Protospacer
* **** ******** **********   ..

21. spacer 1.3|16868|31|NZ_CP041297|PILER-CR matches to NZ_CP045356 (Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence) position: , mismatch: 8, identity: 0.742

cgtatcttggcatttgataaatgccgtttga	CRISPR spacer
cttatcgtggcattttataaatgccggggag	Protospacer
* **** ******** **********   ..

22. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP046163 (Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence) position: , mismatch: 8, identity: 0.75

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cttatcgtggcattttataaatgccggggaga	Protospacer
* **** ******** **********   ..*

23. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP046066 (Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence) position: , mismatch: 8, identity: 0.75

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cttatcgtggcattttataaatgccggggaga	Protospacer
* **** ******** **********   ..*

24. spacer 1.6|16867|32|NZ_CP041297|CRISPRCasFinder matches to NZ_CP045356 (Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence) position: , mismatch: 8, identity: 0.75

cgtatcttggcatttgataaatgccgtttgaa	CRISPR spacer
cttatcgtggcattttataaatgccggggaga	Protospacer
* **** ******** **********   ..*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1491

Staphylococcus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168370867.1\|270_1491_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.9e-59	36.7

DBSCAN-SWA_2

7150 : 7357

Fusobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_122902235.1\|7150_7357_-	helix-turn-helix transcriptional regulator	A0A0E3U244	Fusobacterium_phage	2.4e-07	38.5

DBSCAN-SWA_3

11729 : 13625

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168370872.1\|11729_13025_-	DUF4113 domain-containing protein	A0A2H4JBL5	uncultured_Caudovirales_phage	1.3e-146	57.0
WP_168370873.1\|13046_13625_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	3.1e-52	55.6

DBSCAN-SWA_4

20534 : 23083

Escherichia_phage(50.0%)

integrase,transposase

attL 21302:21361|attR 26419:27485

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067784.1\|20534_21239_-\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	1.9e-120	85.8
21302:21361	attL	NA	NA	NA	NA
WP_099143682.1\|22375_23083_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.2e-31	35.8
WP_099143682.1\|22375_23083_+\|integrase	tyrosine-type recombinase/integrase	S5W9T9	Leptospira_phage	6.2e-31	35.8
26419:27485	attR	NA	NA	NA	NA

DBSCAN-SWA_5

27814 : 28630

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001043260.1\|27814_28630_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6

DBSCAN-SWA_6

33258 : 34038

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058199817.1\|33258_34038_+	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	3.1e-31	35.5

DBSCAN-SWA_7

37972 : 38677

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067858.1\|37972_38677_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6

DBSCAN-SWA_8

43353 : 49979

uncultured_Caudovirales_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005146104.1\|43353_44841_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	6.4e-219	79.6
WP_002115246.1\|44853_45705_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	5.5e-66	45.2
WP_120376091.1\|45950_46517_-	recombinase family protein	Q2A092	Sodalis_phage	3.1e-25	38.4
WP_122902243.1\|48247_49162_-	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	9.0e-14	36.5
WP_171407328.1\|49178_49979_-	AAA family ATPase	Q8JL10	Natrialba_phage	8.4e-16	36.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP041295

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041295_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041295_1

1213578-1213789

Orphan

I-F:NA

Consensus_repeat	Method
GTTCACTGCCATGTAGGCAGCTTAGAAAA	CRISPRCasFinder
TAGGCAGCTTAGAAAATTC	CRT

3 spacers

The CRISPR arrays of NZ_CP041295_1

>merge|NZ_CP041295|1|1213578-1213789|CRISPRCasFinder,CRT
ATACGACCCCATACAGGCAGCTTAGAAAATTCCGCTCTGCTGGCTGGAAATACCTGTCTAGTTCACTGCCATATAGGCAGCTTAGAAAATTCGCCAAAGCAAGCAGCGCCTCTTCACCACGTTCACTGCCATGTAGGCAGCTTAGAAAATTGTCACGAACTCCCCCAACAATAAGCGCAGGTTCACTGCCATGTAGGCAGCTTAAAAACACC

>NZ_CP041295|1|1|1213578-1213786|CRISPRCasFinder
ATACGACCCCATACAGGCAGCTTAGAAAA	TTCCGCTCTGCTGGCTGGAAATACCTGTCTA
GTTCACTGCCATATAGGCAGCTTAGAAAA	TTCGCCAAAGCAAGCAGCGCCTCTTCACCAC
GTTCACTGCCATGTAGGCAGCTTAGAAAA	TTGTCACGAACTCCCCCAACAATAAGCGCAG
GTTCACTGCCATGTAGGCAGCTTAAAAAC

>NZ_CP041295|1|1|1213591-1213789|CRT
CAGGCAGCTTAGAAAATTC	CGCTCTGCTGGCTGGAAATACCTGTCTAGTTCACTGCCATA
TAGGCAGCTTAGAAAATTC	GCCAAAGCAAGCAGCGCCTCTTCACCACGTTCACTGCCATG
TAGGCAGCTTAGAAAATTG	TCACGAACTCCCCCAACAATAAGCGCAGGTTCACTGCCATG
TAGGCAGCTTAAAAACACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041295.1\|WP_005177351.1\|1219579_1219870_+\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	unknown	unknown	gnl\|CDD\|237504
NZ_CP041295.1\|WP_016658268.1\|1220665_1221166_+\|phenylacetate-CoA-oxygenase-subunit-PaaJ	unknown	unknown	gnl\|CDD\|131214
NZ_CP041295.1\|WP_168370461.1\|1201468_1203622_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|227114
NZ_CP041295.1\|WP_075174494.1\|1221205_1222264_+\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	unknown	unknown	gnl\|CDD\|131215
NZ_CP041295.1\|WP_168370462.1\|1208219_1210679_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NZ_CP041295.1\|WP_075174493.1\|1219881_1220637_+\|phenylacetate-CoA-oxygenase-subunit-PaaC	unknown	unknown	gnl\|CDD\|368300
NZ_CP041295.1\|WP_075166740.1\|1204982_1205429_-\|protein-TolR	unknown	unknown	gnl\|CDD\|274306
NZ_CP041295.1\|WP_075174492.1\|1218598_1219543_+\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	unknown	unknown	gnl\|CDD\|184320
NZ_CP041295.1\|WP_104489730.1\|1211916_1212906_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP041295.1\|WP_104470846.1\|1213091_1213520_+\|transposase	unknown	unknown	gnl\|CDD\|225511
NZ_CP041295.1\|WP_168370463.1\|1210996_1211920_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP041295.1\|WP_104470849.1\|1206193_1208161_-\|phytase	unknown	unknown	gnl\|CDD\|226698
NZ_CP041295.1\|WP_016658266.1\|1222288_1223059_+\|enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|182026
NZ_CP041295.1\|WP_168370464.1\|1214595_1216020_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340886
NZ_CP041295.1\|WP_168369519.1\|1204191_1204986_-\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|367555
NZ_CP041295.1\|WP_104489727.1\|1205435_1206122_-\|protein-TolQ	unknown	unknown	gnl\|CDD\|131843
NZ_CP041295.1\|WP_168370465.1\|1216219_1218337_-\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	unknown	unknown	gnl\|CDD\|236931
NZ_CP041295.1\|WP_104494800.1\|1200792_1201404_-\|DUF4198-domain-containing-protein	unknown	unknown	gnl\|CDD\|378467
NZ_CP041295.1\|WP_160241378.1\|1223058_1223850_+\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	unknown	unknown	gnl\|CDD\|236163
NZ_CP041295.1\|WP_005177343.1\|1213833_1214328_-\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854

Protein	Function_ID	Function_description	E-value
NZ_CP041295.1\|WP_005177351.1\|1219579_1219870_+\|1,2-phenylacetyl-CoA-epoxidase-subunit-B	gnl\|CDD\|237504	PRK13781, paaB, phenylacetate-CoA oxygenase subunit PaaB; Provisional.	5.76461e-63
NZ_CP041295.1\|WP_016658268.1\|1220665_1221166_+\|phenylacetate-CoA-oxygenase-subunit-PaaJ	gnl\|CDD\|131214	TIGR02159, Putative_12-phenylacetyl-CoA_epoxidase_subunit_D, phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	2.22331e-59
NZ_CP041295.1\|WP_168370461.1\|1201468_1203622_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|227114	COG4773, FhuE, Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid [Inorganic ion transport and metabolism].	3.01116e-173
NZ_CP041295.1\|WP_075174494.1\|1221205_1222264_+\|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK	gnl\|CDD\|131215	TIGR02160, 12-phenylacetyl-CoA_epoxidase_subunit_E, phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA. [Energy metabolism, Other].	1.16636e-135
NZ_CP041295.1\|WP_168370462.1\|1208219_1210679_-\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	0
NZ_CP041295.1\|WP_075174493.1\|1219881_1220637_+\|phenylacetate-CoA-oxygenase-subunit-PaaC	gnl\|CDD\|368300	pfam05138, PaaA_PaaC, Phenylacetic acid catabolic protein. This family includes proteins such as PaaA and PaaC that are part of a catabolic pathway of phenylacetic acid. These proteins may form part of a dioxygenase complex.	6.68003e-109
NZ_CP041295.1\|WP_075166740.1\|1204982_1205429_-\|protein-TolR	gnl\|CDD\|274306	TIGR02801, Protein_TolR, TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score. [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	1.68688e-46
NZ_CP041295.1\|WP_075174492.1\|1218598_1219543_+\|1,2-phenylacetyl-CoA-epoxidase-subunit-A	gnl\|CDD\|184320	PRK13778, paaA, phenylacetate-CoA oxygenase subunit PaaA; Provisional.	0
NZ_CP041295.1\|WP_104489730.1\|1211916_1212906_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.9677e-06
NZ_CP041295.1\|WP_104470846.1\|1213091_1213520_+\|transposase	gnl\|CDD\|225511	COG2963, COG2963, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.56678e-08
NZ_CP041295.1\|WP_168370463.1\|1210996_1211920_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.51308e-21
NZ_CP041295.1\|WP_104470849.1\|1206193_1208161_-\|phytase	gnl\|CDD\|226698	COG4247, Phy, 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism].	6.24154e-79
NZ_CP041295.1\|WP_016658266.1\|1222288_1223059_+\|enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|182026	PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional.	5.43773e-110
NZ_CP041295.1\|WP_168370464.1\|1214595_1216020_-\|MFS-transporter	gnl\|CDD\|340886	cd17328, MFS_spinster_like, Protein spinster and spinster homologs of the Major Facilitator Superfamily of transporters. The protein spinster family includes Drosophila protein spinster, its vertebrate homologs, and similar proteins. Humans contain three homologs called protein spinster homologs 1 (SPNS1), 2 (SPNS2), and 3 (SPNS3). Protein spinster and its homologs may be sphingolipid transporters that play central roles in endosomes and/or lysosomes storage. SPNS2 is also called sphingosine 1-phosphate (S1P) transporter and is required for migration of myocardial precursors. S1P is a secreted lipid mediator that plays critical roles in cardiovascular, immunological, and neural development and function. The spinster-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.24295e-66
NZ_CP041295.1\|WP_168369519.1\|1204191_1204986_-\|energy-transducer-TonB	gnl\|CDD\|367555	pfam03544, TonB_C, Gram-negative bacterial TonB protein C-terminal. The TonB_C domain is the well-characterized C-terminal region of the TonB receptor molecule. This protein is bound to an inner membrane-bound protein ExbB via a globular domain and has a flexible middle region that is likely to help in positioning the C-terminal domain into the iron-transporter barrel in the outer membrane. TonB_C interacts with the N-terminal TonB box of the outer membrane transporter that binds the Fe3+-siderophore complex. The barrel of the transporter, consisting of 22 beta-sheets and an inside plug, binds the iron complex in the barrel entrance.	1.09991e-13
NZ_CP041295.1\|WP_104489727.1\|1205435_1206122_-\|protein-TolQ	gnl\|CDD\|131843	TIGR02796, Protein_TolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	2.40146e-78
NZ_CP041295.1\|WP_168370465.1\|1216219_1218337_-\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	gnl\|CDD\|236931	PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional.	0
NZ_CP041295.1\|WP_104494800.1\|1200792_1201404_-\|DUF4198-domain-containing-protein	gnl\|CDD\|378467	pfam10670, DUF4198, Domain of unknown function (DUF4198). This family was previously missannotated in Pfam as NikM.	2.73801e-08
NZ_CP041295.1\|WP_160241378.1\|1223058_1223850_+\|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase	gnl\|CDD\|236163	PRK08140, PRK08140, enoyl-CoA hydratase; Provisional.	9.63616e-160
NZ_CP041295.1\|WP_005177343.1\|1213833_1214328_-\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	4.20272e-64

