CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP051545	Paracoccus sanguinis strain OM2164 plasmid pPspOM7, complete sequence	0 crisprs	NA	0	0
NZ_CP051543	Paracoccus sanguinis strain OM2164 plasmid pPspOM122, complete sequence	0 crisprs	NA	0	1
NZ_CP051544	Paracoccus sanguinis strain OM2164 plasmid pPspOM44, complete sequence	0 crisprs	NA	0	0
NZ_CP051542	Paracoccus sanguinis strain OM2164 chromosome, complete genome	5 crisprs	csa3,cas3,WYL,DEDDh	6	230

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

52013 : 102838

Leptospira_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781947.1\|52013_53513_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168781936.1\|53797_54986_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168784015.1\|54991_58912_-	glycosyltransferase	NA	NA	NA	NA
WP_168781936.1\|58998_60188_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168784016.1\|60379_61726_-	nucleotide sugar dehydrogenase	NA	NA	NA	NA
WP_088238952.1\|61622_62410_-\|transposase	IS5-like element ISPme2 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.4e-17	41.8
WP_168784017.1\|63045_64146_+	Fic family protein	D7RWK9	Brochothrix_phage	9.2e-05	34.5
WP_168784018.1\|64164_65673_+	malonyl-CoA synthase	A0A2H4PQM9	Staphylococcus_phage	7.3e-29	26.6
WP_168784019.1\|65767_66445_-	lysozyme inhibitor	NA	NA	NA	NA
WP_168784020.1\|66606_69291_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	1.6e-66	29.6
WP_088238952.1\|69589_70377_-\|transposase	IS5-like element ISPme2 family transposase	A0A0N9SJT9	Paenibacillus_phage	3.4e-17	41.8
WP_168784021.1\|70508_70949_+	hypothetical protein	NA	NA	NA	NA
WP_168784022.1\|71617_72529_+	EamA family transporter	NA	NA	NA	NA
WP_168784023.1\|72525_73125_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_168784024.1\|73329_74388_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_168784062.1\|74575_74872_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168784025.1\|75088_76150_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_168784026.1\|76146_76809_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_168784027.1\|76828_77488_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_168784063.1\|77547_78264_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_168784064.1\|78965_79922_+	Hint domain-containing protein	NA	NA	NA	NA
WP_168784028.1\|80015_80981_+	threonine-phosphate decarboxylase	NA	NA	NA	NA
WP_168784029.1\|80977_82423_-	cobyric acid synthase	NA	NA	NA	NA
WP_168784030.1\|82427_83069_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_168784031.1\|83440_83797_+	DUF1636 domain-containing protein	NA	NA	NA	NA
WP_168784032.1\|83800_84835_+	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
WP_168784033.1\|84841_88081_+	cobaltochelatase subunit CobN	NA	NA	NA	NA
WP_168784034.1\|88077_89208_+	precorrin-3B synthase	NA	NA	NA	NA
WP_168784035.1\|89207_89837_+	precorrin-8X methylmutase	NA	NA	NA	NA
WP_168784036.1\|89833_90607_+	precorrin-2 C(20)-methyltransferase	NA	NA	NA	NA
WP_168784037.1\|90603_91344_+	precorrin-3B C(17)-methyltransferase	NA	NA	NA	NA
WP_168784038.1\|91316_92069_-	cobalt-precorrin-6A reductase	NA	NA	NA	NA
WP_168784039.1\|92067_93246_+	precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE	NA	NA	NA	NA
WP_168784040.1\|93242_93617_+	cobalamin biosynthesis protein	NA	NA	NA	NA
WP_168784041.1\|93613_94387_+	precorrin-4 C(11)-methyltransferase	NA	NA	NA	NA
WP_168784042.1\|94383_95715_+	cobyrinate a,c-diamide synthase	NA	NA	NA	NA
WP_168784043.1\|96041_96710_+	cobalt transporter	NA	NA	NA	NA
WP_168784044.1\|96773_97532_+	precorrin-6A synthase (deacetylating)	NA	NA	NA	NA
WP_168784045.1\|97633_98425_+	propanediol utilization protein	NA	NA	NA	NA
WP_168784046.1\|98421_99357_+	cobalamin biosynthesis protein CobD	NA	NA	NA	NA
WP_168784065.1\|99495_100833_-	hypothetical protein	NA	NA	NA	NA
WP_168781936.1\|101649_102838_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP051542

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051542_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051542_2

74182-74261

Orphan

Consensus_repeat	Method
TGTCGTTGCCCGCGCCGCCGTTCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051542_2

>merge|NZ_CP051542|2|74182-74261|CRISPRCasFinder
TGTCGTTGCCTTCGCCGGCGTTGATGGTGTCGGACCCGGTCCCCGAGCGGATCGTGTCGTTGCCTTCGCCGGCGTTGATC

>NZ_CP051542|2|2|74182-74261|CRISPRCasFinder
TGTCGTTGCCTTCGCCGGCGTTGATG	GTGTCGGACCCGGTCCCCGAGCGGATCG
TGTCGTTGCCTTCGCCGGCGTTGATC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051542.1\|WP_168781972.1\|67978_68332_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238152
NZ_CP051542.1\|WP_043131119.1\|69768_70494_+\|heme-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|273492
NZ_CP051542.1\|WP_168781982.1\|84802_85810_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|274743
NZ_CP051542.1\|WP_168783753.1\|72409_73537_+\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|377230
NZ_CP051542.1\|WP_036700691.1\|79564_79996_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|312075
NZ_CP051542.1\|WP_036700690.1\|80131_80299_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|179075
NZ_CP051542.1\|WP_036700695.1\|70656_71202_+\|DsbE-family-thiol:disulfide-interchange-protein	unknown	unknown	gnl\|CDD\|129481
NZ_CP051542.1\|WP_168781975.1\|73533_73698_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_168781984.1\|87287_88253_+\|GTP-cyclohydrolase-I-FolE2	unknown	unknown	gnl\|CDD\|237466
NZ_CP051542.1\|WP_168781983.1\|85988_87182_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|168979
NZ_CP051542.1\|WP_168781978.1\|77769_78894_+\|DUF1223-domain-containing-protein	unknown	unknown	gnl\|CDD\|369071
NZ_CP051542.1\|WP_168781980.1\|81408_82059_-\|septation-protein-IspZ	unknown	unknown	gnl\|CDD\|367894
NZ_CP051542.1\|WP_168781973.1\|69067_69724_+\|heme-exporter-protein-CcmB	unknown	unknown	gnl\|CDD\|200083
NZ_CP051542.1\|WP_168781979.1\|80545_81460_+\|DUF726-domain-containing-protein	unknown	unknown	gnl\|CDD\|333880
NZ_CP051542.1\|WP_168783752.1\|68340_68970_+\|heme-ABC-exporter-ATP-binding-protein-CcmA	unknown	unknown	gnl\|CDD\|237421
NZ_CP051542.1\|WP_168781974.1\|71400_72384_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP051542.1\|WP_036700704.1\|66983_67979_+\|protein-translocase-subunit-SecF	unknown	unknown	gnl\|CDD\|237275
NZ_CP051542.1\|WP_168781981.1\|82319_84758_-\|UvrD-helicase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273429
NZ_CP051542.1\|WP_168781977.1\|74683_77470_-\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP051542.1\|WP_074826769.1\|70493_70664_+\|heme-exporter-protein-CcmD	unknown	unknown	gnl\|CDD\|377440

Protein	Function_ID	Function_description	E-value
NZ_CP051542.1\|WP_168781972.1\|67978_68332_+\|hypothetical-protein	gnl\|CDD\|238152	cd00248, Mth938-like, Mth938-like domain. The members of this family include: Mth938, 2P1, Xcr35, Rpa2829, and several uncharacterized sequences. Mth938 is a hypothetical protein encoded by the Methanobacterium thermoautotrophicum (Mth) genome. This protein crystallizes as a dimer, although it is monomeric in solution, with one disulfide bond in each monomer. 2P1 is a partially characterized nuclear protein which is homologous to E3-3 from rat and known to be alternately spliced. Xcr35 and Rpa2829 are hypothetical proteins of unknown function from the Xanthomonas campestris and Rhodopseudomonas palustris genomes, respectively, for which the crystal structures have been determined.	8.80236e-39
NZ_CP051542.1\|WP_043131119.1\|69768_70494_+\|heme-ABC-transporter-permease	gnl\|CDD\|273492	TIGR01191, Heme_exporter_protein_C, heme exporter protein CcmC. This model describes the cyt c biogenesis protein encoded by ccmC in bacteria. It must be noted an arabidopsis, a tritcum and a piscum plant proteins were recognizable in the clade. Quite likely they are of organellar origin. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes, ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in the heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	1.25879e-88
NZ_CP051542.1\|WP_168781982.1\|84802_85810_-\|TerC-family-protein	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	5.10298e-141
NZ_CP051542.1\|WP_168783753.1\|72409_73537_+\|YeeE/YedE-family-protein	gnl\|CDD\|377230	pfam04143, Sulf_transp, Sulphur transport. This is an integral membrane protein. It is predicted to have a function in the transport of sulphur-containing molecules. It contains several conserved glycines and an invariant cysteine that is probably an important functional residue.	1.08524e-26
NZ_CP051542.1\|WP_036700691.1\|79564_79996_+\|PAS-domain-containing-protein	gnl\|CDD\|312075	pfam08448, PAS_4, PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.	1.39813e-07
NZ_CP051542.1\|WP_036700690.1\|80131_80299_+\|50S-ribosomal-protein-L33	gnl\|CDD\|179075	PRK00595, rpmG, 50S ribosomal protein L33; Validated.	4.66195e-19
NZ_CP051542.1\|WP_036700695.1\|70656_71202_+\|DsbE-family-thiol:disulfide-interchange-protein	gnl\|CDD\|129481	TIGR00385, Thiol:disulfide_interchange_protein_DsbE_homolog, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily. Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins. [Protein fate, Protein folding and stabilization].	1.66973e-75
NZ_CP051542.1\|WP_168781984.1\|87287_88253_+\|GTP-cyclohydrolase-I-FolE2	gnl\|CDD\|237466	PRK13674, PRK13674, GTP cyclohydrolase I FolE2.	5.56472e-124
NZ_CP051542.1\|WP_168781983.1\|85988_87182_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|168979	PRK07504, PRK07504, O-succinylhomoserine sulfhydrylase; Reviewed.	1.54932e-179
NZ_CP051542.1\|WP_168781978.1\|77769_78894_+\|DUF1223-domain-containing-protein	gnl\|CDD\|369071	pfam06764, DUF1223, Protein of unknown function (DUF1223). This family consists of several hypothetical proteins of around 250 residues in length which are found in both plants and bacteria. The function of this family is unknown. Structurally it lies in the Thioredoxin-like superfamily.	2.10698e-66
NZ_CP051542.1\|WP_168781980.1\|81408_82059_-\|septation-protein-IspZ	gnl\|CDD\|367894	pfam04279, IspA, Intracellular septation protein A.	4.34047e-62
NZ_CP051542.1\|WP_168781973.1\|69067_69724_+\|heme-exporter-protein-CcmB	gnl\|CDD\|200083	TIGR01190, Heme_exporter_protein_B, heme exporter protein CcmB. This model describes the cyt c biogenesis protein encoded by ccmB in bacteria. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome C. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	4.78115e-73
NZ_CP051542.1\|WP_168781979.1\|80545_81460_+\|DUF726-domain-containing-protein	gnl\|CDD\|333880	pfam00151, Lipase, Lipase.	3.06493e-06
NZ_CP051542.1\|WP_168783752.1\|68340_68970_+\|heme-ABC-exporter-ATP-binding-protein-CcmA	gnl\|CDD\|237421	PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional.	5.622e-88
NZ_CP051542.1\|WP_168781974.1\|71400_72384_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	3.25499e-54
NZ_CP051542.1\|WP_036700704.1\|66983_67979_+\|protein-translocase-subunit-SecF	gnl\|CDD\|237275	PRK13022, secF, protein translocase subunit SecF.	1.97747e-122
NZ_CP051542.1\|WP_168781981.1\|82319_84758_-\|UvrD-helicase-domain-containing-protein	gnl\|CDD\|273429	TIGR01073, ATP-dependent_DNA_helicase_PcrA, ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP051542.1\|WP_168781977.1\|74683_77470_-\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP051542.1\|WP_074826769.1\|70493_70664_+\|heme-exporter-protein-CcmD	gnl\|CDD\|377440	pfam04995, CcmD, Heme exporter protein D (CcmD). The CcmD protein is part of a C-type cytochrome biogenesis operon. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation. These proteins contain a predicted transmembrane helix.	1.28512e-05