>NZ_CP041295.1|WP_104470846.1|1213091_1213520_+|transposase
MDLKTVIDSTPTLKKPRRTFTAEFKHQLIQQCQQPDTSVAKVAMQHQINANLLHKWIRQSRSMVPSLTTPSNPQTDFLPVILYPTPVKQEAPPPPVPERKATAHIRIPLHDEQCSVRDQMIEIEWPVESATELLLLLQGLIK
>NZ_CP041295.1|WP_104489730.1|1211916_1212906_+|helix-turn-helix-transcriptional-regulator
MSYQNDQLILPTYLAPALLIDLAEMYGVNPNRILKGTPVFIEGLISVNQCVSVEQLIHMIRNLHESIMHPEVQFLFGQRYIETLTHPALNAIAYSQNIKEAIQRYVEFHIYLSPWLTPVAYYSDHKIILFWLNSQERHATSLVISAMTAVRTILLNSTQEELKMNYHFVGAEPEFIEQFWEHLGENIQFNSLVNAIQIDIQECTQKQNYQTSAMRQAYYHQAKVLQQQSGLEQSFLQEVHHFLIRNIHQAPNLEECAEYFQISIASFKRRLNKHNTSYQQMLDQARLFTSIQLKTLFAYNDEQVADYLNINDIHNFRRAFKRWSNVVVS
>NZ_CP041295.1|WP_168370463.1|1210996_1211920_+|diguanylate-cyclase
MLKPFLYYPRHFLLVMIMAIACLAFFMLSGNFKAHSEIQVIDVIGEGLACLLTLLWIYLILKSRPRGYVTRYFYWGLTFVFLALWMDVLDEFIAIPKTLVWDDLMESFTTPIGFIVLTIAMVNWHKEQLVLSRKLQTKEHVFRDHRLFDAITPLADAQYFKQQLQHEINQRHHSAKNIHLMMINIKDLSAINREFGFDTGNQVLSVIAQTISLNIRPCDLVCRLAGDKFILMLLDLADAQVEIMARELQKCIQSQIFYTHQDFQKFNIDCRYTISEVQQDSPATEIQKLYKQMKHQQIIKLRTRMSV
>NZ_CP041295.1|WP_168370462.1|1208219_1210679_-|TonB-dependent-receptor
MSTHCSNKTAAFTFKVSTLVLCMLATGHSLAAENATEYVRVIGQAASINEALKEQRKSNSISSVVHADAIAKLPDDNAAEALQRIPGVSTERDQGEGRFVTVRGLGTDLNAVTINGTLVPAPEASRRGVALDVLPAELVQSLTVIKTLTPDMDANSLGGTIQVESLSAFDHDGLFYTAAVEGGYDEKREEYSPKVSGAVSQKFSLGSGTDNFGVAAALSWQERTFGSDNVETGGKWEDGLLEETEMRQYDIERERLGAGLNFDFRPNKNSEYYLRTLYSRFQDNETRQAAGVEFSDPLAINTPGSAEVVRELKEREETQEIKSFVLGGKNRFDQWTLEAQLGYSEASEKNPGGIAGAGFVGEFDDLQYSSTRIPVVKGGASFYDPSQYELDEVEWEKSTAKDKEKNAKFDLSRDYLLNDYASIFKFGAKVSQRTKTNDTEIWKVEDLDTFPAHFGSNGHYELAQFGPTLSSGPIHNQLAQLNLNDWRDAEESVINDYKTSEDIHAAYVMNTIDFDRLRVIAGLRYEDTDFETQGYRILDGESSSVSTQNDYDHWLPSLHLKYQLSSDAILRAAWTNTVVRPNFEQSRPGIYIDGDEAEFGNPDLKALEASNFDLGVEKYFGDASVISMNAFYKDIDHFIYNANVAGTGDWTDFDEAMTFKNGSSAKIYGVELGYSQKWHNFIFGLNSTFSRAKADIDGMVDGELMTRTINFPSQSKVVGNAMIGWENDRVGLRLAANYKSRYLNEISGIDEPEKDLYTDDQVFVDLSGHVNFNKNIQLFFNAQNLTDEVYYNYNGNRHYNAQYEEYGPSYKVGLKFTHF
>NZ_CP041295.1|WP_104470849.1|1206193_1208161_-|phytase
MTMLFKLSTFCAALVALSGCASSAHTQKNTISSPLHLEQTVSALDQPALPVEQIFKLPITVEDAHWIEIDGLNAQVLTSSKTQGLSLWNSNAQRVQHIPGSFSKIDYRSIGQQLIIQTTDLLQQRPVIFRFDLNTGTWAKPVYLAARSFKTEDNCLYLTPDQSLYSFLVGEEGIGEQWMIQSGGSNQISPRFIRNMSLPPNSGFCVVDDHHDKLYINEEDVGIWAYETDPEADLIRYPVDLNHPHGSILGNVSGLSLIDNALAAMDESKAVLYRYRIEGTSWHKLPPLSLQNVDEPERISLKGTQDQKQLLLVDDQIKLLNIDWTTQALPPKKAGLAIPADVETDLVPSRGDAADDPAIWVNQANPRLSRVLGTDKQGGLAVYDLNGKQLQYLKVGRLNNVDIRPNFKLGQQTVDLAIATNRDQNSLHLFSIHQKTGQVKDLGELPTDLNNIYGFCMYQNRQGETFAIPNDKNGTFVQYKIQSKASGLSAEEVLRFKVSSQPEGCVVDDEHDRIYVGEEAKAVWTTRLDDPKQIQLKPVITVGEQVKADIEGLAIYKGQVRDYLVISSQGDDSYLIVDAAAPYQLRGKFKISANLNHEIDAVSETDGLEVTSANLGGIWKKGMLVVQDGRKRMPEGNQNYKYVAWEKIAQALGLE
>NZ_CP041295.1|WP_104489727.1|1205435_1206122_-|protein-TolQ
MSNPSAAQLSVWELISHASLLVQAVMLILLLASIISWYVIIKQSIRLRQETAANKVFLSQFRQQPFPLATTEPSEPKSGGLGQIYQAGLDEFNTLQHTSTRLSSAAVTDQVERRLLTSVSEQEEKLEKHLSFLATVGSVSPYIGLFGTVWGIMNSFIGLSQLEQATLSAVAPGIAEALIATAIGLFAAIPAVIAYNRLSARAEKISNSYYSFGNELQTRMLRFLQAGN
>NZ_CP041295.1|WP_075166740.1|1204982_1205429_-|protein-TolR
MQKRQKKHALNAEMNVVPYIDVMLVLLVIFMVTAPMLTQGIKVNLPNLEAETLVTPKEQKVITISIQEDGRYYWNVGESVDTAQVTDRATSLTEMKEKLSPLLQIHQDIQVFIRADRSANYELVAQTIGLLQQSGVEQLGLVTEEQDQ
>NZ_CP041295.1|WP_168369519.1|1204191_1204986_-|energy-transducer-TonB
MKSISRINPATAVAFSVTAFLHATLVYSVLNQNFDSPIQEVAPKSVQVKFVQLPKADISPQLQPEHAPTQEPAQSQVMPSAAAPVQSAPTQLAQSVKAKPASNQPAKARPEPSPQPKVASSPAVTDHTSTTMQTTAAVTHESPPAPAKPAATTQPAPFTSKPIVAENTQPPPVFDEKNYKPISKVKPDYPMRALENELEGNCTVEYSVNTQGQVVNPKALSDCDPIFVRPSLNAARQFKYQPRIVNGQAVEVAKIKNTFEYRIE
>NZ_CP041295.1|WP_168370461.1|1201468_1203622_-|TonB-dependent-siderophore-receptor
MSYIVHPSFKLSLLSLTILVSQQSFAEDTQQLATITMTAEPAKANQSSEHTQRYIIQNSATASKLDIPLKETPQTVNVVTRQQLDDFSLNNTRDVLRNSPGIMVSNQETERTSYLSRGFEISNVLVDGVGLPLEGYNYNNDNPDSFLFDRIEVVKGANALNNGIGDPGATINLIRKRPTQDFQAALNASYGSWNTQRYEVDVSSALTEDGRIRGRLFGYQQTGDSYLDRYSLEKNGVGAVLEADLTDTTLLTAGYSETQHQPNSVNWGSNPLINTEGEQLHYPQNYNYSPDWAYWDSNIKNYFAEIEQKLGGDWTAKLSYDKKRTKRDAKLLYLSGRPGADGTSGVFLYPGMYLDDNKQQQASLSFSGTYLLWGQRHEASVGYIWAENQLNELGYGGSFAQPLTTDLASFTPEEPSWDLSKTSGEMHIRQKNQSLYAATRLHLNEDLKVLLGANYVQAKSTGSSYGTDTIYDEDKVLPYAGLTYNFSPEYTGYLSYTSIFRPQTSKAADGNLNKPIEGESYEAGIKSSWLDDRLTATMAIFRTEQNNYPLRDSDGIPTLRKTQVSDLRSQGYEFSLAGQLSDHLNLSFGYTQFSLKDLINGGDARTFNPNQSFNLLTTYQVPQIPKLKLGLGLQWQDKTYLEVPESTTNGVTQQAGVIEQDAYALVNLMASYELNEHITLQANGNNLTNEKYLFNFPNQQGFYGAPANYSVAVKFKY
>NZ_CP041295.1|WP_104494800.1|1200792_1201404_-|DUF4198-domain-containing-protein
MKKMIALTMGLSMSLSAQAHMLWLERGPNAQTYAFFGEYSEQLKETQEGALKSFSQAKLVQAKKIYSPQRQQDHLIYATQDQADVKLSHELIYGESLLSYHAKAGRQHLKSESALDIIPAQRNSNTFTVLYQGKPAADLEVTVFSPQYWLKKYTTNSQGQITVATPWKGQYVLEVAKELDQAGTFNQQAYKKQYFVTTLSFVH
>NZ_CP041295.1|WP_005177343.1|1213833_1214328_-|DNA-starvation/stationary-phase-protection-protein
MAKMKKASMHIDIGISEDNRAKIVEGLSRLLADSYTLYLMTHNFHWNVTGPQFNSLHTMFMTQYTEQWNALDVIAERIRALGFPAPGTYKEFVKLASIEEVEGVPKANEMVELLVRAHETVARTARSIFDVVEEANDQPTADVLTQRLEVHEKTAWMLRSLLEE
>NZ_CP041295.1|WP_168370464.1|1214595_1216020_-|MFS-transporter
MNDKTLEIDAVERNIQPESKQFEAAHPIDLPATPSSQDSSSTYQWYVVIICMVAYILSFVDRQILSLMIEPIKADLMLSDTQFSLLQGLAFSLFYAFMGVPIAALADKKSRIKIISSGIAFWSLATAACGLSKNFIQMFLARLSVGAGEAALSPAFYSIVADLFPKEKLGRALGVYAIGAFIGSGLAFLIGGYVIGLLKEVDFVVLPLIGELKTWQLTFFIVGLPGVLLALVMILTVREPSRKGVKVGQDGEVVKASFKNSVAFIKLHKKTFFCHFIGFSFYTMMLYSLLGWAPAYYMRHFGLDASQTGYVLGCIILVANTAGALLCGWLIDFFSKRGYSDAAIRAGALGCAALIIPSVLFTQVDNLYLSFALIFVAMFFSTFPIPASAAATQMLTPNQLRAQVSAKFLLISNLIALGVGTTAVALITDNYFENTLMVGHSISIVNAVAGVIGVFLLYKGCRYYRDSIQHEKLN
>NZ_CP041295.1|WP_168370465.1|1216219_1218337_-|phenylacetic-acid-degradation-bifunctional-protein-PaaZ
MLELDTQTAQTESQATDYSSVRPALKTLSSLVCGQEFVASQDFRPVQHAITGETIYQVSSFGLDTRAVVDYAKQHGAAIASWTFHQRANALKQVAQYLLERKEDFYELAKATGCTRKDAWIDVEGGIGTLFAYSSLVRRELSDETAWVEDSWIPLSKHGAFGAKHVLSPKAGVAVHINAFNFPIWGMLEKIAPTLLAGVPCIVKPATEGAELTHAVVKAIHASGYLPEGALQLICGQTYDLFEQLTPQDTVTFTGSAATGQKLRAHPHLNQYSIPFSMEADSVNSAILTEQASDTAIDLFVREVFREMTSKAGQKCTAIRRAFVPRELLATVQERLIAKLQKVVVGNPELDQVTMGALASLKQKQDVAAKVEQLSQEAQIVFGSHLRQDFSIQADQPELGAFYPPTVLVCEQPEQASSLHQIEAFGPVVTLMAYDNLAQLADLVARGEGSLVASVVRDCEQNIEQLIAKIAPWHGRVHVLDEESAKESTGHGSPLPHLVHGGPGRAGGGEELGGLRAVKHYMQRTAIQGSPNAMTQIGHSWTAGAQVFEDRVHPFKKSFDELRVGERLLTARRTVTEADLVNFACLSGDYFYAHMDKIAAAESLFEERVAHGYFVVSAAAGLFVDAAPGPVIANYGMDNLRFVEPVKIGDTIQVELTCKQKTPKQQRDPSQKPHGVVVWDIKVKNQRNELVATYDILTLVERGEV
>NZ_CP041295.1|WP_075174492.1|1218598_1219543_+|1,2-phenylacetyl-CoA-epoxidase-subunit-A
MTNQLHSFEQAIEKDISIEPKNWMPEAYRKTLIRQIGQHAHSEVVGMLPEGNWITRAPSLKRKAVLLAKVQDEAGHALYLYSAAETLGADRDDMMDKLIAGRMKYSSIFNYPTLSWADVAAIGWLVDGAAIVNQVALCRTSYGPYARAMVRICKEESFHQRQGFEAMMQLANGTPEQKQMAQDAVNRFWWPALMMFGPSDDNSPNSAQSMAWKIKRFSNDELRQKFVDNTVPQVLQLGLSVPDPDLRFNQDTGHYEFGEINWTEFFDVIAGKGPCNHERIEARRKAWEGGKWVRETAAVYAQKQQTQQQQQKVA
>NZ_CP041295.1|WP_005177351.1|1219579_1219870_+|1,2-phenylacetyl-CoA-epoxidase-subunit-B
MDNKNHWSLYEVFVRSKQGLSHRHVGSLRASDDEVALQNARDVYTRRNEGVSIWVVKSELITSSQPDEKPEFFDPSLDKVYRHPTFYNIPDGIEHM
>NZ_CP041295.1|WP_075174493.1|1219881_1220637_+|phenylacetate-CoA-oxygenase-subunit-PaaC
MNQTVLAQFLLHVGDSQLILSHRLAEWCGHAPELELDIALANIGLDLLGQARTALSLAGEIEGLGRDEDKLAYFRTEREYRNLLLCEQPNGDFAQTMVRQWLMDLYHLELFTALSQSQQADVVAFAVKSLKEVKYHLRFSTTWMERLSLGTAEAHEKTQQGLNQLWRFTAELFEQTADEQQLVAQGILPDFAPLKAAWTAQVQTELQRFGLSLPDTGAYRSGAKQGLHTEHLGFILAELQYMQRSYPNMAW
>NZ_CP041295.1|WP_016658268.1|1220665_1221166_+|phenylacetate-CoA-oxygenase-subunit-PaaJ
MNLIRHCLDECWDALAQVSDPEIPVLSVLDLGMIRGVELNAQDEIVVRLTPTYSGCPATDLLKDEITAAFQSKGLTPVQVVVDLSEAWTTDWMSESGKQKLQQYGIAPPQGQSHQCGTHVALSDGIRCPHCHSQQTKLLSEFSSTACKALYKCQDCLEPFDYFKCI
>NZ_CP041295.1|WP_075174494.1|1221205_1222264_+|phenylacetate-CoA-oxygenase/reductase-subunit-PaaK
MSQFIPLTIKSIQPQTEQAICIAFDLAPEQADLFQYQPGQHLTIRHLTEQGEIRRCYSICSDRAEDMSIAIKKIDQGQFSTWANEHLKAGDVLEVMPPQGVFFQKAAKTGGQNYLGFAAGSGITPILSIVKSVLNHQPGAHFTLVYGNRSWKQTMFSEQIMDLKDRYKERLQLVNVFSRELNDSQLLNGRIDAEKLQQLFQAGLIHSQFDHCFACGPEEMMNAVETVLPELGIERSKIHTERFNTGTVPKASAAQIESRSEEKVNIILDGRELIVDVSKQDDSILDAALRAGADLPYACKGGVCATCKCKVLEGEVEMAINYSLEEDEVAKGYVLSCQARPTSANVRLSFDE
>NZ_CP041295.1|WP_016658266.1|1222288_1223059_+|enoyl-CoA-hydratase/isomerase-family-protein
MDYLKSSLAAPGVVLIELNRPEKRNALNNATLKELADHLQQLDADSSVKAVVITGNPQCFAAGADLNELAQLDVVSIQQDQRPLLWKGIDEFSKPLIMAVNGYALGAGFELALHGDMIITGENAQFALPEIGLGMLPGAGGTQRLARLVGQQLAMRWAMTGEMVSATTALQHGISSQVCPSGLTVQYALELATKIAAQAPLAIRAIKQSLKSIHEVTLSQGLKLERQHFVWLAATQDRQEGIQAFLEKRKPEFRGV
>NZ_CP041295.1|WP_160241378.1|1223058_1223850_+|2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA-isomerase
MDYQTIIVEEKNAVGYLTFNRPKQLNSFNETMHQEVSKVMKAWAKDSKIRAVVISAEGRGFCAGQDLNDRVVDPNADAPDLGLSIEKYYNPLIKLITDMPKPVLCAVNGVAAGAGANIALACDIVLAAKSASFIQAFCRLGLVPDSGGTWFLPRLVGRAQAMGLAMLGDKVSAEQALQLGMIWQVVEDDQLKAEAEKMAEHLAKQPTYGLSLIKKAIHAAADNNLDEQLILERDLQRLAGRSNDYKEGVQAFMQKRTPQYTGC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041295_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041295_2

1458032-1458120

Orphan

Consensus_repeat	Method
GCATTGCCACTGGCATGGGCTGCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041295_2

>merge|NZ_CP041295|2|1458032-1458120|CRISPRCasFinder
GCATTGCCACTGGCATGGGCTGCGCGGCCGGCTTCACGCGCTTCTTCGGATGTAAATTCATGCGCATTGCCGCTGGCATGGGCTGCGCG

>NZ_CP041295|2|2|1458032-1458120|CRISPRCasFinder
GCATTGCCACTGGCATGGGCTGCGCG	GCCGGCTTCACGCGCTTCTTCGGATGTAAATTCATGC
GCATTGCCGCTGGCATGGGCTGCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041295.1\|WP_168370514.1\|1466399_1467686_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041295.1\|WP_168370510.1\|1454067_1455822_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP041295.1\|WP_016658124.1\|1461840_1462005_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041295.1\|WP_104471337.1\|1460547_1460787_+\|DUF2171-domain-containing-protein	unknown	unknown	gnl\|CDD\|370756
NZ_CP041295.1\|WP_104488883.1\|1462104_1463523_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
NZ_CP041295.1\|WP_168370512.1\|1458647_1459889_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340951
NZ_CP041295.1\|WP_168370508.1\|1451297_1452428_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP041295.1\|WP_168370506.1\|1444461_1446498_+\|choline-BCCT-transporter-BetT	unknown	unknown	gnl\|CDD\|236635
NZ_CP041295.1\|WP_168370507.1\|1448674_1450156_+\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
NZ_CP041295.1\|WP_168370509.1\|1452424_1453525_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|378925
NZ_CP041295.1\|WP_104473134.1\|1456986_1457436_+\|cyanase	unknown	unknown	gnl\|CDD\|235079
NZ_CP041295.1\|WP_005178046.1\|1455884_1456694_-\|formate/nitrite-transporter-family-protein	unknown	unknown	gnl\|CDD\|376497
NZ_CP041295.1\|WP_005177920.1\|1450167_1451298_+\|biotin/lipoyl-binding-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP041295.1\|WP_168370515.1\|1469466_1470381_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176136
NZ_CP041295.1\|WP_171526197.1\|1463823_1464981_-\|acyl-CoA-desaturase	unknown	unknown	gnl\|CDD\|239583
NZ_CP041295.1\|WP_104473131.1\|1460889_1461759_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187613
NZ_CP041295.1\|WP_005178072.1\|1467792_1469175_-\|aromatic-acid/H+-symport-family-MFS-transporter	unknown	unknown	gnl\|CDD\|273327
NZ_CP041295.1\|WP_005177911.1\|1446510_1447119_+\|MarC-family-protein	unknown	unknown	gnl\|CDD\|225006
NZ_CP041295.1\|WP_034597681.1\|1443647_1444232_-\|transcriptional-regulator-BetI	unknown	unknown	gnl\|CDD\|179115
NZ_CP041295.1\|WP_075166613.1\|1465004_1466027_-\|ferredoxin-reductase	unknown	unknown	gnl\|CDD\|99812

Protein	Function_ID	Function_description	E-value
NZ_CP041295.1\|WP_168370510.1\|1454067_1455822_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.84255e-55
NZ_CP041295.1\|WP_104471337.1\|1460547_1460787_+\|DUF2171-domain-containing-protein	gnl\|CDD\|370756	pfam09939, DUF2171, Uncharacterized protein conserved in bacteria (DUF2171). This domain, found in various hypothetical prokaryotic proteins, has no known function.	7.34411e-26
NZ_CP041295.1\|WP_104488883.1\|1462104_1463523_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	7.93727e-17
NZ_CP041295.1\|WP_168370512.1\|1458647_1459889_-\|MFS-transporter	gnl\|CDD\|340951	cd17393, MFS_MosC_like, Membrane protein MosC and similar proteins of the Major Facilitator Superfamily of transporters. The gene encoding Sinorhizobium meliloti membrane protein MosC is part of the mos locus, which encodes the biosynthesis of the rhizopine 3-O-methyl-scyllo-inosamine. MosC belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.03e-83
NZ_CP041295.1\|WP_168370508.1\|1451297_1452428_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	3.71919e-26
NZ_CP041295.1\|WP_168370506.1\|1444461_1446498_+\|choline-BCCT-transporter-BetT	gnl\|CDD\|236635	PRK09928, PRK09928, choline transport protein BetT; Provisional.	0
NZ_CP041295.1\|WP_168370507.1\|1448674_1450156_+\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	4.22327e-20
NZ_CP041295.1\|WP_168370509.1\|1452424_1453525_+\|ABC-transporter-permease	gnl\|CDD\|378925	pfam12698, ABC2_membrane_3, ABC-2 family transporter protein. This family is related to the ABC-2 membrane transporter family pfam01061.	1.68435e-28
NZ_CP041295.1\|WP_104473134.1\|1456986_1457436_+\|cyanase	gnl\|CDD\|235079	PRK02866, PRK02866, cyanate hydratase; Validated.	1.76603e-94
NZ_CP041295.1\|WP_005178046.1\|1455884_1456694_-\|formate/nitrite-transporter-family-protein	gnl\|CDD\|376497	pfam01226, Form_Nir_trans, Formate/nitrite transporter.	1.81739e-68
NZ_CP041295.1\|WP_005177920.1\|1450167_1451298_+\|biotin/lipoyl-binding-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	3.15263e-32
NZ_CP041295.1\|WP_168370515.1\|1469466_1470381_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176136	cd08445, PBP2_BenM_CatM_CatR, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes of the ortho-pathway required for benzoate catabolism: muconate lactonizing enzyme I, muconolactone isomerase, and catechol 1,2-dioxygenase. CatR normally responds to benzoate and cis,cis-muconate, an inducer molecule, to activate transcription of the catBCA operon, whose gene products convert benzoate to catechol. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	3.63799e-93
NZ_CP041295.1\|WP_171526197.1\|1463823_1464981_-\|acyl-CoA-desaturase	gnl\|CDD\|239583	cd03506, Delta6-FADS-like, The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases are required for the synthesis of highly unsaturated fatty acids (HUFAs), which are mainly esterified into phospholipids and contribute to maintaining membrane fluidity. While HUFAs may be required for cold tolerance in bacteria, plants and fish, the primary role of HUFAs in mammals is cell signaling. These enzymes are described as front-end desaturases because they introduce a double bond between the pre-exiting double bond and the carboxyl (front) end of the fatty acid. Various substrates are involved, with both acyl-coenzyme A (CoA) and acyl-lipid desaturases present in this CD. Acyl-lipid desaturases are localized in the membranes of cyanobacterial thylakoid, plant endoplasmic reticulum (ER), and plastid; and acyl-CoA desaturases are present in ER membrane. ER-bound plant acyl-lipid desaturases and acyl-CoA desaturases require cytochrome b5 as an electron donor. Most of the eukaryotic desaturase domains have an adjacent N-terminal cytochrome b5-like domain. This domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain the residues: HXXXH, HXX(X)HH, and Q/HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within the homolog, stearoyl CoA desaturase.	3.20051e-50
NZ_CP041295.1\|WP_104473131.1\|1460889_1461759_+\|SDR-family-oxidoreductase	gnl\|CDD\|187613	cd05355, SDR_c1, classical (c) SDR, subgroup 1. These proteins are members of the classical SDR family, with a canonical active site tetrad and a typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.12928e-151
NZ_CP041295.1\|WP_005178072.1\|1467792_1469175_-\|aromatic-acid/H+-symport-family-MFS-transporter	gnl\|CDD\|273327	TIGR00895, transport_protein, benzoate transport. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	3.29895e-116
NZ_CP041295.1\|WP_005177911.1\|1446510_1447119_+\|MarC-family-protein	gnl\|CDD\|225006	COG2095, MarC, Multiple antibiotic transporter [Intracellular trafficking and secretion].	1.84887e-13
NZ_CP041295.1\|WP_034597681.1\|1443647_1444232_-\|transcriptional-regulator-BetI	gnl\|CDD\|179115	PRK00767, PRK00767, transcriptional regulator BetI; Validated.	1.10637e-104
NZ_CP041295.1\|WP_075166613.1\|1465004_1466027_-\|ferredoxin-reductase	gnl\|CDD\|99812	cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	2.75542e-78