>NZ_CP051542.1|WP_168781975.1|73533_73698_+|hypothetical-protein
MTRRVMAALCLAGLAALIGADLAAAPPNPYRAPAMLALGSGAVASGGFCGALPR
>NZ_CP051542.1|WP_168783753.1|72409_73537_+|YeeE/YedE-family-protein
MGAREAPATPLVPGLASRSAAVALALAALAAVALFVGARFALLLAIGLGFGITLEGLRFGFAGPWRALILRREAGGVLAQILAIALTALVAMPLIAANPGELSGAAAPIGWAMLGGAFVFGAAMQVVLGCGSGTLVNAGSGNPVAVVALPFFALGSFLGSFSLVWWTNLGSLPVVVLGGASGLGITLALLAVLAAVVLAVAAPGHRRIPGRWIAAAGLLAALALANLVVSGQPWGVVYGLGLWGAKAAASLGVDLSASAFWSAPGNAARVTQSVLTDITSLTAFGTILGAMLVAFWRGGLAQRLPDLPARAWVATVVSGLLLGYSSRLAFGCNVGALFSGISTGSLHGWAWLVMGFAGSAVGVRLRPWLGMEGRQ
>NZ_CP051542.1|WP_168781974.1|71400_72384_+|sulfurtransferase
MRFIAPFLTAAAVALAVPALAQTAPAPTAPVSATPAAEAPRAQHLGPLVTPAELAATDRAPLILDIRGADYAKGHIPGAVDAPYKLFRGPTDNPGRPVAPEQLQATLSQLGVELDRPVVVVHQGSDQDDFGAAARVYWTLKSAGVQDIAILNGGMNGWAAAGQPTETTPVTPAPSLIEITWDDRWTATEAEVAAIAAGKGDAVLLDARPPGFYEGRQAHAAASVPGTVPGAENVPHTEWFAGSTPAIAPAATAADVARALGLSPDREIVTFCNTGHWAATEWFALSELAGLPDVKMYPESMVGYTRGDHEIANRPGLVENLLRQIRG
>NZ_CP051542.1|WP_036700695.1|70656_71202_+|DsbE-family-thiol:disulfide-interchange-protein
MARISPLVALPPVLFAGLAAMFYWGMGRDDPTAIPSTLIGQEAPAVPATTLPGATPLTDADLRSGKVTLVNFWASWCPPCRAEHPTLTALAAEGIPVMGIDLKDPEPAAQRFLAEHGNPFARLATDPQGRAAIDWGVTAPPETFILDAEGRVLYRHAGPLIREDYTNRFRPELDKALAAQK
>NZ_CP051542.1|WP_074826769.1|70493_70664_+|heme-exporter-protein-CcmD
MVELGKYAVPVLSAWAISLALIVALVVQTLAASARARRDLERVEPPRNRQQESRRG
>NZ_CP051542.1|WP_043131119.1|69768_70494_+|heme-ABC-transporter-permease
MSLWEYANPVKFMRLSGAVLPWVTAAAAVTLVGGLIWGFSVPEDYKQGATVKIMFLHVPAAMMAINIWVMMLVTSLIWLIRRHHVSALAARAAAPVGAVMTVIALVTGAVWGQPMWGTWWEWDPRLTSFLILFLFYLGYMALWAAIENPDSAADLTGVLCLVGSVFALLSRYAVNFWNQGLHQGATISVAPGDRISSVYSYPLYTCMAGFFLLFLALLLVRTRTEIRRRRTAALLAREVRG
>NZ_CP051542.1|WP_168781973.1|69067_69724_+|heme-exporter-protein-CcmB
MKALLLRDLALATRAGGGFGLGLAFFLILCTLVPFGVGPEGGTLARIAPGILWVGALLACLLSLDRLFALDWEDGSLDLLATSPLPLEGAVGIKALAHWITTGLPLVVAAPLFGILLHLPGAALPWLVAALLLGTPALSMLGAFGAALTVGLRRGGLLMSLLVLPLYVPTLIFGAEAVRRGAAGADGMTPLVLLAGISLAVLAAIPFAAAAALRVNLR
>NZ_CP051542.1|WP_168783752.1|68340_68970_+|heme-ABC-exporter-ATP-binding-protein-CcmA
MVTAHDLAVSRGGRRAVERVAFTLAPGEALILRGPNGIGKTTLLRTVAGLQPPAAGRIEADPDAIAYAAHADGLKGALTVAENLDFWRAVFGGPPIGPALEAMNLAALAERPAAMLSAGQKRRTGLARLMVTGRAVWVLDEPTVSLDADSVALFARVVRGHLAAGGAALVATHIDLGLPEARILDLARFRADPDRPTDRAPASFDEAFA
>NZ_CP051542.1|WP_168781972.1|67978_68332_+|hypothetical-protein
MAMKETDFAGAVPVDGYGPGFFRVGGRLHHGPVIVTAAGPRPWGGLDDLAALEALGGTVDVLFLGMGADPARPPAALSQALAAAGLAVEPTATPTAARSYNVTLSEGRRVACALLPV
>NZ_CP051542.1|WP_036700704.1|66983_67979_+|protein-translocase-subunit-SecF
MAFRLKLVPDVTHYDFFRWQKLTFGISAVAMIASVIIIFLNGFNFGIDFKGGTTIRAESPTAFEVSDYRQALGGLNLGDVSITEVFDPSFGADRHVAMIRIGTSGETGSVTPEELNQVEAALKTVDPQVRFAAVESVGPKVSGELIKTALYAVGAATLGILFYVWLRFEWQFAVGGVFALVHDILLTAGIFSLFQIKFDLSTIAALLTILGYSINDTVVVFDRLRENLIKFKTMPLIEVMNLTVNETLSRTIMTAVATALALAALLALGGDVIRGFVFAMLWGVFVGCYSTIYVAKNIVLWLGVKRDWSKPEKTPAGEVSDLAGTPFQDRP
>NZ_CP051542.1|WP_168781977.1|74683_77470_-|aconitate-hydratase-AcnA
MPIVTGTDTAKTRRELSAGGATYAYYSIPAATEAGLGDFSRLPAALKVVLENMLRFEDDGFTVSVDDIKAFAQWAQDGGKSDREIAYRPARVLMQDFTGVPAVVDLAAMRDGIKALGGDAQKINPLNPVDLVIDHSVMVDEFGTPRAFQRNVDLEYDRNMERYQFLKWGQGAFNNFRVVPPGTGICHQVNLEYLAQTVWTDTDQDGKTVAYPDTLVGTDSHTTMVNGLAVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKITGALKEGVTATDLVLKVVKMLRDHKVVGKFVEFYGAGLDNMPLADRATIANMAPEYGATCGFFPVDDETLRYLRQTGRDEDRIALVEAYAKANGLWRDAAYEPVYTSTLSLDLGDVVPAISGPKRPQDHVALDAAAQTFKAYIEGLKPAPSVPKEQKFEMTEEGGAPSPSSDQIPGGNRGGAELFGAPVEGRDFTLNDGSVVIAAITSCTNTSNPYVLMAAGLVARKARALGLTRKPWVKTSLAPGSQVVAEYLDAAGLQDDLDALGFNLVGFGCTTCIGNSGPLEPEISKAIAENDLVAVSVLSGNRNFEGRISPDVRANYLASPPLVVAYAIAGDMNIDITREPIGQDKDGRDVFLKDIWPTSAEVSDLVHKVVTREMFQSKYADVFKGDERWQAVETTDSETYDWPATSTYIQNPPYFQGMNREPGVITDIEGARVLAVLGDMITTDHISPAGSFKPTTPAGKYLTERQVAPADFNSYGSRRGNHEIMMRGTFANIRIKNEMLEGVEGGYTKGPDGDETSIYDAAMAYQQAGTPLVVVGGVEYGAGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVIPFEFTGGDTRKTLGLTGAEVISIHGLADDFKPLKIVPATIRYADGTEKTVDLKARVDTEVEIEYLKNGGVLHYVLRNLAKS
>NZ_CP051542.1|WP_168781978.1|77769_78894_+|DUF1223-domain-containing-protein
MSCAAPTPLRHPVPTSRLACAPSSGPSAGPGRTPLKALALALSVLLVSLTAAPHPLSADPFDGAPGQEQVGDAPDTGDFDPGFDPGDMGDAVDPGDIAVIEAPDDNGYTVPGEGFVEDMPMGGEGFALVPERADPMRGQAAPAPRAAMARSIAAPVVVELFTAQGCSTCPVADALLAGLADLPGVLPLSWHVDYWDYLGWTDNFADPRHTTRQEGYAAAAGERGVYTPQIIVDGQDTLIGVGRMGLLALIDEHASRPPAVMVTAAEDGGNPVIDLTPRAAIPGGVDVLLVRYLPERKVRIDGGENRGHSILYRNIVVGVEKLSAWPARTPLRLTVRPGTMASRGYPADTRHAILVQQPLRGGRPGPILAALRLD
>NZ_CP051542.1|WP_036700691.1|79564_79996_+|PAS-domain-containing-protein
MLPHPESVLRDAIPVDLAAGLALSSTPGADRGTRLALALMRHMVQPVILMDPDGRVTQLNPAAQSLLMPGEPGRFGPGGRFWWQLWPHADGLALRGALAEAAGGETVRVTLDCRRAVASTAVLVPIEDAGGGVAKVMCLLRAR
>NZ_CP051542.1|WP_036700690.1|80131_80299_+|50S-ribosomal-protein-L33
MAKPTTIKIRLNSTAGTGHFYVTKKNARTMTEKMTVNKYDPVLRKHVEYKEGKIK
>NZ_CP051542.1|WP_168781979.1|80545_81460_+|DUF726-domain-containing-protein
MALVRIDSGAPVPAELWRRAETLPPDRPVVVMIHGYRFTPSVPDRSPHHHILSLTPDPGARRALSWPAALGFSAEGSEGLGVALGWDSCGGLRAVHGRAAEVGAELAALIDRLALAARRPVALIGHSLGARVALAALGRAAPGAVGRVVLLAAAELRPRAEAAIASPAGMLAEVVNVTSRENDPFDLALELILSAGRHRALGFGLGQPRRNWVDLQIDDAATLASLGRLGFAIDPRASRACHWSPYLRAGLFDLWRCVLCTPAALPLPLLAAAGPARPARRWSRLMAPQRGVPSSPAFSSGISA
>NZ_CP051542.1|WP_168781980.1|81408_82059_-|septation-protein-IspZ
MTDRTPASAPRAPLPHSLKLALDYGPLVAFLVVFLLYRDRTVHWGGQSYPGLIVATLVFVPLTIAANAVLWARTRKLSVMQLVTLVIVVIFGGLTIWLNDERFIKMKPTFIYLLLAGMLGLGLVLRRNWLALAMGEMVPLAPEGWRRLTLRMTGLFLTLAVLNEIIWRTQSDTTWVLFKTVGLIALTFVFLMANVPLIQRYALIPEENAGEDGTPR
>NZ_CP051542.1|WP_168781981.1|82319_84758_-|UvrD-helicase-domain-containing-protein
MSQFDDADAFEAAASRAPAPRPSLSARAMGIGAQAAPAYLDGLNPAQRAAVEALDGPVLLLAGAGTGKTRALTTRIAHLLTQGRATPGRILAVTFTNKAAREMKARIAKLLGETIEGMPWLGTFHSVSVKILRRHAELVGVGDLHLKSSFTILDTDDQLRLLKQLIAAENIDEKRWPARMLAGLIDDWKNRALTPGRVPASESHAYDGKGVALYTQYQRRLIELNATDFGDLLLHCVTIFQAHPDVLAQWQDRFRYILVDEYQDTNVAQYLWLRLLAAGHRNICCVGDDDQSIYGWRGAEVGNILRFETDFPGAQVIRLEQNYRSTPQILAAASGLIAANKGRLGKTLWTEAEPGEKVRLIGHWDSEAEARWIGEEIEAFHGGHRHSVGRRSLNDIAILVRAAHQMRAFEDRFMTIGLPYRVIGGPRFYERLEIRDAMAYFRLAVSPTDDLAFERIANTPKRGLGDKGLQTIQRVARAEGLSLLQGAAAAVASGDLGGKAAAQMRLFTEAMGRFHADALDSRVSHVELAERILDETGYTAMWQADKSPDAPGRLDNLKELVKALEEFENLQGFLEHVALVMDAAEGEQAEEVSIMTLHAAKGLEYPIVFLPGWEDGLFPSQRSMDESGLKGLEEERRLAYVGLTRAEDLATISFAGNRRMYGQWQSSLPSRFIDELPEDQIEVLTPPGLYGGGYGAAAQGFGQPFTPSAMHDRASRADVYNSPGWKRMQERAAARSAPTHRTPIVIDATPGERFAVGERVFHPKFGTGTVQGIAEDTLTVEFPAGFKTIKAAYVQPAAEAARDITPSDDVPF
>NZ_CP051542.1|WP_168781982.1|84802_85810_-|TerC-family-protein
MDFLTSTMFLGQPVWMWAVFLTAVVVLLVLDLGVLNRGNREIGVRRSLMLSVMYIALGLGFGGFVWWQMGQQPALEYLTGFVVEKSLAMDNVFVIAMIFGALAIPRQYQHRVLFWGILGVIVLRGIMIGVGATLVARYEWILLIFAVFLIATGIKMLLSSGDEDHDVGQSRILRWLKRNLRVTSRLHGERFFVRRADPRPGRRGKTLLFATPLFLALAMVEIADVIFAVDSVPAIFAITTDPYIVYTSNIFAILGLRALYFALAAIIHRFAYLKQALAVLLVFIGGKVIVAEMLGIEKVPPSVSLSVTFVILAAGVAYSLWRTRGAAHAELTNKA
>NZ_CP051542.1|WP_168781983.1|85988_87182_+|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MAENSDSPPRPASARHPRTRAVHAGIRRSQYGEMAEALFLTQGFAYASAEEAEARFIKSGPDEFIYARYGNPTSRMFEDRMASLEGTEDAFATASGMAAVNGALMAIARPGERIVAARQLFGSCLYVLDILKRFGVDVVLLDGTDLDQWRAAVTPGTRAVFFETVSNPTLEVMDIAGIADIAHAAGALVVVDNVFATPVFSRAVDQGADVVIYSTTKHVDGGGRALGGVICGTRQFVREVAEPYLKHTGGAISPFNAWIMLNGLSTLELRVRAMADGALALALALEGAGVRVIYPGLAAHPQHALAMRQMGSGGTMIALDLGTKEAAFAALNRMDLVSISNNLGDAKSIATHPATTTHQRLSEDDRAAMGIGPGLIRLSVGLEHADDLAADILGAIG
>NZ_CP051542.1|WP_168781984.1|87287_88253_+|GTP-cyclohydrolase-I-FolE2
MTQTTPTPSPAYPALRRDYPADFRVDEAYRASLPDLQNGPASLIVGARKAIQHVGISNFRLPIRYRQKDGGEITLETSVTGTVSLEADRKGINMSRIMRSFYAHADKQFSLGVMAAALSDYKDHLDAFDARIQMRLSYPMRVGSLRSGLEGWQYYDLALEMVDQGGERLRILHADYVYSSTCPCSLELSEHARAGRGQLATPHSQRSVARISAVMLGEEKLWFEDMIALCRRAVATETQVMVKREDEQAFAELNAANPIFVEDAVRAFARELEAEPRVGDFRIIASHQESLHSHDAVSLLTEGETFAQTSLDPATFAGLRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051542_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051542_1