>NZ_CP041295.1|WP_104473134.1|1456986_1457436_+|cyanase
MISHRQQVTDMILSAKVLNNIQWSSVAQEIGLSKEWVTAACLGQMALNKEQAEKIGQIFNLSDEAVAWLQIVPYKGSLPTSVPTDPLIYRWYEVVNVYGSTIKELIHEEFGDGIMSAIDFSMDIQRESHENSDRVNVVLSGKFLPYKSY
>NZ_CP041295.1|WP_005178046.1|1455884_1456694_-|formate/nitrite-transporter-family-protein
MAYLAPSEFATKVVDAGESKLHMANRDVLIRATMAGAILALAAVFAVTIAVQTGVPLIGALLFPVGFCMLYLLGYDLLTGVFVLTPLAWLDKRPGVTWARILKNWGVVFVGNFTGALIVAVMMAAVYTYGFSTEPNKVGLAIAHIGEDRTLGYKEYGVAGWITIFIRGMLCNWMVSLGVIGAMMSTTVSGKFIAMWMPIMLFFAMGFEHSVVNMFLFPFAMMMGGDFSVMDYFIWNELPVALGNLVGGLALTGLALYTTHVRTAPKREF
>NZ_CP041295.1|WP_168370510.1|1454067_1455822_-|protein-kinase
MSTLPSSHQTSLQIRLGQYSAAGRKESNQDFHGAAVPEGYLAQQKGIACAIADGISSSNVSHIASETAVSSFLADYFSTPDSWSVKTSVDRVIRATNSWLYAQTQQSQGRVDKDRGYVCTFSALVFKHETVHLFHIGDARIYRLREQQLEQLSVDHRVWLSSRESYLSRALGVAQKVEVDYLSLPLAQDDIFLLMTDGVYEYLSDSQIIEALHSPETLDLDQVAEMLVHLADAQGSPDNLTLQIVQVQQLPQQAQSQFQPSHNQLSLTPDLSIGQQFEGYRIQNVLHQNHRSRLYLAWDETRQQQLVIKIPSLDLTQDAQALERFLLEEWVAKRIQHPQVLAAYPHQRSKSYYFQTYEYLSGQTLNTWLHQQRQPIALETAIQITEQIIKGLQAFHRLDMLHQDIRPENIMLNAQLELKLIDFGATLVKGISEFQPQHAAALGTLAFMAPEYFCSRPVSTRSDQFSLAVVLYYVLSKQLPYGTELARCQTLKQLKMVRYHSILEYRPDIPVWIDGALHKALALMPNERYEVLSEFLYDLKHPNRYFLKPVHSSLLDKNPVRFWQAVSAMLFLCLLLSLALMFSV
>NZ_CP041295.1|WP_168370509.1|1452424_1453525_+|ABC-transporter-permease
MKSLWFYYLQGFKDIVSHGAIFTTLILSVLFYSFFYPTAYQAQQAEALPIIIVDEEQSNLSTRIIGQVAQSPNVEIEAITGNFAEAKQWVESQKADGILLLPDNLSQSLRHGETGGIGLYLSTANFLVTKQIGLGLATSVEQTLADYTERFGEVSDFSPALSVHQIPLFNPLSGYGSYVFPAVAPLIIHQTILLGLSMLILVYRERKVELNANAFIGTCLAVFTIGCLGCFYLFGFSFWLFDYPRGGNLLGMLLAVPVFIYTIMGMTCLFASFLDLPERAGHVIVFTSIPLFFLSGAAWPHAAMPIWMQVVGEILPSTQIVQMFIQLNQMGVPTTLILPKLLYLGMIGSLCFFLAYRRLISNCGTF
>NZ_CP041295.1|WP_168370508.1|1451297_1452428_+|ABC-transporter-permease
MWTGIWRELRYLLREKWDLCLVTLAPALVIILFSSMFAQGKSDHLPIAIIDQDQSALSQSIYQHVALNHTLKIATVSEQTAEIERLLNQNKIWGYIHIPSGAEQRLVRAQDADISIAFNQSYFSIGNTISSAMLVSTLQALAEFSGQQYLGNRLPSLEAPSPHIKISPLYNPQLNYEFYLEPYVIPAILHLLLCCCVAFSVGQELKRQTLTSWISNSSIWMALLSKNLVYVAIFSLWTWIWMFWLIEIRGWFVAGSLALILSAQFLLYSAYAFLSSAVVLATKDLSKSFGIIAVYGGSSLSFAGVTLPLNNAPLFTQFWSNIIPFTPYAKLQTEQWVIGSPLHISLQAGFMLLIYALVYALLAYLFLKKIAKGAVQ
>NZ_CP041295.1|WP_005177920.1|1450167_1451298_+|biotin/lipoyl-binding-protein
MNEDQKPNDPVNEAASSSDTEKSPAQQVETKTEIENNATTSTEQQQAPEIAKKKKYLLLALIPVLLAVIAFGLWKSYQPAPLELQGRVEAETVQVATKVPSRIEEIYVEEGQRVKKGDVLVRLNSPEIQAKKQQAAAALQSALALQSTAERGSQEENIASLYANWQSLKAQQNLAKVSYERGANLFKEGVISRQRRDELYAASQSAAQMTEAAYQQYARAKRGSTSQQKSSADAQVDIAQAALDEANALEAETQLVAPVNGTVSKTYGKVSELVATAVPVVSLIEDQMWVSLNIREDQYAPFQKMSSIEGYIPALDKTATFKIKQISAEGEFATIKTTRQTGGYDVRSFKLHLVPTPAIPELKVGMSVLFKLKETR
>NZ_CP041295.1|WP_168370507.1|1448674_1450156_+|TolC-family-protein
MNLKKNKRQLVWGLNLLASMMYGSFAHAQSISFQDAERQLLQNSYSSQAYQSLEQASKLEAEAVKGVGLPRVDLNVRAYAFHSEVDIPLKQFKNNLENSLSQGVNGRLNEWEASNGVDLPAGITDPLRDGLNNTIHSGVGLIPDTSNVILEDQVIRPTVSVIMPIYTGGLTRSAKEIANIQVGRSQLSNKQQQDTQRFELIQSYFNVQLQKQLHAAALFNLNAMQQHYRNALKMEQQGFISKGQRMQFEVARNNAERSQQNTQANLNAALFQLNNLLQESSITELSTPLFVNKTEPQALNHLLKTFSQNSALIQKMQLDTQLAQANVKAQQAAKKPNVFAFGEYSLDQNENWIVGVAARYNLFSGIDKNKNIQAAELKRSATELLTARTQQEIENLIYKSYSEALSAQQSDALLAQNLKAAQENLRIQELSFKEDMGTAIQVIDAQNMLSGLRAETALNAYKYVMSLATLLQSHGSIAEFPNYIQHTNTHYIR
>NZ_CP041295.1|WP_005177911.1|1446510_1447119_+|MarC-family-protein
MSESLHAFALFFSLLNPFLMSIYMLGIIRNSEARVFNRALIQGSLISFVVFIIFAKTGEAFFHDVLHVRFESFQIFGGIIFLVIGYRYVFEGADTIGVMRGAPHHLAGTIAMPFMIGPGTISAAVITGIQLSLWQLVLVIFVTLFLTCSLLILMKYAHDHLQHKHSNYIDLYVDIVGRLAALLIGTIAIDMIVTGVSGIMQS
>NZ_CP041295.1|WP_168370506.1|1444461_1446498_+|choline-BCCT-transporter-BetT
MQKKTEQTTDSLNKVVFFLSATLILLFSLVTILFNDQANQLITQILNWVSRTFSWYYLLAATLYLVFVLFIALSRYGDIKLGPKHSKPEFSLLSWSAMLFSAGIGIDLMFFSVAEPLSHYMNPPVGEGQTFEAARQSMVWTLFHYGLTGWSMYALVGVALGYFSYRYNLPLTIRSALYPIFGKRVNGWIGHSVDTAAVLGTIFGIATTCGIGVVQLNYGLHVLFDVPENLLIQSALIAVAVIITAISVASGVNKGLRILSEVNIYVSIGLLLFILMMGNTEFLLAALIQNFGDYISQFPQLSLTSFPFEQPKEWMNSWTLFFWAWWIAWSPFVGLFLARISRGRTIREFVAGTLIIPLLFTLTWLSIFGNSALHSVIFDGNTQLATTVLANPAHGFYDLLAQYPWFPFLAGVATITGLLFYVTSADSGALVLGNFTTKFSNIEHDSPRWLSVFWALAIGLLTLAMLMANGVTALQNTTIIMGLPFSFVIFFVMAGLYKSLRLEDFRQASTSMNAAPVVGNVDIFNWKKRLSRVMLHANLSQTQQMLEEVCKPAMQAVATEFINKGIQVDLAEKALDDEPELSHLDLTIQLDEEENFVYQIWPIRYDTPNFSSRGKRTKKYYYRLETYLFEGSQGNDLVGYSKEQVINDILDKYERHLMFLHINRISPGKRPLFPDPDQ
>NZ_CP041295.1|WP_034597681.1|1443647_1444232_-|transcriptional-regulator-BetI
MPKVGMQPIRRQQLIDATLSAINELGFAEASISQIAQRAGVSTGIISHYFQGKHGLIEATMRYLLQQLGDAISASLNAAENTPEQRLIAIVRANFSAEQTDKAAMKTWLAFWANSMHQPDLHRLQQVNHYRLHSNIKHEFAKQLDREQAERAAQGLAALIDGFWLRGSLMTTELDADLPIQICADYIRQQLNIH
>NZ_CP041295.1|WP_168370512.1|1458647_1459889_-|MFS-transporter
MDSFLEWDALFLEGGTYMLFSKTTVVDASAQLNAQGLATKLSFFGLGLSTASWAPLIPFAQQRLSLNHADFGLLLLCMGIGSMLAMPAAGLLIQRIGCRILIGIALVAAMIILPLLTVFGTALSMAIVLFIFGTAVGAFGVAINLQAVIVEKNSLKNMMSSFHGMCSLGGLLGVLTVTVLLSLGVSPLMSALIMSAVLAFIAILAVPNSLSEIEKKSDTAPEDTAPSAKQKFRPSPMILLIGLVCFIAFLSEGSAMDWSGIYLVSNFGMDASFAGLTYTFFAITMTIGRFSGRRLLRMWGEKNIITYSALCAALGLGIIVMAPHWAVVLLGYALLGFGCSNIVPVMFSRVGRQNIMPKAAALSLVSTIAYSGSLSGPALVGFLSEAIGLSTVFALVALLLLSIAVLNRFTQVD
>NZ_CP041295.1|WP_104471337.1|1460547_1460787_+|DUF2171-domain-containing-protein
MADINLNNIQKHSEVIASCGTHVGTVDHLEGSDKIKLTKQDSGDGMHHYIPISWVEEIRGNQIILNKNSEEVTRQWEAV
>NZ_CP041295.1|WP_104473131.1|1460889_1461759_+|SDR-family-oxidoreductase
MNHYPDSPSPQEKQEHQPGVQYKMTPEPEIIKSNYQGSQKLKDKVALITGGDSGIGRSVAVLFAREGANIIIPYLEEDQDAQDTKRLVEQEGRQCLLIQCDLRQHAAVQQMVDLALQQFPHINILVNNAAVQYPQKTIEDINPEQLYKTFETNLYPLFYVTQLLIPQMQAGDSIINTTSITSYQGHNELIDYASTKGAITAFTRSLSTNLLKNKTGIRVNGVAPGPIWTPLIPSSFDEEQLKGFGEDTPMGRMGQPSEVAPAYLFLASDEASYISGQVIHVNGGTIVNG
>NZ_CP041295.1|WP_016658124.1|1461840_1462005_+|hypothetical-protein
MSRGDKSAYTDKQKRQARHIIESEKERGHSEEEAERIGWSTVNKQDGGGKKKSH
>NZ_CP041295.1|WP_104488883.1|1462104_1463523_-|iron-containing-redox-enzyme-family-protein
MENNKMSVVSQNSYRPLKLERQKSYRELFHFFLDESTPAPEKEKLSAQLLQRELHQIDPTSIPLPDEPVQIKDWLFQQNMQNCERYQQYLSRRQAGGQREYFQHVAAAYDFLVKVAPVKYVDGSWLYSTLKHWPDPNFQHLIMIYLEELGLGSAKANHVSMYQQLLSSLNLQDLVEGLEDEYYYQPVVQLALAYAPQQYLPEVIGFNLGYEQLPLHLLISNYELAELGLDHQYFNVHITIDNLDNGHAHRSVAALEYAYSQAANKTEFIDKLKRGYALNDVGLGSTEIIKNSDLTPLIEKIFKKKAVVGKLIHNNRCRFAQASVNEWLSNDQKVVEFLQVLQDKQWIKRGQHPSESRFWQLIHNEEGKMFGVFSVAEQQIIYDWIAQAYTERRAPFKAVTPVQQVDDYIVDYFNSSEQQALQQQLKLARSAEEKINLLLPYLAPHQHHNPTGLWATRQLTQFLFPQALQQIQ
>NZ_CP041295.1|WP_171526197.1|1463823_1464981_-|acyl-CoA-desaturase
MPAALHPNSKSKYLTEVQIQEFGAKVEAIRREVMDDLGEKDAQYIYKIRNFVRYSEITSRGMLMFGGWIPPVWLLGTGLLGLSKIVENMELGHNVMHGQFDWMNDPTLNGASYDWDTIATGDDWKYTHNYIHHTYTNIVDKDHDVGYGLLRVSEAQKWEPRFLMNIPLAIQLMVFFEWYVGLQRLHLEDVLVYKTKTWKQVWDEAAGLRKKMRRQVVKDYVFFPLLAGPNAIPVFAGNAVANVIRSLWASAVIFNGHFTEDAENFEADNTENESRAEWYIRQIRGSSNFSGTQWLHILSGNLSHQIEHHLFPDMPANRYAEVAPKIKALCAEYGIHYNEANFIQQFSSVWVRLAKCSVPNHWQDKIGQGSNLIRTGLAQLKAKFQ
>NZ_CP041295.1|WP_075166613.1|1465004_1466027_-|ferredoxin-reductase
MSTSVEYKPEWIREDFIDFIAEKINPVWALKKVKACVVEIQALSPDFYKIHLRPNQNFQAQRFQAGQSILVTLAMNGVRQQRSYSIVTLLDNGDVILAIKRQGKMSNALTRLPAGAVVELSQPQGNFVLPAPVPSLCFIASGSGITAIYSLLQKAVVSSTQPIDLLYFTRDDAFHAEIKTLALMYPHFKYHHFNTVEQHQHLSLSLLQNTVEQLGERHIYACGSASMMQAAQQICQQLDLSEQFHSEYFQMTADATLEAQPVQFLRSQQDFQANSNLLDSAEAAGLRPAHGCRMGICNTCSCTKVSGSVRNLLTGEIDHNHNTQIKLCVTQAISPVVINL
>NZ_CP041295.1|WP_168370514.1|1466399_1467686_-|hypothetical-protein
MKTMMIKPLVIAVGLTMSVMANAQSSQEVEQLRQEVQQLKALVHQYAQQNQTVQANLNQLANTAVQPPVAQKASTEKRGLGMTLGNAEFNLYGNVRMDGSYQVEGGAKDMPYNQINGVALEGNAENSDRFRSTLAATRLGLDFKTQVGAEDVKGKLEVDFLGGNLDSLRIRHAYLTYADWLIGQTWSNFAVPDYMPETVDALAYAGGAVKRTPQVRYTAKFSPQTNLVVAAEDPKDNSITQRLPALTARLNHQFADNMSVSARAMGHEKRINSDEEMAWGVGLGAKYDVTPSTTLKADYYHVKGDSSFVSFANTGTIQGANGLEQSEFDSITVGLTQKFNEKLRGTVGYGYMSFDQDADYLAATPADKRTDVNKDLWQAWANVFYSPIKPVSLGLEYVYGEREAVVPAANGSKTGEDNRINMVAIYNF
>NZ_CP041295.1|WP_005178072.1|1467792_1469175_-|aromatic-acid/H+-symport-family-MFS-transporter
MNTTDSVNINTVVDNAKFTPFHWGVLLWCLLIIIFDGYDLVIYGVALPLLMQEWSLGAVEAGLLASTALFGMMFGAMSFGTLSDKLGRKKTIMICVAIFSGFTFLGAFASNPIEFGILRFLAGLGIGGVMPNVVALMTEYAPKRIRSTLVAVMFSGYAIGGMTSALLGAWLVADYGWKIMFYLAGTPLLLLPLLWKFLPESLMFLTKKGETEQVRTFVQKIAPEQNIAPNTQFVLNEVMAGDEAPLRALFQQGRTFSTLMFWVAFFMCLLMVYALGSWLPKLMIQAGYSLGASMLFLFALNIGGMVGAIGGGALSDRFHLKPVLTIMFTVGAIALILLGFNSPQPVLYTLIAIAGAATIGSQILLYTFVAQFYPTTVRSTGMGWASGIGRIGAIVGPVLTGALLTLNLPHQMNFMMIAIPGLIAAVAIFMVNLKVSVDGAKAKQESFANSNVKAVKSSAH
>NZ_CP041295.1|WP_168370515.1|1469466_1470381_-|LysR-family-transcriptional-regulator
MELRHLRYFVAVVEEQSFTKAAEKLFIAQPPLSRQIQNLESELGIQLFERGSRPLQTTPAGQFFYQHAVKLLSNAEEIKTMTKRVGMVEKTVTIGFVGSLLYGLLPRIVYLFRQQHPNLKIELVEMTTINQIQALKEGRIDVGFGRLRISDPAIRRILLREEPLMVAVHDSHIFATKRQGIYLSDIVEENIFLYPNHPKPNFSTQVRGLFSEYSLEPRSLKEVREIQLALGLVAAGEGMCIVPESARTIQLPHLNYIPLLDDAAKSPIFLAIRSMDESEDIRSLFDSIYQVYDLEAIKYDRTVI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP041295_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041295_3

2599003-2599115

Unclear

Consensus_repeat	Method
TCATCGAAAGAACGTTGTGGACGGTCGCCAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041295_3

>merge|NZ_CP041295|3|2599003-2599115|CRISPRCasFinder
TCATCGAAAGAACGTTGTGGACGGTCGCCAAAGCCACCTTCACGACGTGGGCGATCGCTGTTGAATTCGCGACGTGGACGGTCATCGAAAGAACGCTGTGGACGGTCGCCAAA

>NZ_CP041295|3|3|2599003-2599115|CRISPRCasFinder
TCATCGAAAGAACGTTGTGGACGGTCGCCAAA	GCCACCTTCACGACGTGGGCGATCGCTGTTGAATTCGCGACGTGGACGG
TCATCGAAAGAACGCTGTGGACGGTCGCCAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041295.1\|WP_171293255.1\|2595426_2596011_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
NZ_CP041295.1\|WP_032048861.1\|2593787_2595092_+\|IS4-family-transposase	unknown	unknown	gnl\|CDD\|379017
NZ_CP041295.1\|WP_171260950.1\|2597524_2598382_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213228
NZ_CP041295.1\|WP_034598236.1\|2604144_2604747_+\|GTP-cyclohydrolase-II	unknown	unknown	gnl\|CDD\|234745
NZ_CP041295.1\|WP_104483950.1\|2590786_2591422_+\|ComF-family-protein	unknown	unknown	gnl\|CDD\|223970
NZ_CP041295.1\|WP_005180320.1\|2592596_2593610_+\|magnesium-and-cobalt-transporter-CorA	unknown	unknown	gnl\|CDD\|213369
NZ_CP041295.1\|WP_005180318.1\|2591850_2592444_-\|TIGR00730-family-Rossman-fold-protein	unknown	unknown	gnl\|CDD\|129813
NZ_CP041295.1\|WP_104473167.1\|2607817_2608027_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041295.1\|WP_168370744.1\|2601923_2603834_-\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP041295.1\|WP_168370743.1\|2596748_2597528_-\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	unknown	unknown	gnl\|CDD\|223838
NZ_CP041295.1\|WP_016658512.1\|2609445_2611269_+\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|185635
NZ_CP041295.1\|WP_005180325.1\|2596077_2596749_-\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	unknown	unknown	gnl\|CDD\|275223
NZ_CP041295.1\|WP_104489521.1\|2591446_2591848_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240046
NZ_CP041295.1\|WP_104483984.1\|2606671_2607613_+\|oxygen-dependent-coproporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|235413
NZ_CP041295.1\|WP_075175570.1\|2608247_2609036_+\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
NZ_CP041295.1\|WP_104473166.1\|2605062_2606436_-\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236430
NZ_CP041295.1\|WP_034597976.1\|2600980_2601811_-\|inositol-monophosphatase	unknown	unknown	gnl\|CDD\|238817
NZ_CP041295.1\|WP_168370745.1\|2611360_2612515_-\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP041295.1\|WP_104473172.1\|2612642_2613101_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
NZ_CP041295.1\|WP_005180321.1\|2595127_2595415_-\|STAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|132914

Protein	Function_ID	Function_description	E-value
NZ_CP041295.1\|WP_171293255.1\|2595426_2596011_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	1.171e-40
NZ_CP041295.1\|WP_032048861.1\|2593787_2595092_+\|IS4-family-transposase	gnl\|CDD\|379017	pfam13006, Nterm_IS4, Insertion element 4 transposase N-terminal. This family represents the N-terminal region of proteins carrying the transposase enzyme, DDE_Tnp_1 (that was Transposase_11), pfam01609, at the C-terminus. The full-length members are Insertion Element 4, IS4. Within the collection of E.coli strains, ECOR, the number of IS4 elements varies from zero to 14, with an average of 5 copies/strain.	9.14221e-24
NZ_CP041295.1\|WP_171260950.1\|2597524_2598382_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213228	cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.38584e-142
NZ_CP041295.1\|WP_034598236.1\|2604144_2604747_+\|GTP-cyclohydrolase-II	gnl\|CDD\|234745	PRK00393, ribA, GTP cyclohydrolase II RibA.	2.65905e-124
NZ_CP041295.1\|WP_104483950.1\|2590786_2591422_+\|ComF-family-protein	gnl\|CDD\|223970	COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only].	7.68273e-30
NZ_CP041295.1\|WP_005180320.1\|2592596_2593610_+\|magnesium-and-cobalt-transporter-CorA	gnl\|CDD\|213369	cd12835, EcCorA-like_1, Escherichia coli Mg2+ transporter CorA_like subgroup. A bacterial subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subgroup includes the Mg2+ transporters Escherichia coli CorA and Salmonella typhimurium CorA (which can also transport Co2+, and Ni2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	4.76729e-128
NZ_CP041295.1\|WP_005180318.1\|2591850_2592444_-\|TIGR00730-family-Rossman-fold-protein	gnl\|CDD\|129813	TIGR00730, LOG_family_protein_YJL055W, TIGR00730 family protein. This model represents one branch of a subfamily of proteins of unknown function. Both PSI-BLAST and weak hits by this model show a low level of similarity to and suggest an evolutionary relationship of the subfamily to the DprA/Smf family of DNA-processing proteins involved in chromosomal transformation with foreign DNA. Both Aquifex aeolicus and Mycobacterium leprae have one member in each of two branches of this subfamily, suggesting that the branches may have distinct functions. [Hypothetical proteins, Conserved].	3.79905e-61
NZ_CP041295.1\|WP_075175570.1\|2608247_2609036_+\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	7.84982e-110
NZ_CP041295.1\|WP_168370744.1\|2601923_2603834_-\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP041295.1\|WP_168370743.1\|2596748_2597528_-\|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	8.62077e-82
NZ_CP041295.1\|WP_016658512.1\|2609445_2611269_+\|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein	gnl\|CDD\|185635	PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional.	0
NZ_CP041295.1\|WP_005180325.1\|2596077_2596749_-\|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD	gnl\|CDD\|275223	TIGR04430, OM_asym_MlaD, outer membrane lipid asymmetry maintenance protein MlaD. Members of this protein family are the MlaD (maintenance of Lipid Asymmetry D) protein of an ABC transport system that seems to remove phospholipid from the outer leaflet of the Gram-negative bacterial outer membrane (OM), leaving only lipopolysaccharide in the outer leaflet. The Mla locus has long been associated with toluene tolerance, consistent with the proposed role in retrograde transport of phospholipid and therefore with maintaining the integrity of the OM as a protective barrier.	1.80585e-46
NZ_CP041295.1\|WP_104489521.1\|2591446_2591848_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240046	cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	2.24171e-36
NZ_CP041295.1\|WP_104483984.1\|2606671_2607613_+\|oxygen-dependent-coproporphyrinogen-oxidase	gnl\|CDD\|235413	PRK05330, PRK05330, oxygen-dependent coproporphyrinogen oxidase.	0
NZ_CP041295.1\|WP_104473166.1\|2605062_2606436_-\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236430	PRK09249, PRK09249, coproporphyrinogen dehydrogenase.	0
NZ_CP041295.1\|WP_034597976.1\|2600980_2601811_-\|inositol-monophosphatase	gnl\|CDD\|238817	cd01639, IMPase, IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be recycled into inositol lipids; in eukaryotes IMPase plays a vital role in intracellular signaling. IMPase is one of the proposed targets of Li+ therapy in manic-depressive illness. This family contains some bacterial members of the inositol monophosphatase family classified as SuhB-like. E. coli SuhB has been suggested to participate in posstranscriptional control of gene expression, and its inositol monophosphatase activity doesn't appear to be sufficient for its cellular function. It has been proposed, that SuhB plays a role in the biosynthesis of phosphatidylinositol in mycobacteria.	7.94629e-111
NZ_CP041295.1\|WP_168370745.1\|2611360_2612515_-\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP041295.1\|WP_104473172.1\|2612642_2613101_+\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	1.96344e-35
NZ_CP041295.1\|WP_005180321.1\|2595127_2595415_-\|STAS-domain-containing-protein	gnl\|CDD\|132914	cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes.	8.35281e-10