73876-74100

Orphan

Consensus_repeat	Method
TGTCGTTGCCCGCGCCGCCGTTCAGG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP051542_1

>merge|NZ_CP051542|1|73876-74100|CRISPRCasFinder
TGTCGAGGCCCGCGAAGCTGCGCAGGTCGATCACGTCGTCGTCGCTGTCGAAGTTGCGCACCGTGTCGAGACCGGCGGTGAAGACGAAGCGGTCGTCGCCCTCGCCGCCGCGCAGCATGTCGTTGCCCGCGCCGCCGTTCAGGTAGTCGCTGCCCTCGCCCGCGGCAAGGTCGTCGTTGCCGAGCCCGCCGATCAGCGTGTCGTTGCCCGCGCCGCCGATCAGGA

>NZ_CP051542|1|1|73876-74100|CRISPRCasFinder
TGTCGAGGCCCGCGAAGCTGCGCAGG	TCGATCACGTCGTCGTCGCTGTCGAAGTTGCGCACCGTGTCGAGACCGGCGGTGAAGACGAAGC
GGTCGTCGCCCTCGCCGCCGCGCAGC	ATGTCGTTGCCCGCGCCGCCGTTCAGGT
AGTCGCTGCCCTCGCCCGCGGCAAGG	TCGTCGTTGCCGAGCCCGCCGATCAGCG
TGTCGTTGCCCGCGCCGCCGATCAGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051542.1\|WP_168781972.1\|67978_68332_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238152
NZ_CP051542.1\|WP_043131119.1\|69768_70494_+\|heme-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|273492
NZ_CP051542.1\|WP_168781982.1\|84802_85810_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|274743
NZ_CP051542.1\|WP_168783753.1\|72409_73537_+\|YeeE/YedE-family-protein	unknown	unknown	gnl\|CDD\|377230
NZ_CP051542.1\|WP_036700691.1\|79564_79996_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|312075
NZ_CP051542.1\|WP_036700690.1\|80131_80299_+\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|179075
NZ_CP051542.1\|WP_036700695.1\|70656_71202_+\|DsbE-family-thiol:disulfide-interchange-protein	unknown	unknown	gnl\|CDD\|129481
NZ_CP051542.1\|WP_168781975.1\|73533_73698_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_168781984.1\|87287_88253_+\|GTP-cyclohydrolase-I-FolE2	unknown	unknown	gnl\|CDD\|237466
NZ_CP051542.1\|WP_168781983.1\|85988_87182_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|168979
NZ_CP051542.1\|WP_168781978.1\|77769_78894_+\|DUF1223-domain-containing-protein	unknown	unknown	gnl\|CDD\|369071
NZ_CP051542.1\|WP_168781980.1\|81408_82059_-\|septation-protein-IspZ	unknown	unknown	gnl\|CDD\|367894
NZ_CP051542.1\|WP_168781973.1\|69067_69724_+\|heme-exporter-protein-CcmB	unknown	unknown	gnl\|CDD\|200083
NZ_CP051542.1\|WP_168781979.1\|80545_81460_+\|DUF726-domain-containing-protein	unknown	unknown	gnl\|CDD\|333880
NZ_CP051542.1\|WP_168783752.1\|68340_68970_+\|heme-ABC-exporter-ATP-binding-protein-CcmA	unknown	unknown	gnl\|CDD\|237421
NZ_CP051542.1\|WP_168781974.1\|71400_72384_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
NZ_CP051542.1\|WP_036700704.1\|66983_67979_+\|protein-translocase-subunit-SecF	unknown	unknown	gnl\|CDD\|237275
NZ_CP051542.1\|WP_168781981.1\|82319_84758_-\|UvrD-helicase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273429
NZ_CP051542.1\|WP_168781977.1\|74683_77470_-\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP051542.1\|WP_074826769.1\|70493_70664_+\|heme-exporter-protein-CcmD	unknown	unknown	gnl\|CDD\|377440