>NZ_CP041295.1|WP_171260950.1|2597524_2598382_-|ABC-transporter-ATP-binding-protein
MHAEKNAGKSSAMNNQTPLQAPALIEVNHLSFKRGERVIYDNVSLKIRRGQITAIMGPSGTGKTTLLRLIGGQLTPDQGEVLLDGKNIGKMSRQELFAARARMGMLFQSGALFTDMTVYENVAFPIRAHTRLPEHLIAELVALKLESVGLRGAEQLMPSELSGGMNRRVALARAIALDPELIMYDEPFAGQDPIVMGVLTRLIRSLREALDLTTIIVSHDVAETLSIADYIYVVAEGKVQGEGTPEQLKQHASPFVRQFLTGSVEGPVDYQFSHQPYLSHEVHSA
>NZ_CP041295.1|WP_168370743.1|2596748_2597528_-|lipid-asymmetry-maintenance-ABC-transporter-permease-subunit-MlaE
MNVIAALGRRVIERVRGIGVATLMLLQILFSMPTWIGVKLFIYQMYRVGVMSLLIIVVSGLFIGAVLGLQMYSILVTFGSEAMLGTAVALTLLRELAPVVAALLFAGRAGSALTAEIGLMKATEQLSSMEMIGVDPLKRVISPRLWAGIFSLPMLSVIFAAVGIMGGKFVGVDFLGADEGSYWSGMESTVQFYKDIFNGTIIKSFVFALICTWIAVYQGYACEPTSEGIATSTTRTVVYSSLCVLGFDFVLTAVMFGGV
>NZ_CP041295.1|WP_005180325.1|2596077_2596749_-|outer-membrane-lipid-asymmetry-maintenance-protein-MlaD
MKSRTSELAVGVFVILFGIALFFLAMRVSGLVGTTIQDSYSMTATFDNINGIKPRAKVALSGVKVGQVESITLDPVTRLATVTMILDGELTTFNQEQLQQVQQYALEELRYSSEYTEADPAQQKAMEKQLLDNMTSITNIDEDAYIMVATNGLLGEKYLKIVPGGGLNYLKRGDQISNTQSTMEIEDLVTKFVTGGAGNKSSSDNPADETSAETTDAEVSFVE
>NZ_CP041295.1|WP_171293255.1|2595426_2596011_-|ABC-transporter-substrate-binding-protein
MVAGSAFAAPTETPPAFIKKVADGLISRLKADHAKLQNNPALVKTIVRQNLDPYIDSQAFTRIVMGTYATNQYSSAAQRAQFEKNFRETLIENYGSAFAKFSNQTYTLRPYKASNSKNPVVTIDFNNKGDKIPVSFQLVDKGNQWKIRNINVSGIDLGLQFRNQFAANVKRNGGNIDKAIATFKPDAEAAVDKK
>NZ_CP041295.1|WP_005180321.1|2595127_2595415_-|STAS-domain-containing-protein
MIEYVNQELRVSGKIDFNNAEQYYQQGLQLIQQQPAPVVVNLAGLEQGSTLALAVLVRWLRQTPDAQGLVFKAVPEKMMKIIQSCHLQDDLQLSA
>NZ_CP041295.1|WP_032048861.1|2593787_2595092_+|IS4-family-transposase
MSLSEHLESTLEHALPSLSHFCELIDLNWIETSLHQTGKASIRRRKLPAEHVVWLVLGLALFRNQPISYVVEQLKLVFGTTDYCVPSAAVQARQRLGREPLAALFSLISQAWFDESQQQYSTFQGLSVCAVDGVVWSMPLTKENFNHFGSSKGKTAVAPYPQVRATCLVNTNTHEIIDAQIGSMDQGELTLANQLSPPAQSITLFDRAYFSADFLIGWQTRGESSHWLMRAKDNLRYDIIKRNSPHDFHIRMPISARAKKLNPALGDYWEARLIEVEQAGKIRRYITSLLDSKTYPLIALAKLYAQRWEIEMCYREIKSNLQEGKHLRSKQPDLIYQELWGVLIAYNVLRRQMKYMAQRAKVSPLRISFHIASIALLNLLRFDSLASAGNLPKHLESLMEKSDRYVLPERRMRSYPRVVKGKPQKYPRKSQSIS
>NZ_CP041295.1|WP_005180320.1|2592596_2593610_+|magnesium-and-cobalt-transporter-CorA
MLEAFYATERGSLEDATINGGFDLHPELVWIDLIAPSQEEQQWVMDAYRQDLPTLKSLEDISSSARFYRDDDGVLHISTYFLTKNKNYQVDDESEENSSILATVQTVAFILNRDRLLTLRGEKLVAFRAFRARARRNDYEIDYKDPTWVLLGLLEAKLDELADILEDIHKDLEKYSTEVLNNRHREMILDLDDMITRLAQLEDMLGKAQLCLIDLRRVLTFLARPRALGSHIYDADIRELSEDVRSLVEHDAFLFQKVRFLLDTTSGFINTEQNDTIRRFSILPSMLAPPMLVASVYGMNTDVLPFAKGTTSFIIVSIILIGFFIGPLIYFRWKKWI
>NZ_CP041295.1|WP_005180318.1|2591850_2592444_-|TIGR00730-family-Rossman-fold-protein
MTNSIAVFCGSALGSDAVFVDTAQLVGQTIAKQGKTLVYGGGRSGLMGVVADSALQAGGAVIGVIPEPLVDRELAHPGLTELHVVKNMHERKTKMSELSDAFIAMPGGAGTLEEIFEQWTWAQLGIHLKPNAFLNVEGFYDDLLRFIRMTTDKGFTHARFTEALIVSDSMDEILSQFERFQAPEPKWGMADRQALVK
>NZ_CP041295.1|WP_104489521.1|2591446_2591848_-|NUDIX-domain-containing-protein
MNTITVAAAIILNEQQQLLLVRKQHTECFMQVGGKLESNEPPEQTICREIAEEIGCQAQIKQFVGRFETATANEPDHRLVSYVYYVQLDQDPQVQAEIAEMKWIELEDKTTRLAPLTTEVVIPWVKQQLLQSA
>NZ_CP041295.1|WP_104483950.1|2590786_2591422_+|ComF-family-protein
MPMFKLLAHSRTLLQKLLPCQLCGSAAQQQYRVCADCLQQLPWLKANVYRQETEIQVACHYRYPVDRMIQQFKYEQQLHYQSLLAGSLCELTYPRVQAIVPMPVATERLAERGYHHTLLLAQVLARHLQLPIWQPVVRRHQHSQKGLSRLERLENLDQQFQLRPDTGRPYRRVLIVDDVVTTGSSIRALKQQLEQLGCHKVYAVCIASADG
>NZ_CP041295.1|WP_034597976.1|2600980_2601811_-|inositol-monophosphatase
MEPMVVMAARAAQTVGQELLKAHQNRHKLDLQVEEKGIDGPVTRVDRYLEQLTIDTLRKSYKNHSFLGEEFGLQEGKGHDADWCWVIDPLDGTLNFINGFPHFCISIAVQHKGVTQHGVIYDPVKDELFSASRGRGAMLNQRRIRVNVKDSLENTFLAVGHAYRAKRNGEVVSYAKNHFESLLNVTEAGAQYRRAGSAALDLAYVAAGRLDGYFELGLKPWDIAAGELIVKEAGGTVVDARGGSDSMDNGQVLACSMKMLKPLMKAVVPAWGDAAK
>NZ_CP041295.1|WP_168370744.1|2601923_2603834_-|1-deoxy-D-xylulose-5-phosphate-synthase
MLYTEIPTQRPVTPLLDSIDHPQQLRLLAQSQLAQVADELRQFILYAAGQSGGHFGANLGVIELTVALHYAFNTPHDRLIWDVGHQAYPHKALTGRREQLTTIRAKDGLAAFPAREESEFDTFGVGHSSTAISAGLGMALASRYQQQQREVVAIIGDGAMTAGMAFEAMNDAVAHQADLMVILNDNDMSISCSTGGFAKHLAALWQRGESVHIDAAGEAYIQPHPEWNYTSRLHCAATDAADNLFKAIGFDYFGPFDGHDVDQLVNVFQALKKRKGPRLIHVYTKKGKGFAPAEADQIKYHAISKINSSASAAAAPKYSDVFGQWLSDEAAQDSRLLAITPAMCEGSGMVQFAKQYPERFFDVAIAEQHAVTLAAGMACEGLKPVVAIYSTFLQRGYDQLIHDVALQNLDVTFGIDRAGLVGEDGPTHAGAYDYAYMRTVPNMVIMAPKDENECRQMLHTAYHYPGPAAVRYPRGNGVGVEIQQQLNLMEIGQAEIVARFNEQSDEQIAILAFGSRVYPAIEAAQAFAARHDIAVQVVNMRFVKPLDEAMIERLAENTQLFVTVEEHAVMGGAGSAVSEYLAKAQLVKPIIHLGLDDSFMQQATHSQMLQQAGLDTAGIEQAMTQAWNKLTESVSS
>NZ_CP041295.1|WP_034598236.1|2604144_2604747_+|GTP-cyclohydrolase-II
MPIEFVATSRLPTAFGEFKITVFQDPKTGEEHVALSKGLEQAPTEPVLVRVHSECLTGDAFASLKCDCGPQLQATQRLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANLMLNLPADARQYDMCSIMLDHLQVKAVRLITNNPLKIEALREQGINVVDRVPLTVGLNPFNEQYLKTKHERMAHMYQKDDF
>NZ_CP041295.1|WP_104473166.1|2605062_2606436_-|oxygen-independent-coproporphyrinogen-III-oxidase
MLKPASSLVQKYNVPGPRYTSYPTVPYWEEASFSREAWQQSLQRAFAESNASEGISLYIHLPFCESLCTFCGCHKRVTKRHEVEQPYIQAVLKEWDLYCQLLPDRPMIKEIHLGGGTPTFFSVAHLQQLIQGILAKATVAPEHEFSFEGHPNNTTREHLQALYDLGFRRVSYGVQDYNEKVQKAIHRIQPYKHVQRVTEWARDIGYTSISHDLVFGLPFQNLDDVLNTIQQTTQLNPDRLAFYSYAHVPWIKGNGQRGFKDDDVPKDELKRTLYEEGKKKLLAHGYHEIGMDHFALKSDAMYQAFQQGSLHRNFMGYTASKTQLMIGLGLSSISDSWYSFAQNEKTLEDYYARLEQNEIPVFRGHVLTAEDLMIRRHILNLMCSFQTSWADPEMQFQELPEVLKQLEEMQEDGLLTLFEDHLQVTEQGKPFVRNICMAFDLRLKRKVPSTRIFSMTI
>NZ_CP041295.1|WP_104483984.1|2606671_2607613_+|oxygen-dependent-coproporphyrinogen-oxidase
MQHPTSADIQRVREFLLDLQARICAALEQQERAGGGTAEFVIDDWQRPEGGGGRSRVLQNGSVIEKGGVMFSHINISKLPASATERHPGIAGAKAQAMGVSLVIHPKNPNVPTSHANVRLFVAEPEGQDPIWWFGGGFDLTPFYPNDEDVLSWHQIAHDLCAPFGEQVYTEHKQWCDDYFYLKHRDEQRGVGGLFFDDLNQWDFDTCFEYIQAVGNGYLEAILPIFKRNQDKPYTEAQREFQLYRRGRYVEYNLVYDRGTLFGLQTGGRIESILVSLPNLAGWSYRPEWDADSAEKKLTDYYLKPHDWLRELQ
>NZ_CP041295.1|WP_104473167.1|2607817_2608027_+|hypothetical-protein
MLQNFIAQHKGLLFWLILSILVCSLSITFIFEHPLSDSLSIVASVFALIALVFTSVLLVLDTILDICNP
>NZ_CP041295.1|WP_075175570.1|2608247_2609036_+|shikimate-dehydrogenase
MRKQFAVVGNPIEQSRSPELHHAFAEKTGVDLVYRKRLAPLDGFEANIREFFAEGGVGMNVTVPFKEQAFALCDVLSERAKTAKAVNTLWMQDGQLYGDNTDGQGLVDAIRTLNWNLDNTEILIIGAGGATRGVIYPLVQAGVKKVVIANRTLARAEQLVADLQQAVPQAELSAIGLDALAGEFDIVINATSASLSGDTLILPDALQFQHAYEMAYGKPSSFLEQAKARQIPTSEGFGMLVGQAIESFSIWNGVKPDLKDFL
>NZ_CP041295.1|WP_016658512.1|2609445_2611269_+|acyl-CoA-dehydrogenase-C-terminal-domain-containing-protein
MPAYKAPLHDIRFLMNEVFDYPAHYQTLSNGEAADPETVDMILEGAADFCENVLSPLNQTGDQEGCHFENGEVKTPKGFKEAYDQFVQSGWQGLSYPEQYGGQNLPMSLNLIKSEMMGTANWSFQMYPGLSVGCINTIIQYGTDEQKDTYLPHLVAGTWSGTMCLTEPQCGTDLGQVKTKAEPQADGTYAISGTKIFISAGEHDLTENIVHIVLARLPDAPAGTKGISLFIVPKFLPSADGGVGERNPVTCGSIEHKMGIRASATAVLNFDNAVGYLIGEPNKGLHAMFTFMNTARIGTAIQGICHAELAFQGALPYAKERMSMRALSGKKDPEKVADAIIHHADVRRMLLTQKAIAEGGRAMIYHAAQIADKMTDALERGDTAAFEQHDDHLGFYTPILKGFLTEMGYEAANHGMQVYGGHGYIKEWGMEQIVRDSRISTLYEGTTGVQALDLIGRKVLLTSKGKVIRDYTAEILKFCGQHARNKYMRRFAWDLTKLCAQWNALTVRIMLAARKDRDIVSSASVDFLMFSGYVMMAYFWAQQAAVASAKLASNDGAETPEFYKAKIKVADFYFERLLPRTQGHAEAMVNPSKTMTALAPEHFSFDY
>NZ_CP041295.1|WP_168370745.1|2611360_2612515_-|radical-SAM-family-heme-chaperone-HemW
MAELNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGKLSLDLEQQYLQALVADFNTQLEFAQGREIHSVFIGGGTPSLISAAGYQWLFAQLKALLPFQDDCEITLEANPGTIEHDPFAGYLAAGINRLSIGVQSFNSDHLQKLGRIHSQSDALSAIHLAREAGFQRINVDLMHGLPEQTLEQALNDLKLAVGQGATHISWYQLTIEPNTVFFRTQPVLPVDEVLEAIQEQGEAYLKANGFINYEVSAWRKERPSAHNLNYWQFGDYLAIGAGAHGKVTRPDGVYRFQKTRLPKDYLAKVPAEHGQFKRITAEEMPFEFMMNALRLNAGVDAKLYAQRTGLSLDDLAPVLTSLRQRKLMVEDASRLACTEQGHVFLNSVLEEFL
>NZ_CP041295.1|WP_104473172.1|2612642_2613101_+|DMT-family-transporter
MKISSQLLLLMPLAMGIGIAMTLQTAINTQLREYLYSPLQAALFSFLVGTIVLAILVFFQQVPKPNLHEIVHLPWYMWLGGVLGVYAISLSIYAAPKLGYLTLTGLILFGQIAMSMLVDHFGILGTEKAPINWQRLLGGVVIFIGVLLTLQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP041295_1	1.3\|1213727\|31\|NZ_CP041295\|CRISPRCasFinder	1213727-1213757	31	MK024806	Proteus phage Mydo, complete genome	105143-105173	9	0.71
NZ_CP041295_1	1.3\|1213727\|31\|NZ_CP041295\|CRISPRCasFinder	1213727-1213757	31	MT178275	Klebsiella virus KpS8, complete genome	49394-49424	9	0.71
NZ_CP041295_1	1.3\|1213727\|31\|NZ_CP041295\|CRISPRCasFinder	1213727-1213757	31	NC_048647	UNVERIFIED: Klebsiella phage KNP2 genomic sequence	40138-40168	9	0.71
NZ_CP041295_1	1.3\|1213727\|31\|NZ_CP041295\|CRISPRCasFinder	1213727-1213757	31	MT939253	Klebsiella phage vB_KpnM_Seu621, complete genome	49357-49387	9	0.71
NZ_CP041295_1	1.3\|1213727\|31\|NZ_CP041295\|CRISPRCasFinder	1213727-1213757	31	KX452695	UNVERIFIED: Klebsiella phage KPN2 genomic sequence	40138-40168	9	0.71

1. spacer 1.3|1213727|31|NZ_CP041295|CRISPRCasFinder matches to MK024806 (Proteus phage Mydo, complete genome) position: , mismatch: 9, identity: 0.71

ttgtcacgaactcccccaacaataagcgcag	CRISPR spacer
tcttcacgaactcccccaacgataacaaggc	Protospacer
*. *****************.****  . .

2. spacer 1.3|1213727|31|NZ_CP041295|CRISPRCasFinder matches to MT178275 (Klebsiella virus KpS8, complete genome) position: , mismatch: 9, identity: 0.71

ttgtcacgaactcccccaacaataagcgcag	CRISPR spacer
tcttcacgaactcccccaacgataacaaggc	Protospacer
*. *****************.****  . .

3. spacer 1.3|1213727|31|NZ_CP041295|CRISPRCasFinder matches to NC_048647 (UNVERIFIED: Klebsiella phage KNP2 genomic sequence) position: , mismatch: 9, identity: 0.71

ttgtcacgaactcccccaacaataagcgcag	CRISPR spacer
tcttcacgaactcccccaacgataacaaggc	Protospacer
*. *****************.****  . .

4. spacer 1.3|1213727|31|NZ_CP041295|CRISPRCasFinder matches to MT939253 (Klebsiella phage vB_KpnM_Seu621, complete genome) position: , mismatch: 9, identity: 0.71

ttgtcacgaactcccccaacaataagcgcag	CRISPR spacer
tcttcacgaactcccccaacgataacaaggc	Protospacer
*. *****************.****  . .

5. spacer 1.3|1213727|31|NZ_CP041295|CRISPRCasFinder matches to KX452695 (UNVERIFIED: Klebsiella phage KPN2 genomic sequence) position: , mismatch: 9, identity: 0.71

ttgtcacgaactcccccaacaataagcgcag	CRISPR spacer
tcttcacgaactcccccaacgataacaaggc	Protospacer
*. *****************.****  . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

866378 : 872302

Acinetobacter_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168370423.1\|866378_867740_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.4e-17	37.2
WP_005176472.1\|867851_868208_-	DUF861 domain-containing protein	NA	NA	NA	NA
WP_005176473.1\|868304_868853_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	3.4e-93	95.1
WP_005176474.1\|868946_869630_-	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	7.0e-88	75.5
WP_016659976.1\|869836_870643_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.5e-126	84.7
WP_168370424.1\|870660_871707_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	5.2e-167	86.8
WP_171065072.1\|871726_872302_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.0e-103	93.7

DBSCAN-SWA_2

1092875 : 1149031

uncultured_Caudovirales_phage(15.38%)

tRNA,transposase,protease,integrase

attL 1087992:1088007|attR 1151844:1151859

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1087992:1088007	attL	NA	NA	NA	NA
WP_104469906.1\|1092875_1093592_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_171526196.1\|1093821_1096221_+	ExeM/NucH family extracellular endonuclease	NA	NA	NA	NA
WP_104500673.1\|1096293_1097739_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	9.4e-167	63.7
WP_075174768.1\|1097956_1098568_+	glutathione S-transferase N-terminal domain-containing protein	NA	NA	NA	NA
WP_168370446.1\|1098622_1099927_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_104500674.1\|1100089_1100875_-	thiazole synthase	NA	NA	NA	NA
WP_005177095.1\|1100887_1101085_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_005177099.1\|1101117_1101483_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_005177101.1\|1101705_1102575_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	1.8e-43	39.5
WP_016658363.1\|1102711_1102948_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
WP_005177104.1\|1103333_1103546_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.9e-12	50.0
WP_005177106.1\|1103641_1104793_+	ATP-dependent RNA helicase RhlB	A0A1B1IS59	uncultured_Mediterranean_phage	3.0e-51	32.7
WP_005177108.1\|1104905_1105286_-	hypothetical protein	NA	NA	NA	NA
WP_034597478.1\|1105510_1106086_+	nitroreductase family protein	NA	NA	NA	NA
WP_016658361.1\|1106116_1107190_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_016658360.1\|1107274_1107730_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_168370447.1\|1107763_1108903_+	general secretion pathway protein GspL	NA	NA	NA	NA
WP_104490317.1\|1108902_1109382_+	type II secretion system protein M	NA	NA	NA	NA
WP_104491679.1\|1109472_1110474_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_016658356.1\|1110478_1111054_+	CvpA family protein	NA	NA	NA	NA
WP_005177128.1\|1111078_1112617_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	9.6e-85	39.6
WP_075166687.1\|1112707_1114597_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_104503534.1\|1114733_1115405_+	hypothetical protein	NA	NA	NA	NA
WP_168370448.1\|1115401_1116370_+	NAD(P)-binding domain-containing protein	M1NSB9	Streptococcus_phage	1.3e-18	27.3
WP_075166690.1\|1116452_1117892_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_168370835.1\|1117930_1118326_+	GFA family protein	NA	NA	NA	NA
WP_075166807.1\|1118374_1118731_+	hypothetical protein	NA	NA	NA	NA
WP_005177146.1\|1118849_1119296_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.8e-18	41.5
WP_001136722.1\|1119329_1119545_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_005177148.1\|1119692_1120709_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.7e-123	66.1
WP_104472989.1\|1121613_1122486_-	ATP-binding protein	NA	NA	NA	NA
WP_075166694.1\|1122666_1124181_+	DUF3336 domain-containing protein	NA	NA	NA	NA
WP_104498224.1\|1124146_1124983_+	protein kinase	NA	NA	NA	NA
WP_005177162.1\|1125735_1125939_-	hypothetical protein	NA	NA	NA	NA
WP_075166696.1\|1126391_1126664_+	hypothetical protein	NA	NA	NA	NA
WP_104469918.1\|1126679_1127414_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_168370449.1\|1127543_1129520_+	acyltransferase family protein	B5WZU0	Pseudomonas_phage	5.4e-56	34.5
WP_005177173.1\|1129580_1130813_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
WP_005177175.1\|1130968_1131388_+	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_005177178.1\|1131384_1131867_+	glutathione peroxidase	Q70H87	Fowlpox_virus	1.5e-23	38.0
WP_168370450.1\|1131991_1133161_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_075166700.1\|1133185_1135849_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_171260894.1\|1135872_1137087_-	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_104489690.1\|1137267_1137615_-	L-valine transporter subunit YgaH	NA	NA	NA	NA
WP_045795021.1\|1137604_1138363_-	AzlC family ABC transporter permease	NA	NA	NA	NA
WP_005177204.1\|1138465_1138960_+	hypothetical protein	NA	NA	NA	NA
WP_005177206.1\|1139313_1140405_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_127799176.1\|1140427_1140691_-	hypothetical protein	NA	NA	NA	NA
WP_075175198.1\|1140727_1141492_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_034586922.1\|1141518_1142577_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0H3UZC2	Geobacillus_virus	4.8e-27	36.2
WP_075167884.1\|1142597_1143011_+\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	6.2e-47	61.6
WP_104490323.1\|1144837_1145308_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_005177213.1\|1145360_1146110_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_104490328.1\|1146219_1146786_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_104500639.1\|1147810_1149031_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAT5	uncultured_Caudovirales_phage	7.2e-51	31.7
1151844:1151859	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1364491 : 1408225

uncultured_virus(20.0%)

plate,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035363010.1\|1364491_1364908_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.0
WP_168370484.1\|1364917_1367194_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.1e-164	43.6
WP_005177718.1\|1367304_1367658_+	YnfA family protein	A0A218MNG8	uncultured_virus	1.9e-28	59.4
WP_075167739.1\|1367741_1368215_-	hypothetical protein	NA	NA	NA	NA
WP_104470137.1\|1368534_1369827_+	MFS transporter	Q6JIH2	Burkholderia_virus	4.8e-37	29.6
WP_005177730.1\|1369906_1370821_-	ornithine carbamoyltransferase	NA	NA	NA	NA
WP_075167741.1\|1370935_1371586_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_045795692.1\|1371812_1372697_+	methylisocitrate lyase	NA	NA	NA	NA
WP_045795691.1\|1372701_1373841_+	2-methylcitrate synthase	NA	NA	NA	NA
WP_168370485.1\|1373918_1374539_-	aminotransferase	NA	NA	NA	NA
WP_045795689.1\|1374613_1375096_-	CinA family protein	A0A218MNG4	uncultured_virus	6.2e-22	38.1
WP_005177745.1\|1375305_1375539_+	hypothetical protein	NA	NA	NA	NA
WP_005177747.1\|1375715_1375859_+	hypothetical protein	NA	NA	NA	NA
WP_075167745.1\|1375977_1376310_+	hypothetical protein	NA	NA	NA	NA
WP_005177751.1\|1376707_1376944_+	hypothetical protein	NA	NA	NA	NA
WP_104473247.1\|1377319_1377667_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_005177756.1\|1377705_1377945_-	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_168370486.1\|1379419_1380190_+	hypothetical protein	NA	NA	NA	NA
WP_104489751.1\|1380238_1380676_+	hypothetical protein	A0A2H4JCJ6	uncultured_Caudovirales_phage	1.9e-46	60.1
WP_104489752.1\|1380635_1381277_+	hypothetical protein	A0A2H4JE07	uncultured_Caudovirales_phage	2.2e-112	89.6
WP_004279609.1\|1381344_1381554_+	hypothetical protein	NA	NA	NA	NA
WP_158650816.1\|1381638_1382472_-	hypothetical protein	NA	NA	NA	NA
WP_075175222.1\|1382868_1384029_+	MFS transporter	NA	NA	NA	NA
WP_168370487.1\|1384077_1385565_-	amidase	NA	NA	NA	NA
WP_005177765.1\|1385789_1386254_+	hypothetical protein	NA	NA	NA	NA
WP_005177767.1\|1386319_1387684_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_005177770.1\|1387701_1388124_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_104498775.1\|1388140_1388596_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_005177774.1\|1389657_1389915_+	hypothetical protein	NA	NA	NA	NA
WP_168370488.1\|1389918_1390581_+	zeta toxin	NA	NA	NA	NA
WP_075167749.1\|1391076_1391493_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_075167750.1\|1391494_1391917_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_168370489.1\|1391913_1392789_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_104499646.1\|1392930_1393695_+	alpha/beta fold hydrolase	A0A023W7H4	Mycobacterium_phage	2.3e-07	34.8
WP_104494741.1\|1393709_1394672_-	M15 family metallopeptidase	A0A0H3V0Q8	Geobacillus_virus	4.9e-10	32.1
WP_168370490.1\|1394668_1395313_-	hypothetical protein	NA	NA	NA	NA
WP_104484623.1\|1395327_1396134_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_005177795.1\|1396146_1397511_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_104484624.1\|1397516_1398632_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_104484625.1\|1398651_1401330_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	1.4e-78	29.5
WP_104484626.1\|1401720_1402359_+	hypothetical protein	NA	NA	NA	NA
WP_045795670.1\|1402379_1402883_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_005177804.1\|1402875_1404357_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_005177807.1\|1404401_1404905_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_045795669.1\|1404972_1405449_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_075175233.1\|1405460_1407266_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_168370491.1\|1407229_1408225_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_4