Protein	Function_ID	Function_description	E-value
NZ_CP051542.1\|WP_168781972.1\|67978_68332_+\|hypothetical-protein	gnl\|CDD\|238152	cd00248, Mth938-like, Mth938-like domain. The members of this family include: Mth938, 2P1, Xcr35, Rpa2829, and several uncharacterized sequences. Mth938 is a hypothetical protein encoded by the Methanobacterium thermoautotrophicum (Mth) genome. This protein crystallizes as a dimer, although it is monomeric in solution, with one disulfide bond in each monomer. 2P1 is a partially characterized nuclear protein which is homologous to E3-3 from rat and known to be alternately spliced. Xcr35 and Rpa2829 are hypothetical proteins of unknown function from the Xanthomonas campestris and Rhodopseudomonas palustris genomes, respectively, for which the crystal structures have been determined.	8.80236e-39
NZ_CP051542.1\|WP_043131119.1\|69768_70494_+\|heme-ABC-transporter-permease	gnl\|CDD\|273492	TIGR01191, Heme_exporter_protein_C, heme exporter protein CcmC. This model describes the cyt c biogenesis protein encoded by ccmC in bacteria. It must be noted an arabidopsis, a tritcum and a piscum plant proteins were recognizable in the clade. Quite likely they are of organellar origin. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes, ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in the heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	1.25879e-88
NZ_CP051542.1\|WP_168781982.1\|84802_85810_-\|TerC-family-protein	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	5.10298e-141
NZ_CP051542.1\|WP_168783753.1\|72409_73537_+\|YeeE/YedE-family-protein	gnl\|CDD\|377230	pfam04143, Sulf_transp, Sulphur transport. This is an integral membrane protein. It is predicted to have a function in the transport of sulphur-containing molecules. It contains several conserved glycines and an invariant cysteine that is probably an important functional residue.	1.08524e-26
NZ_CP051542.1\|WP_036700691.1\|79564_79996_+\|PAS-domain-containing-protein	gnl\|CDD\|312075	pfam08448, PAS_4, PAS fold. The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.	1.39813e-07
NZ_CP051542.1\|WP_036700690.1\|80131_80299_+\|50S-ribosomal-protein-L33	gnl\|CDD\|179075	PRK00595, rpmG, 50S ribosomal protein L33; Validated.	4.66195e-19
NZ_CP051542.1\|WP_036700695.1\|70656_71202_+\|DsbE-family-thiol:disulfide-interchange-protein	gnl\|CDD\|129481	TIGR00385, Thiol:disulfide_interchange_protein_DsbE_homolog, periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily. Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins. [Protein fate, Protein folding and stabilization].	1.66973e-75
NZ_CP051542.1\|WP_168781984.1\|87287_88253_+\|GTP-cyclohydrolase-I-FolE2	gnl\|CDD\|237466	PRK13674, PRK13674, GTP cyclohydrolase I FolE2.	5.56472e-124
NZ_CP051542.1\|WP_168781983.1\|85988_87182_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|168979	PRK07504, PRK07504, O-succinylhomoserine sulfhydrylase; Reviewed.	1.54932e-179
NZ_CP051542.1\|WP_168781978.1\|77769_78894_+\|DUF1223-domain-containing-protein	gnl\|CDD\|369071	pfam06764, DUF1223, Protein of unknown function (DUF1223). This family consists of several hypothetical proteins of around 250 residues in length which are found in both plants and bacteria. The function of this family is unknown. Structurally it lies in the Thioredoxin-like superfamily.	2.10698e-66
NZ_CP051542.1\|WP_168781980.1\|81408_82059_-\|septation-protein-IspZ	gnl\|CDD\|367894	pfam04279, IspA, Intracellular septation protein A.	4.34047e-62
NZ_CP051542.1\|WP_168781973.1\|69067_69724_+\|heme-exporter-protein-CcmB	gnl\|CDD\|200083	TIGR01190, Heme_exporter_protein_B, heme exporter protein CcmB. This model describes the cyt c biogenesis protein encoded by ccmB in bacteria. Bacterial c-type cytochromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome C. [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Other].	4.78115e-73
NZ_CP051542.1\|WP_168781979.1\|80545_81460_+\|DUF726-domain-containing-protein	gnl\|CDD\|333880	pfam00151, Lipase, Lipase.	3.06493e-06
NZ_CP051542.1\|WP_168783752.1\|68340_68970_+\|heme-ABC-exporter-ATP-binding-protein-CcmA	gnl\|CDD\|237421	PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional.	5.622e-88
NZ_CP051542.1\|WP_168781974.1\|71400_72384_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	3.25499e-54
NZ_CP051542.1\|WP_036700704.1\|66983_67979_+\|protein-translocase-subunit-SecF	gnl\|CDD\|237275	PRK13022, secF, protein translocase subunit SecF.	1.97747e-122
NZ_CP051542.1\|WP_168781981.1\|82319_84758_-\|UvrD-helicase-domain-containing-protein	gnl\|CDD\|273429	TIGR01073, ATP-dependent_DNA_helicase_PcrA, ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP051542.1\|WP_168781977.1\|74683_77470_-\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP051542.1\|WP_074826769.1\|70493_70664_+\|heme-exporter-protein-CcmD	gnl\|CDD\|377440	pfam04995, CcmD, Heme exporter protein D (CcmD). The CcmD protein is part of a C-type cytochrome biogenesis operon. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation. These proteins contain a predicted transmembrane helix.	1.28512e-05

>NZ_CP051542.1|WP_168781975.1|73533_73698_+|hypothetical-protein
MTRRVMAALCLAGLAALIGADLAAAPPNPYRAPAMLALGSGAVASGGFCGALPR
>NZ_CP051542.1|WP_168783753.1|72409_73537_+|YeeE/YedE-family-protein
MGAREAPATPLVPGLASRSAAVALALAALAAVALFVGARFALLLAIGLGFGITLEGLRFGFAGPWRALILRREAGGVLAQILAIALTALVAMPLIAANPGELSGAAAPIGWAMLGGAFVFGAAMQVVLGCGSGTLVNAGSGNPVAVVALPFFALGSFLGSFSLVWWTNLGSLPVVVLGGASGLGITLALLAVLAAVVLAVAAPGHRRIPGRWIAAAGLLAALALANLVVSGQPWGVVYGLGLWGAKAAASLGVDLSASAFWSAPGNAARVTQSVLTDITSLTAFGTILGAMLVAFWRGGLAQRLPDLPARAWVATVVSGLLLGYSSRLAFGCNVGALFSGISTGSLHGWAWLVMGFAGSAVGVRLRPWLGMEGRQ
>NZ_CP051542.1|WP_168781974.1|71400_72384_+|sulfurtransferase
MRFIAPFLTAAAVALAVPALAQTAPAPTAPVSATPAAEAPRAQHLGPLVTPAELAATDRAPLILDIRGADYAKGHIPGAVDAPYKLFRGPTDNPGRPVAPEQLQATLSQLGVELDRPVVVVHQGSDQDDFGAAARVYWTLKSAGVQDIAILNGGMNGWAAAGQPTETTPVTPAPSLIEITWDDRWTATEAEVAAIAAGKGDAVLLDARPPGFYEGRQAHAAASVPGTVPGAENVPHTEWFAGSTPAIAPAATAADVARALGLSPDREIVTFCNTGHWAATEWFALSELAGLPDVKMYPESMVGYTRGDHEIANRPGLVENLLRQIRG
>NZ_CP051542.1|WP_036700695.1|70656_71202_+|DsbE-family-thiol:disulfide-interchange-protein
MARISPLVALPPVLFAGLAAMFYWGMGRDDPTAIPSTLIGQEAPAVPATTLPGATPLTDADLRSGKVTLVNFWASWCPPCRAEHPTLTALAAEGIPVMGIDLKDPEPAAQRFLAEHGNPFARLATDPQGRAAIDWGVTAPPETFILDAEGRVLYRHAGPLIREDYTNRFRPELDKALAAQK
>NZ_CP051542.1|WP_074826769.1|70493_70664_+|heme-exporter-protein-CcmD
MVELGKYAVPVLSAWAISLALIVALVVQTLAASARARRDLERVEPPRNRQQESRRG
>NZ_CP051542.1|WP_043131119.1|69768_70494_+|heme-ABC-transporter-permease
MSLWEYANPVKFMRLSGAVLPWVTAAAAVTLVGGLIWGFSVPEDYKQGATVKIMFLHVPAAMMAINIWVMMLVTSLIWLIRRHHVSALAARAAAPVGAVMTVIALVTGAVWGQPMWGTWWEWDPRLTSFLILFLFYLGYMALWAAIENPDSAADLTGVLCLVGSVFALLSRYAVNFWNQGLHQGATISVAPGDRISSVYSYPLYTCMAGFFLLFLALLLVRTRTEIRRRRTAALLAREVRG
>NZ_CP051542.1|WP_168781973.1|69067_69724_+|heme-exporter-protein-CcmB
MKALLLRDLALATRAGGGFGLGLAFFLILCTLVPFGVGPEGGTLARIAPGILWVGALLACLLSLDRLFALDWEDGSLDLLATSPLPLEGAVGIKALAHWITTGLPLVVAAPLFGILLHLPGAALPWLVAALLLGTPALSMLGAFGAALTVGLRRGGLLMSLLVLPLYVPTLIFGAEAVRRGAAGADGMTPLVLLAGISLAVLAAIPFAAAAALRVNLR
>NZ_CP051542.1|WP_168783752.1|68340_68970_+|heme-ABC-exporter-ATP-binding-protein-CcmA
MVTAHDLAVSRGGRRAVERVAFTLAPGEALILRGPNGIGKTTLLRTVAGLQPPAAGRIEADPDAIAYAAHADGLKGALTVAENLDFWRAVFGGPPIGPALEAMNLAALAERPAAMLSAGQKRRTGLARLMVTGRAVWVLDEPTVSLDADSVALFARVVRGHLAAGGAALVATHIDLGLPEARILDLARFRADPDRPTDRAPASFDEAFA
>NZ_CP051542.1|WP_168781972.1|67978_68332_+|hypothetical-protein
MAMKETDFAGAVPVDGYGPGFFRVGGRLHHGPVIVTAAGPRPWGGLDDLAALEALGGTVDVLFLGMGADPARPPAALSQALAAAGLAVEPTATPTAARSYNVTLSEGRRVACALLPV
>NZ_CP051542.1|WP_036700704.1|66983_67979_+|protein-translocase-subunit-SecF
MAFRLKLVPDVTHYDFFRWQKLTFGISAVAMIASVIIIFLNGFNFGIDFKGGTTIRAESPTAFEVSDYRQALGGLNLGDVSITEVFDPSFGADRHVAMIRIGTSGETGSVTPEELNQVEAALKTVDPQVRFAAVESVGPKVSGELIKTALYAVGAATLGILFYVWLRFEWQFAVGGVFALVHDILLTAGIFSLFQIKFDLSTIAALLTILGYSINDTVVVFDRLRENLIKFKTMPLIEVMNLTVNETLSRTIMTAVATALALAALLALGGDVIRGFVFAMLWGVFVGCYSTIYVAKNIVLWLGVKRDWSKPEKTPAGEVSDLAGTPFQDRP
>NZ_CP051542.1|WP_168781977.1|74683_77470_-|aconitate-hydratase-AcnA
MPIVTGTDTAKTRRELSAGGATYAYYSIPAATEAGLGDFSRLPAALKVVLENMLRFEDDGFTVSVDDIKAFAQWAQDGGKSDREIAYRPARVLMQDFTGVPAVVDLAAMRDGIKALGGDAQKINPLNPVDLVIDHSVMVDEFGTPRAFQRNVDLEYDRNMERYQFLKWGQGAFNNFRVVPPGTGICHQVNLEYLAQTVWTDTDQDGKTVAYPDTLVGTDSHTTMVNGLAVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKITGALKEGVTATDLVLKVVKMLRDHKVVGKFVEFYGAGLDNMPLADRATIANMAPEYGATCGFFPVDDETLRYLRQTGRDEDRIALVEAYAKANGLWRDAAYEPVYTSTLSLDLGDVVPAISGPKRPQDHVALDAAAQTFKAYIEGLKPAPSVPKEQKFEMTEEGGAPSPSSDQIPGGNRGGAELFGAPVEGRDFTLNDGSVVIAAITSCTNTSNPYVLMAAGLVARKARALGLTRKPWVKTSLAPGSQVVAEYLDAAGLQDDLDALGFNLVGFGCTTCIGNSGPLEPEISKAIAENDLVAVSVLSGNRNFEGRISPDVRANYLASPPLVVAYAIAGDMNIDITREPIGQDKDGRDVFLKDIWPTSAEVSDLVHKVVTREMFQSKYADVFKGDERWQAVETTDSETYDWPATSTYIQNPPYFQGMNREPGVITDIEGARVLAVLGDMITTDHISPAGSFKPTTPAGKYLTERQVAPADFNSYGSRRGNHEIMMRGTFANIRIKNEMLEGVEGGYTKGPDGDETSIYDAAMAYQQAGTPLVVVGGVEYGAGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVIPFEFTGGDTRKTLGLTGAEVISIHGLADDFKPLKIVPATIRYADGTEKTVDLKARVDTEVEIEYLKNGGVLHYVLRNLAKS
>NZ_CP051542.1|WP_168781978.1|77769_78894_+|DUF1223-domain-containing-protein
MSCAAPTPLRHPVPTSRLACAPSSGPSAGPGRTPLKALALALSVLLVSLTAAPHPLSADPFDGAPGQEQVGDAPDTGDFDPGFDPGDMGDAVDPGDIAVIEAPDDNGYTVPGEGFVEDMPMGGEGFALVPERADPMRGQAAPAPRAAMARSIAAPVVVELFTAQGCSTCPVADALLAGLADLPGVLPLSWHVDYWDYLGWTDNFADPRHTTRQEGYAAAAGERGVYTPQIIVDGQDTLIGVGRMGLLALIDEHASRPPAVMVTAAEDGGNPVIDLTPRAAIPGGVDVLLVRYLPERKVRIDGGENRGHSILYRNIVVGVEKLSAWPARTPLRLTVRPGTMASRGYPADTRHAILVQQPLRGGRPGPILAALRLD
>NZ_CP051542.1|WP_036700691.1|79564_79996_+|PAS-domain-containing-protein
MLPHPESVLRDAIPVDLAAGLALSSTPGADRGTRLALALMRHMVQPVILMDPDGRVTQLNPAAQSLLMPGEPGRFGPGGRFWWQLWPHADGLALRGALAEAAGGETVRVTLDCRRAVASTAVLVPIEDAGGGVAKVMCLLRAR
>NZ_CP051542.1|WP_036700690.1|80131_80299_+|50S-ribosomal-protein-L33
MAKPTTIKIRLNSTAGTGHFYVTKKNARTMTEKMTVNKYDPVLRKHVEYKEGKIK
>NZ_CP051542.1|WP_168781979.1|80545_81460_+|DUF726-domain-containing-protein
MALVRIDSGAPVPAELWRRAETLPPDRPVVVMIHGYRFTPSVPDRSPHHHILSLTPDPGARRALSWPAALGFSAEGSEGLGVALGWDSCGGLRAVHGRAAEVGAELAALIDRLALAARRPVALIGHSLGARVALAALGRAAPGAVGRVVLLAAAELRPRAEAAIASPAGMLAEVVNVTSRENDPFDLALELILSAGRHRALGFGLGQPRRNWVDLQIDDAATLASLGRLGFAIDPRASRACHWSPYLRAGLFDLWRCVLCTPAALPLPLLAAAGPARPARRWSRLMAPQRGVPSSPAFSSGISA
>NZ_CP051542.1|WP_168781980.1|81408_82059_-|septation-protein-IspZ
MTDRTPASAPRAPLPHSLKLALDYGPLVAFLVVFLLYRDRTVHWGGQSYPGLIVATLVFVPLTIAANAVLWARTRKLSVMQLVTLVIVVIFGGLTIWLNDERFIKMKPTFIYLLLAGMLGLGLVLRRNWLALAMGEMVPLAPEGWRRLTLRMTGLFLTLAVLNEIIWRTQSDTTWVLFKTVGLIALTFVFLMANVPLIQRYALIPEENAGEDGTPR
>NZ_CP051542.1|WP_168781981.1|82319_84758_-|UvrD-helicase-domain-containing-protein
MSQFDDADAFEAAASRAPAPRPSLSARAMGIGAQAAPAYLDGLNPAQRAAVEALDGPVLLLAGAGTGKTRALTTRIAHLLTQGRATPGRILAVTFTNKAAREMKARIAKLLGETIEGMPWLGTFHSVSVKILRRHAELVGVGDLHLKSSFTILDTDDQLRLLKQLIAAENIDEKRWPARMLAGLIDDWKNRALTPGRVPASESHAYDGKGVALYTQYQRRLIELNATDFGDLLLHCVTIFQAHPDVLAQWQDRFRYILVDEYQDTNVAQYLWLRLLAAGHRNICCVGDDDQSIYGWRGAEVGNILRFETDFPGAQVIRLEQNYRSTPQILAAASGLIAANKGRLGKTLWTEAEPGEKVRLIGHWDSEAEARWIGEEIEAFHGGHRHSVGRRSLNDIAILVRAAHQMRAFEDRFMTIGLPYRVIGGPRFYERLEIRDAMAYFRLAVSPTDDLAFERIANTPKRGLGDKGLQTIQRVARAEGLSLLQGAAAAVASGDLGGKAAAQMRLFTEAMGRFHADALDSRVSHVELAERILDETGYTAMWQADKSPDAPGRLDNLKELVKALEEFENLQGFLEHVALVMDAAEGEQAEEVSIMTLHAAKGLEYPIVFLPGWEDGLFPSQRSMDESGLKGLEEERRLAYVGLTRAEDLATISFAGNRRMYGQWQSSLPSRFIDELPEDQIEVLTPPGLYGGGYGAAAQGFGQPFTPSAMHDRASRADVYNSPGWKRMQERAAARSAPTHRTPIVIDATPGERFAVGERVFHPKFGTGTVQGIAEDTLTVEFPAGFKTIKAAYVQPAAEAARDITPSDDVPF
>NZ_CP051542.1|WP_168781982.1|84802_85810_-|TerC-family-protein
MDFLTSTMFLGQPVWMWAVFLTAVVVLLVLDLGVLNRGNREIGVRRSLMLSVMYIALGLGFGGFVWWQMGQQPALEYLTGFVVEKSLAMDNVFVIAMIFGALAIPRQYQHRVLFWGILGVIVLRGIMIGVGATLVARYEWILLIFAVFLIATGIKMLLSSGDEDHDVGQSRILRWLKRNLRVTSRLHGERFFVRRADPRPGRRGKTLLFATPLFLALAMVEIADVIFAVDSVPAIFAITTDPYIVYTSNIFAILGLRALYFALAAIIHRFAYLKQALAVLLVFIGGKVIVAEMLGIEKVPPSVSLSVTFVILAAGVAYSLWRTRGAAHAELTNKA
>NZ_CP051542.1|WP_168781983.1|85988_87182_+|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MAENSDSPPRPASARHPRTRAVHAGIRRSQYGEMAEALFLTQGFAYASAEEAEARFIKSGPDEFIYARYGNPTSRMFEDRMASLEGTEDAFATASGMAAVNGALMAIARPGERIVAARQLFGSCLYVLDILKRFGVDVVLLDGTDLDQWRAAVTPGTRAVFFETVSNPTLEVMDIAGIADIAHAAGALVVVDNVFATPVFSRAVDQGADVVIYSTTKHVDGGGRALGGVICGTRQFVREVAEPYLKHTGGAISPFNAWIMLNGLSTLELRVRAMADGALALALALEGAGVRVIYPGLAAHPQHALAMRQMGSGGTMIALDLGTKEAAFAALNRMDLVSISNNLGDAKSIATHPATTTHQRLSEDDRAAMGIGPGLIRLSVGLEHADDLAADILGAIG
>NZ_CP051542.1|WP_168781984.1|87287_88253_+|GTP-cyclohydrolase-I-FolE2
MTQTTPTPSPAYPALRRDYPADFRVDEAYRASLPDLQNGPASLIVGARKAIQHVGISNFRLPIRYRQKDGGEITLETSVTGTVSLEADRKGINMSRIMRSFYAHADKQFSLGVMAAALSDYKDHLDAFDARIQMRLSYPMRVGSLRSGLEGWQYYDLALEMVDQGGERLRILHADYVYSSTCPCSLELSEHARAGRGQLATPHSQRSVARISAVMLGEEKLWFEDMIALCRRAVATETQVMVKREDEQAFAELNAANPIFVEDAVRAFARELEAEPRVGDFRIIASHQESLHSHDAVSLLTEGETFAQTSLDPATFAGLRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051542_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051542_3

129438-129724

Orphan

Consensus_repeat	Method
TCGTCGCGGCGGTCGCCGTTGCG	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_CP051542_3

>merge|NZ_CP051542|3|129438-129724|CRISPRCasFinder
GCCGGGCCGCGGTCGCGGTCGCGGTAACGCTCGCGCCGGTCGTCGCGGCGATCATCCTTGCGCTCGTCCCGACGCTCGTCGCGGCGGTCGCCGTTGCGATCCGCGTTGCGATCCTCGCGGCGGTCGCCGTTGCGGTCCGCCGCGCGGTCGTTGCGGCGGTCGCCGTTGCGTTCGCCGCGCTCGCCCGAGCGGCGCTCGCCCCGATCCTCGCCGCGGCGGTCATCGGTGCGGCGGTCGTCGCCACGGCGGTCGTCGCTGGCGCGCTCGTCGCGGCGCTCATCGCGGCG

>NZ_CP051542|3|3|129438-129724|CRISPRCasFinder
GCCGGGCCGCGGTCGCGGTCGCG	GTAACGCTCGCGCCGG
TCGTCGCGGCGATCATCCTTGCG	CTCGTCCCGACGCTCGTCGCGGCGG
TCGCCGTTGCGATCCGCGTTGCG	ATCCTCGCGGCGGTCGCCGTTGCGGTCCGCCGCGCGG
TCGTTGCGGCGGTCGCCGTTGCG	TTCGCCGCGCTCGCCCGAGCGGCGCTCGCCCCGATCC
TCGCCGCGGCGGTCATCGGTGCG	GCGGTCGTCGCCACGGCGGTCGTCGCTGGCGCGC
TCGTCGCGGCGCTCATCGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051542.1\|WP_168782007.1\|124267_125650_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
NZ_CP051542.1\|WP_168782017.1\|143094_143796_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP051542.1\|WP_168782018.1\|143812_144553_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	unknown	unknown	gnl\|CDD\|274568
NZ_CP051542.1\|WP_168782004.1\|121043_121700_-\|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuD	unknown	unknown	gnl\|CDD\|132048
NZ_CP051542.1\|WP_168782014.1\|137339_138032_-\|HAD-hydrolase-like-protein	unknown	unknown	gnl\|CDD\|319815
NZ_CP051542.1\|WP_168782003.1\|120255_121047_-\|ectoine-utilization-protein-EutA	unknown	unknown	gnl\|CDD\|132035
NZ_CP051542.1\|WP_036703565.1\|123391_124177_-\|ectoine/hydroxyectoine-ABC-transporter-ATP-binding-protein-EhuA	unknown	unknown	gnl\|CDD\|132050
NZ_CP051542.1\|WP_168782009.1\|127044_128658_-\|apolipoprotein-N-acyltransferase	unknown	unknown	gnl\|CDD\|234721
NZ_CP051542.1\|WP_168783755.1\|136295_137336_+\|beta-N-acetylhexosaminidase	unknown	unknown	gnl\|CDD\|224389
NZ_CP051542.1\|WP_168782008.1\|125791_126958_-\|methionine-adenosyltransferase	unknown	unknown	gnl\|CDD\|235374
NZ_CP051542.1\|WP_168782006.1\|122523_123363_-\|ectoine/hydroxyectoine-ABC-transporter-substrate-binding-protein-EhuB	unknown	unknown	gnl\|CDD\|132040
NZ_CP051542.1\|WP_168782012.1\|133236_134982_+\|arginine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234964
NZ_CP051542.1\|WP_168783756.1\|138131_139544_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	unknown	unknown	gnl\|CDD\|184642
NZ_CP051542.1\|WP_168782016.1\|141544_142243_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239483
NZ_CP051542.1\|WP_168782011.1\|131243_133124_+\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP051542.1\|WP_168782002.1\|119049_120231_-\|ectoine-hydrolase-DoeA	unknown	unknown	gnl\|CDD\|274380
NZ_CP051542.1\|WP_052176558.1\|117956_119045_-\|N-alpha-acetyl-diaminobutyric-acid-deacetylase-DoeB	unknown	unknown	gnl\|CDD\|132039
NZ_CP051542.1\|WP_168782013.1\|135087_136293_+\|SPOR-domain-containing-protein	unknown	unknown	gnl\|CDD\|236766
NZ_CP051542.1\|WP_168782005.1\|121699_122356_-\|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuC	unknown	unknown	gnl\|CDD\|132049
NZ_CP051542.1\|WP_168782015.1\|139547_141365_+\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729

Protein	Function_ID	Function_description	E-value
NZ_CP051542.1\|WP_168782007.1\|124267_125650_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.30846e-92
NZ_CP051542.1\|WP_168782017.1\|143094_143796_-\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	6.19524e-123
NZ_CP051542.1\|WP_168782018.1\|143812_144553_-\|urea-ABC-transporter-ATP-binding-protein-UrtD	gnl\|CDD\|274568	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	1.99674e-144
NZ_CP051542.1\|WP_168782004.1\|121043_121700_-\|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuD	gnl\|CDD\|132048	TIGR03003, ectoine_ehuD, ectoine/hydroxyectoine ABC transporter, permease protein EhuD. Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons.	3.48865e-107
NZ_CP051542.1\|WP_168782014.1\|137339_138032_-\|HAD-hydrolase-like-protein	gnl\|CDD\|319815	cd07512, HAD_PGPase, haloacid dehalogenase-like superfamily phosphoglycolate phosphatase, similar to Rhodobacter sphaeroides CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.14179e-68
NZ_CP051542.1\|WP_168782003.1\|120255_121047_-\|ectoine-utilization-protein-EutA	gnl\|CDD\|132035	TIGR02990, ectoine_eutA, ectoine utilization protein EutA. Members of this protein family are EutA, a predicted arylmalonate decarboxylase found in a conserved ectoine utilization operon of species that include Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti and Silicibacter pomeroyi. It is missing from two other species with the other ectoine transport and utilization genes: Pseudomonas putida and Agrobacterium tumefaciens.	4.01638e-82
NZ_CP051542.1\|WP_036703565.1\|123391_124177_-\|ectoine/hydroxyectoine-ABC-transporter-ATP-binding-protein-EhuA	gnl\|CDD\|132050	TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.	9.9433e-142
NZ_CP051542.1\|WP_168782009.1\|127044_128658_-\|apolipoprotein-N-acyltransferase	gnl\|CDD\|234721	PRK00302, lnt, apolipoprotein N-acyltransferase; Reviewed.	1.08518e-111
NZ_CP051542.1\|WP_168783755.1\|136295_137336_+\|beta-N-acetylhexosaminidase	gnl\|CDD\|224389	COG1472, BglX, Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism].	4.63356e-74
NZ_CP051542.1\|WP_168782008.1\|125791_126958_-\|methionine-adenosyltransferase	gnl\|CDD\|235374	PRK05250, PRK05250, S-adenosylmethionine synthetase; Validated.	0
NZ_CP051542.1\|WP_168782006.1\|122523_123363_-\|ectoine/hydroxyectoine-ABC-transporter-substrate-binding-protein-EhuB	gnl\|CDD\|132040	TIGR02995, ectoine_ehuB, ectoine/hydroxyectoine ABC transporter solute-binding protein. Members of this family are the extracellular solute-binding proteins of ABC transporters that closely resemble amino acid transporters. The member from Sinorhizobium meliloti is involved in ectoine uptake, both for osmoprotection and for catabolism. All other members of the seed alignment are found associated with ectoine catabolic genes. [Transport and binding proteins, Amino acids, peptides and amines].	1.71363e-105
NZ_CP051542.1\|WP_168782012.1\|133236_134982_+\|arginine--tRNA-ligase	gnl\|CDD\|234964	PRK01611, argS, arginyl-tRNA synthetase; Reviewed.	0
NZ_CP051542.1\|WP_168783756.1\|138131_139544_+\|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU	gnl\|CDD\|184642	PRK14353, glmU, bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU.	0
NZ_CP051542.1\|WP_168782016.1\|141544_142243_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239483	cd03389, PAP2_lipid_A_1_phosphatase, PAP2_like proteins, Lipid A 1-phosphatase subfamily. Lipid A 1-phosphatase, or LpxE from Francisella novicida selectively dephosphorylates lipid A at the 1-position. Lipid A is the membrane-anchor component of lipopolysaccharides (LPS), the major constituents of the outer membrane in many gram-negative bacteria.	1.76434e-18
NZ_CP051542.1\|WP_168782011.1\|131243_133124_+\|sodium:proton-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	4.26537e-52
NZ_CP051542.1\|WP_168782002.1\|119049_120231_-\|ectoine-hydrolase-DoeA	gnl\|CDD\|274380	TIGR02993, ectoine_eutD, ectoine utilization protein EutD. Members of this family are putative peptidases or hydrolases similar to Xaa-Pro aminopeptidase (pfam00557). They belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. The exact function is unknown.	0
NZ_CP051542.1\|WP_052176558.1\|117956_119045_-\|N-alpha-acetyl-diaminobutyric-acid-deacetylase-DoeB	gnl\|CDD\|132039	TIGR02994, ectoine_eutE, ectoine utilization protein EutE. Members of this family, part of the succinylglutamate desuccinylase / aspartoacylase family (pfam04952), belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it the operon is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida.	0
NZ_CP051542.1\|WP_168782013.1\|135087_136293_+\|SPOR-domain-containing-protein	gnl\|CDD\|236766	PRK10811, rne, ribonuclease E; Reviewed.	7.8867e-08
NZ_CP051542.1\|WP_168782005.1\|121699_122356_-\|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuC	gnl\|CDD\|132049	TIGR03004, ectoine_ehuC, ectoine/hydroxyectoine ABC transporter, permease protein EhuC. Members of this family are presumed to act as permease subunits of ectoine ABC transporters. Operons containing this gene also contain the other genes of the ABC transporter and typically are found next to either ectoine utilization or ectoine biosynthesis operons. Permease subunits EhuC and EhuD are homologous.	2.22736e-92
NZ_CP051542.1\|WP_168782015.1\|139547_141365_+\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0

>NZ_CP051542.1|WP_168782009.1|127044_128658_-|apolipoprotein-N-acyltransferase
MSGRPHDPRPLPPAPRAGGVLPSRPLPAPARLTLDVGLGVAAALGQAPWGLWPVTLIALAALLWRIGGAPSARAAFLRALAGGAGHFALALFWITQPFLVEAEIYGWMAPFALVLMALGGGLFWAIPAAALHPLGHDRRTRALGLALGLVVSDWLRGWIFTGFPWALSGHIWIDTPAGQIAAWGGALGLSALTLAAAALPAWGWTPARPGWRAWVLGTTLAAMLVAAAWVAGLARLAQPLPPDHSAVIRLVQPNADQTLKWTPEWAPVFYARLLELSALPVDPRLGGGRPAAVVWPETSVPFLLNEADPFLPEIAAAAGAPVLAGIQRGEGGRWYNSLAEFTAEGGIGPVYDKFHLVPFGEYIPWGDALARFGVSAFAAQAGNGYARGTGPTVLTLAGLPPVQPMICYETIFERDLARPPRWAGERPAWLLQVTNDAWFGSWSGPYQHLAQARLRAIQTGLPLLRAANTGVSAVIDAQGRVRDRLALNGAGVLDARLPGALPPTLWWRWGDAPLLALLGLALAALIARRPRRARSGR
>NZ_CP051542.1|WP_168782008.1|125791_126958_-|methionine-adenosyltransferase
MSRQNYVFTSESVSEGHPDKLCDQISDAVLDALLTEEEQARVACEAFATSGMVVIGGEIGLRDKARLTSMMGRIPEIARGVIKDIGYEQEKFHWNTCHVLNFLHQQSAHIAQGVDKDGAGDQGIMFGYAVDETPELMPAPIQYAHAILRRLAEARKSGEQPTLGPDAKSQLSVRYENGKPVGVTQIVVSHQHHDEFQTSDDIRAIVEPYVREVLPEGWLTKETVWHVNPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDATKVDRSAAYAARYLAKNVVAAGLAKRCVIQLSYAIGVAEPLSIYADTFGTGEIPNAEIERAVRAVMDLKPSGIRDHLNLNRPIYRRTAAYGHFGRAPEADGGFSWERTDLVEALKGAV
>NZ_CP051542.1|WP_168782007.1|124267_125650_-|PLP-dependent-aminotransferase-family-protein
MQWHPDPQRLARPVYLSLAEQFTQAIQTGRMGAGTRLPPQRTLADRLGVSLQTVSRAYDELGRRGMIAGEVGRGTFVLPQSAEAPAPYLNRRTGGVVDLSILKPVTDALHLQKMREGLAWLAENLPPQAALSFRPTSVMPEHLKTAAAWLARGGIDVAPEQIVITDGATPAITTAVMTAVPPGGTLAAAELTHHLLQPLTRYLGLHLEPLPLDDHGIVPAALEQAARTKGLSALYLQPAAINPRGVLSPAERRAEIVAIARRHNLALIENDILNQLLTDRPTPYAALAPERVLHINGFTKISLPGLRVAYLTLPERLARAAANRHLVTNWMATPIMVELLGRWIADGTMTGLIGWQRQALAERHAIARAVLPEGLCRSHAQALHLWLELPAGIREEEFVAMAHRRGVAVASSQSFRIGGQPGPGALRIALGPPSRDDLSRGLATVAELLAESDEPILPLV
>NZ_CP051542.1|WP_036703565.1|123391_124177_-|ectoine/hydroxyectoine-ABC-transporter-ATP-binding-protein-EhuA
MDQPVIRVENLRKSFGALTVIDGLSFDVARGEKLALIGPSGSGKTTILRILMTLETISGGRIEICGEPLFHMRRGGAEVPADEAHLHRMRRHIGMVFQHFNLFPHKSVLDNITLAPILTKGETRPAAEARARELLEMVGLSDKASAMPAQLSGGQKQRVAIARALALNPQIMLFDEVTSALDPELVEEVLEVMKRLAAETDMTMLLVTHEMGFAREFADRVLFFDGGRICEQGPPEQLFTNPTQERTRTFLRKIIAAGHRV
>NZ_CP051542.1|WP_168782006.1|122523_123363_-|ectoine/hydroxyectoine-ABC-transporter-substrate-binding-protein-EhuB
MKASILAAFAIAVPVLAVPTLAAADKLDDLKSAGKVTIAIGNEPPFTAIAPDGAVSGAAPDVARAVFQKLGVDTLGAQVIEYGAMIPSLQAGRVDAIAAGLFMKPERCAAVAYSEPVLCDAEAMLVAKGNPKGFKSYADIAAADGARIGAPGGGTEEKLALEAGVPRDRVIVVPDPQSGLKMLQDGRLDAYSLPVLSMSDLMKKGGEGSVDLIAPVEGAPVSCDGVAFNRNDTALRDAFDVELAKLKESGEFAKIVEPYGFSAQAALSTTRDKQCAAPQ
>NZ_CP051542.1|WP_168782005.1|121699_122356_-|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuC
MGDWAGYLTLILDGAWVTVRLTVMGAAVALVFAFLAGLGRLSRHAAVRWLATAYIEFFRGTSIFVQLFWIYFVLPLTGVTLTPMQAGVMALGLNVGAYGAEVVRGAILSVPRDQYEATTALNLTRWQRMRHVILPQALPLMLPTFGNNAIELLKATSVVSLISLSDMTFQAQVVRSQTGNTLIPFVTVLVLYFALSMTIAAAVGALERRVTRGLDGVR
>NZ_CP051542.1|WP_168782004.1|121043_121700_-|ectoine/hydroxyectoine-ABC-transporter-permease-subunit-EhuD
MDWDWSFAWSIMPQLLAGVRITILATILGAAVAAVLGLVFAILRRSPNRWIARPTAFVVQFIRGTPLLVQLYFIFYVLPDIGIRLPALAAGVLGMGLHYATYAAEVYRGGIEAVPRGQWEAARATNLTARQTWVHVILPQAVPPMIPAMANYLLAMFKETPLLSAITVLELMNQARSAANFSYRYVEPMTLVGVFFLVISLISVAILRWLERRYARRT
>NZ_CP051542.1|WP_168782003.1|120255_121047_-|ectoine-utilization-protein-EutA
MSGAGVGTGSGGDVALDDRPMRARVGLVVLATDHTTEPDYARIVAPQGIGVYATRIPFANPVTAESLAAMAPDITAAAALILPGEALDAVVYSCTSASVAIGDAAVRAALCAGKPGARAITPLSAAFAAFQALVALRVSLLTPYDDATTAAMAGCLEAGGVSLGAVTGLGLTDDRDMARLSRATLVEAAARATAPGSEALFVACTAVRAAAWVEALEAAAGVPVVTANLATAWAALRLCGHAGPAAPGRLMTLPLNDTYPTTP
>NZ_CP051542.1|WP_168782002.1|119049_120231_-|ectoine-hydrolase-DoeA
MPDIPLNFSRAEYAARLDKTRRAMEAAGVELLVVTDPSNMNWLTGYDGWSFYVPQSVIVPPHGEPLFFGRGMDAVGARFTAWIGEESIIGYPDDYVMNPAKHPMELLAQILTDRGWGRLRVGVEMDNCWYTARSHAALAAGLADARLSDTTGLVNWQRAVKSPAELDYMRKAGEIVTAMHARILEVVAPGVRKNDLVAEIMATGVRGVPGAGGDYPAIVPLLPSGREAAAAHLTWDDRPMRAGEGTFFEIAGCHHRYHCPLSRTVFLGKPPQVFVEGEKAVLEGMEAGLEAARAGNTCEEFAGAFYAVLKKHGITKDGRTGYPIGVSYPPDWGERTMSLRPGDRTVLEPGMTFHFMTGLWSDDMGLEITESLVITEGAPELLANVPRQLFVKD
>NZ_CP051542.1|WP_052176558.1|117956_119045_-|N-alpha-acetyl-diaminobutyric-acid-deacetylase-DoeB
MEATLRPSPVLATVDYDRPGVQHGFLRLPYSRDDSAWGSVVIPITVIRGGEGPTALLTGANHGDEYEGPLALFDLAQTLRPDEVVGRVIIVPAMNYPAFLAGTRTSPIDRGNLNRSFPGRPDGSVTEKIADYFQRVLLPLADVVLDFHSGGKTLDFLPFCAAHILPGEGPEVRAQEERAFALVRAFAAPFSVRMLEIDAIGMYDTAAEEMGKVFVTTELGGGGTATARTVRIAREGLRRVLAAAGVTRGPGAPAPAPLPPTRWLDMPDADCFVFAEDGGLVEFLADLGDSVAAGDPVARLWPLGRTGVAPSELTAARAGVLCARHVPGIVKPGDCVAVLAVEVADASQLEGPGPRELEGVVP
>NZ_CP051542.1|WP_168782011.1|131243_133124_+|sodium:proton-antiporter
MATPTTGLSAMEAFAVIGVAGVGAQWLAWRLRMPAIVLMLTAGLVLGPVTGILVPARDIGPLIAPMVSLAVSVILFEGGLTLNFHRLADARPAVRRLVYVGAPLGWLLSTLALIWIGGLSWKASLVFGGIMIVTGPTVIAPLLRQAKLVTRPAQVLQWEGIVNDPIGALAAALAMQIVLVANAGLFWGQALARVVPGVLAACLIGIAAGWAIVQAFRRHIVPEYMKVPVLFVTVIGAFTAADSILHESGLLAVTLMGLIVANANLPSYTELYRFKEQATVLLVSGVFIILAAGIQFSQLTQLSWRAFLLIAAVILLVRPATVMLSLIGTNLPMKERLLIAFTGPRGVVLVAVSGIFAERLVAEGVPDGGMVAPLAFCLVLATVILHGFTLGPLARRLGLTSGDTPGVMIVGGSPFATGLAQALIKEGVEVLVTDPNRDHLRSARTAGVPTYYGDVLGEAAETNVEFLAYTYVVAASDNDAYNTLVATDLAPDFGREVIWQVARENDDRPRHSLPSQLRGQGFGGGLTLARLNEMLAEGWVFRTTRLTKEYGVEEWRAARPGAVPLVTLDDEADRIVMVSDPERIPDQPGLRIVSLIPPELAARIRAAANDTRLQRAADDNADALDV
>NZ_CP051542.1|WP_168782012.1|133236_134982_+|arginine--tRNA-ligase
MNLFADIRALVLDALTAMTDAGELPAGLSFDAVAVEPPRDPAHGDMATNAAMVLAKPAAKKPREIAEALAARLGTDPRIEAAEVAGPGFLNLRLAPALWREVMAAALAAPADFGRVPQGAGERINIEFVSANPTGPMHVGHMRGAVFGDALASLLGFAGHEVTREYYVNDGGAQVDVLARSAYERYREAHGLEPQIAEGLYPGDYLIPVGEALKARFGDSLLDKPEAEWLAEVREVATEAMMETIRADLALLGVEMDVFSSEKALYGTGRIEAAIARLESAGLIYEGTLEPPKGKLPEDWEAREQTLFRSTAFGDDVDRPVKKSDGAWTYFAPDIAYHWDKIDRGYDQLINVFGADHGGYVKRLTAVVHALSNGRVPLDIKLIQLVRLFKNGEPFKMSKRAGTFVTLRDVVEQAGRDVTRFHMLTRKNDAPLDFDFDKVLEQSKDNPVWYVQYASARINSVLRRAAEMGVDTSDAALAAADLSPLTHPAQLALMRKLAEWPRTVEIAARAHEPHRVAFFLYELASDLHGFWNRGNDEVELRFVTEGDPSATAAKIALARAVGVVISAGLGILGVTPATEMR
>NZ_CP051542.1|WP_168782013.1|135087_136293_+|SPOR-domain-containing-protein
MTVLDFRSGGYADARDGQLSDDAPGHATHWHGARHGEPATEWHPDWHDDDWDATRYAAAGSAARLSDREGVLGRVARLTHYLGALVSVGLMVGLAVWGYQLIVRDVSGVPVIRAVEGEARTAPDEPGGELTDRTGLAVNTVAGGGNAKAAEKVAIAPAPTALDGQDVAMGELGATAQNPTVTSEAVEAPAPAAIALTDSEAARLAAEQQAAVPAVAPLEADSVAASAAVTDVAGLPTQDTAITAALAEAGAAPAVTTPTRPLPRPRRIAAASQVPVANDAAPLAAVAPEAQASTEAAPAATPDAAEPPAAAVAPAVVKSGAPLVQIGAFDSGAIAENEWSRVSGRYGDLFSGKLPLVQEHKAGGRTFYRLRVAGFETRDEARKFCAALIAAGTDCIPAAAK
>NZ_CP051542.1|WP_168783755.1|136295_137336_+|beta-N-acetylhexosaminidase
MTPANAAPPPSGGAFASAGPAHGATILGVEGLTLGADERAFLRDADPWGFILFARNVADPAQLARLTADLREAVGRDAVVMVDQEGGRVQRLTAPHWTDWPAAMDSATDGARAVALRHRLMGQELRAVGIDADAAPCLDVADAETHPFLRNRCFGTDPDTVARMGRAAADGLMAAGVLPIVKHMPGHGRARVDSHHDLPVLDVALDALDARDFAPFRALADLPLGMTAHIRLTALDDRPATASPAAIALIRERIGFGGLLMSDDIGMNALSGTPAERAAAAIAAGCDLVLACNLTRAEFAAVAEAAGPMTEAAAARVTAALARRGAPDEADPAALRAELDALTRRA
>NZ_CP051542.1|WP_168782014.1|137339_138032_-|HAD-hydrolase-like-protein
MTQNGRDRGTVVFDLDGTLADTAGDLIAAANACLAARGLGRPLDPVADAGIAFHGGRAMLRAGYARAPADMLLPPGAEDEDFPLLLDHYGNCLADTTRLYPGTEAALEALAAAGYALAVCTNKPEALAERLLVALGVRERFASLVGADTLPVRKPDPRPYAESVARAGGTVARSFLVGDTETDLRTARAAGVRVALVGFGPEGEGIARLGPDAMLGEFAALPALARDWLG
>NZ_CP051542.1|WP_168783756.1|138131_139544_+|bifunctional-UDP-N-acetylglucosamine-diphosphorylase/glucosamine-1-phosphate-N-acetyltransferase-GlmU
MADERAAGQGHSEQVAAGDSRGAPAPTQPVALVVLAAGQGSRMLSDLPKVLHRLGGVPLVGHALAAGRSLDPARVVVVAGHGAEAVTKAVGKLDPEAQVALQAEQLGTGHAVAQALPLLEGFAGRVVVLYGDTPFISAETLAALAAHPADVVVLGFEAADPGRYGRLIVKGDTLDRIVEFKDADEATRQVALCNSGVMAVEAALLAELVGRLGNDNAAGEYYLTDIVGLARAEGRTAAVVTCDEAETLGINTRAELAAAEAAFQARKRAEAVEAGVALADPATVWFAPDTAIGRDAVIGQNVVFGPGVTVESGAEILPFCHLEGCHVSAGATVGPFARLRPGAELGGDVHVGNFVEIKNSVLDAGVKVGHLTYLGDAHVGERANIGAGTVTCNYDGVGKHRTEIGADAFIGSDTMLVAPVRVGARAMTGSGSVITADIPDDALGLGRARQVTKPGLAARIMQALRAAKGR
>NZ_CP051542.1|WP_168782015.1|139547_141365_+|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIIGILGNHQVGPQLVEALQRLEYRGYDSAGVATVDDAGRLDRRRAVGKLVNLSDRLVLNPLEGRSGIGHTRWATHGAATEGNAHPHRHGPVAVVHNGIIENFRELRAELAAEGIVPESETDTETVALLTGHHMAQGMAPLDAVRATLSRLRGAFALAFLFEGEGDLMIGARKGSPLALGHGEGEMFLGSDAIALAPFTDLVTYLEDGDHVVLTRGGAQVYDAEGRLVNREAARIDVGTTAIDKGGYRHFMAKEIAQQPGVLADALSHYIKDGRIVMPETVDFTGVERVTLVGCGTAYYAAWVAKYWFERIAGLPAEVDVASEFRYREPPLSPRSWAIFVSQSGETADTLAALHYCKDKVARTLGVVNVGTSAIAREADVALPIMAGVEVGVASTKAFTCQLAVLAVLALKAAQDRGVLDPASLSAHLDDLLSIPALVSQAVGTSDDCKRLAGWLSEAQDVLFLGRGALYPIALEGALKLKEISYIHAEGYASGELKHGPIALVDRMVPVVVVAPSDPLFEKTVSNMQEVMARQGPVLLVSDAEGIAAAGEGVHAALTMPAGGGAFAPIVHAVPMQLLAYHTAVAKGTDVDQPRNLAKSVTVE
>NZ_CP051542.1|WP_168782016.1|141544_142243_+|phosphatase-PAP2-family-protein
MNDRTVRDTGAPKADEDVGLIERIEAADVALSEEAGKLRDHPLVEAAGAASEIADQPPALQLAALAVAAGVLAGRPRLAEGGVRAFLALTVAIQTKAAIKKAVVRTRPYKLLDEGHYETGVGGPDEHPYNSFPSGHTADAFAAAQAIGRVAPGLRGPALGLAALIGLVQVPRATHHLADVVAGAAVGVAAEAAVAAAIGVIPQEEMRRVRMGVARRSWLPGAGRGEERTGRG
>NZ_CP051542.1|WP_168782017.1|143094_143796_-|urea-ABC-transporter-ATP-binding-subunit-UrtE
MIEAENVTLHYGGSQILHGVSLSAAPGEVACVMGNNGVGKTSLMNLLAGRHPRSGGELRLMGERLGRVTAQGMARRGVAYVPQGRAIFPMLTVRENLETGLGCLPRGARRVPDAVYDSFPVLAEMAHRRGGDLSGGQQQQLAIARALVIRPKVLLMDEPTEGIQPNIIAQIGRVITALRDAGEMAIVLVEQYFDFAWSLGDRITVMDRGRAVLSGPRGDVEREAVRQRLSAMG
>NZ_CP051542.1|WP_168782018.1|143812_144553_-|urea-ABC-transporter-ATP-binding-protein-UrtD
MSALLEVSGVSKTFDGFRAINGLSFAIGPAELRAIIGPNGAGKTTFMDIVTGKTRPDTGDVLWGERSVSLVGMSEARIARAGIGRKFQRPTVFEDQSVAENLTLALKAARGPLAVLRWRPTSASRARVAALAAEVGLGDQLHRKAGELCHGQKQWLEIGMLLASEPRLLLVDEPAAGMTLAEREATTALLRRLAETRAVVVVEHDMEFVRRLDCKVTVLHQGAVLAEGSLDHVSANAQVIDVYLGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051542_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051542_4

446100-446165

Orphan

Consensus_repeat	Method
GTCGCCGTCGCCGTCGCTGTCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051542_4

>merge|NZ_CP051542|4|446100-446165|CRISPRCasFinder
GCCTCAGCCCCGGTCGCCGTCGCCGTCGCTGTCGCTCCGCCGTGCCTCAGCCCCGGTCGCCGTCGC

>NZ_CP051542|4|4|446100-446165|CRISPRCasFinder
GCCTCAGCCCCGGTCGCCGTCGC	CGTCGCTGTCGCTCCGCCGT
GCCTCAGCCCCGGTCGCCGTCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051542.1\|WP_168782181.1\|439850_443486_-\|vitamin-B12-dependent-ribonucleotide-reductase	unknown	unknown	gnl\|CDD\|236049
NZ_CP051542.1\|WP_168782179.1\|437770_439435_-\|formate--tetrahydrofolate-ligase	unknown	unknown	gnl\|CDD\|376511
NZ_CP051542.1\|WP_168782176.1\|435424_436468_-\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP051542.1\|WP_168782180.1\|439649_439838_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_