1781021 : 1791589

Catovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168370591.1\|1781021_1783655_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.8e-33	23.6
WP_005178805.1\|1783860_1784184_+	ferredoxin family protein	NA	NA	NA	NA
WP_005178806.1\|1784314_1785037_+	hypothetical protein	NA	NA	NA	NA
WP_005178807.1\|1785169_1785835_+	O-methyltransferase	S5YRC3	Mycobacterium_phage	5.0e-30	38.7
WP_168370156.1\|1785977_1786820_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	1.7e-35	33.9
WP_171526198.1\|1786956_1787553_-	acyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	1.3e-08	49.2
WP_168370593.1\|1787566_1788166_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.7e-21	39.6
WP_168370594.1\|1788269_1789454_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_104513340.1\|1789450_1791589_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.1e-25	23.5

DBSCAN-SWA_5

1890629 : 1899483

uncultured_Caudovirales_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104470299.1\|1890629_1891334_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.2e-92	70.5
WP_005179062.1\|1891333_1892383_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_168370609.1\|1892386_1892860_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.5e-36	52.6
WP_005179068.1\|1892864_1893182_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	7.9e-26	64.4
WP_168370610.1\|1893266_1893695_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.3e-41	60.6
WP_168370611.1\|1893839_1895231_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	2.8e-131	64.9
WP_005179080.1\|1895234_1895489_+	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	2.0e-16	46.6
WP_104491633.1\|1895625_1897191_-	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	1.5e-24	30.5
WP_104492240.1\|1897391_1898306_-	hypothetical protein	NA	NA	NA	NA
WP_045794839.1\|1898349_1899483_-	toxic anion resistance protein	K4F9M7	Cronobacter_phage	2.8e-17	22.8

DBSCAN-SWA_6

1949315 : 2058787

Shigella_phage(15.79%)

transposase,integrase

attL 1949262:1949277|attR 2021603:2021617

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1949262:1949277	attL	NA	NA	NA	NA
WP_104473196.1\|1949315_1950248_+\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.3e-57	40.3
1949262:1949277	attL	NA	NA	NA	NA
WP_104470036.1\|1950396_1950693_-	DUF4298 domain-containing protein	NA	NA	NA	NA
WP_168370620.1\|1951074_1952352_+\|integrase	tyrosine-type recombinase/integrase	A0A077KET4	Ralstonia_phage	6.3e-74	39.1
WP_168370621.1\|1952937_1954392_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_168370622.1\|1954488_1955565_-	hypothetical protein	NA	NA	NA	NA
WP_168370623.1\|1956029_1956656_+	TetR/AcrR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_168370624.1\|1957327_1958502_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.5e-45	37.0
1956658:1956673	attR	NA	NA	NA	NA
WP_067765066.1\|1959059_1960025_-	transporter	NA	NA	NA	NA
1956658:1956673	attR	NA	NA	NA	NA
WP_075399991.1\|1962354_1962588_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_168370625.1\|1962973_1964155_+	inovirus-type Gp2 protein	NA	NA	NA	NA
WP_168370626.1\|1964702_1965083_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
WP_168370627.1\|1965334_1967341_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_001094416.1\|1967437_1969084_-\|transposase	IS66-like element ISAba17 family transposase	A0A218MNE7	uncultured_virus	5.0e-140	52.6
WP_000618090.1\|1969158_1969494_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_046128035.1\|1969490_1969919_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168370845.1\|1970893_1973011_-	AAA family ATPase	NA	NA	NA	NA
WP_104487260.1\|1973056_1974204_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.9e-108	69.5
WP_168370628.1\|1975629_1978881_-	DEAD/DEAH box helicase family protein	NA	NA	NA	NA
WP_168370629.1\|1978877_1980233_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_168370630.1\|1982001_1982742_-	DUF45 domain-containing protein	NA	NA	NA	NA
WP_168370631.1\|1982743_1986025_-	HsdR family type I site-specific deoxyribonuclease	NA	NA	NA	NA
WP_168370846.1\|1986067_1989028_-	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_168370847.1\|1989068_1989998_-	DUF1016 family protein	NA	NA	NA	NA
WP_168370632.1\|1990000_1991188_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_168370633.1\|1991184_1992726_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	9.3e-88	38.6
WP_168370634.1\|1992725_1993346_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_168370635.1\|1993391_1993682_-	hypothetical protein	NA	NA	NA	NA
WP_168370848.1\|1993947_1994154_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168370636.1\|1994250_1994730_+	hypothetical protein	NA	NA	NA	NA
WP_168370637.1\|1994822_1995119_-\|transposase	transposase	NA	NA	NA	NA
WP_168370638.1\|1995273_1996314_+\|transposase	IS481 family transposase	A0A077SLK2	Escherichia_phage	8.8e-175	83.2
WP_168370639.1\|1996444_1996840_-\|transposase	transposase family protein	NA	NA	NA	NA
WP_104487260.1\|1997359_1998506_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	7.9e-108	69.5
WP_168370640.1\|1998618_1999872_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_075168045.1\|2000899_2001070_+	DUF2559 family protein	NA	NA	NA	NA
WP_075168046.1\|2001082_2001679_+	putative adenosine monophosphate-protein transferase Fic	NA	NA	NA	NA
WP_168370641.1\|2001782_2002679_-	hydrolase or metal-binding protein	NA	NA	NA	NA
WP_168370642.1\|2002817_2003891_-	YqaJ viral recombinase family protein	A0A139ZPJ9	Marinitoga_camini_virus	9.1e-42	35.9
WP_168370643.1\|2003976_2005014_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	1.9e-60	38.6
WP_004960801.1\|2005125_2005425_-	hypothetical protein	NA	NA	NA	NA
WP_004960803.1\|2005565_2005946_-	hypothetical protein	NA	NA	NA	NA
WP_168370644.1\|2005957_2006539_-	hypothetical protein	NA	NA	NA	NA
WP_168370849.1\|2006556_2006817_-	hypothetical protein	NA	NA	NA	NA
WP_171294856.1\|2007782_2009819_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005179182.1\|2009923_2010277_-	hypothetical protein	NA	NA	NA	NA
WP_005179184.1\|2010498_2011839_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	1.7e-53	79.4
WP_005179187.1\|2011897_2013169_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	6.8e-20	30.2
WP_075167719.1\|2013317_2014352_+	dihydroorotase	NA	NA	NA	NA
WP_075167718.1\|2014336_2014996_+	ribonuclease T	L0N5X9	Acaryochloris_phage	5.9e-07	25.1
WP_168370645.1\|2015249_2017745_+	TonB-dependent receptor plug domain-containing protein	NA	NA	NA	NA
WP_016659224.1\|2017828_2017987_+	hypothetical protein	NA	NA	NA	NA
WP_104489167.1\|2018405_2019824_+	amino acid permease	NA	NA	NA	NA
WP_168370850.1\|2020057_2020819_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_075174999.1\|2021535_2022780_-	NADH:flavin oxidoreductase/NADH oxidase family protein	NA	NA	NA	NA
WP_168370851.1\|2022880_2024467_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-19	36.2
WP_075167714.1\|2024441_2025455_-	ABC transporter permease	NA	NA	NA	NA
WP_005179212.1\|2025454_2026525_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
WP_104473190.1\|2026554_2028393_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168370646.1\|2028420_2031630_-	LysM peptidoglycan-binding domain-containing protein	A0A0A7NU10	Lactobacillus_phage	4.5e-20	37.2
WP_104473188.1\|2031836_2033324_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	2.3e-35	43.0
WP_005179216.1\|2033449_2035093_+	hypothetical protein	NA	NA	NA	NA
WP_075167710.1\|2035092_2035860_+	NAD(+) diphosphatase	NA	NA	NA	NA
WP_160232395.1\|2035871_2036756_-	DUF1749 domain-containing protein	NA	NA	NA	NA
WP_016659235.1\|2036745_2037429_-	BON domain-containing protein	NA	NA	NA	NA
WP_075167708.1\|2037490_2037913_-	YraN family protein	NA	NA	NA	NA
WP_104473186.1\|2037913_2038882_-	penicillin-binding protein activator	NA	NA	NA	NA
WP_104470024.1\|2038893_2039739_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-45	43.2
WP_005179228.1\|2039792_2040041_-	hypothetical protein	NA	NA	NA	NA
WP_168370647.1\|2040217_2041459_-	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_075167704.1\|2041455_2042664_-	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_075174985.1\|2043462_2044791_-	Xaa-Pro aminopeptidase	NA	NA	NA	NA
WP_075167701.1\|2044838_2045468_-	UPF0149 family protein	NA	NA	NA	NA
WP_168370648.1\|2045532_2046084_+	hypothetical protein	NA	NA	NA	NA
WP_005179243.1\|2046086_2046374_+	cell division protein ZapA	NA	NA	NA	NA
WP_168370363.1\|2048103_2049036_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	5.1e-57	40.5
WP_104494559.1\|2049226_2050126_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_160255523.1\|2050175_2051891_-	D-lactate dehydrogenase	NA	NA	NA	NA
WP_104470019.1\|2051986_2053141_-	FMN-dependent L-lactate dehydrogenase LldD	NA	NA	NA	NA
WP_045795925.1\|2053137_2053887_-	transcriptional regulator LldR	NA	NA	NA	NA
WP_171293315.1\|2053911_2055582_-	L-lactate permease	NA	NA	NA	NA
WP_160232389.1\|2056104_2056602_-	hypothetical protein	NA	NA	NA	NA
WP_160232388.1\|2057711_2058787_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.3e-45	40.4

DBSCAN-SWA_7

2873333 : 2914149

Helicobacter_phage(22.22%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_075167936.1\|2873333_2873948_+\|transposase	IS607 family transposase	A0A1S5RGS9	Helicobacter_phage	2.7e-62	63.2
WP_016659040.1\|2873944_2875102_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A7P9	Microcystis_virus	2.7e-55	36.9
WP_005181018.1\|2875565_2876219_+	TetR family transcriptional regulator C-terminal domain-containing protein	NA	NA	NA	NA
WP_162182856.1\|2876262_2876832_-	5'-nucleosidase	NA	NA	NA	NA
WP_075167935.1\|2877127_2878132_+	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
WP_104490436.1\|2878193_2881040_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.9e-78	26.2
WP_005181030.1\|2881032_2881572_+	signal peptidase II	NA	NA	NA	NA
WP_005181033.1\|2881564_2882047_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_005181039.1\|2882185_2882728_+	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_075175576.1\|2883230_2884397_-	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_016658670.1\|2884765_2886115_-	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_016659793.1\|2892203_2892776_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_160255809.1\|2892873_2893584_+	acetoacetate decarboxylase family protein	NA	NA	NA	NA
WP_005181046.1\|2893594_2894671_-	alpha/beta hydrolase	M1PGN2	Moumouvirus	4.0e-29	32.2
WP_168370823.1\|2894873_2895299_+	hypothetical protein	NA	NA	NA	NA
WP_168370824.1\|2895542_2895794_-	hypothetical protein	NA	NA	NA	NA
WP_005181051.1\|2896624_2897173_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
WP_075168302.1\|2897292_2899233_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.8e-147	49.7
WP_104499929.1\|2899464_2900376_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_162182855.1\|2900496_2900886_+	hypothetical protein	NA	NA	NA	NA
WP_171260954.1\|2900924_2902106_-	lytic murein transglycosylase	NA	NA	NA	NA
WP_104488335.1\|2902941_2904063_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_005181065.1\|2904078_2904591_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.4e-19	40.9
WP_075175484.1\|2904879_2906160_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_005181069.1\|2906163_2906502_-	DMT family protein	NA	NA	NA	NA
WP_160232203.1\|2906756_2908124_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_158650729.1\|2908131_2908449_-	hypothetical protein	NA	NA	NA	NA
WP_171502358.1\|2908470_2908920_-\|transposase	IS200/IS605 family transposase	A0A1S5RHE3	Helicobacter_phage	1.2e-32	48.5
WP_160232201.1\|2908992_2910384_+\|transposase	transposase	A0A2I7RKG5	Vibrio_phage	1.9e-07	22.2
WP_016659776.1\|2910592_2910874_-	N-acetyltransferase	NA	NA	NA	NA
WP_104484545.1\|2910912_2911197_-	N-acetyltransferase	NA	NA	NA	NA
WP_075168119.1\|2911770_2912736_+	TerC family protein	A0A1D7XFL1	Escherichia_phage	2.5e-30	32.2
WP_163170003.1\|2912844_2914149_+\|transposase	IS4 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP041297

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP041295

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection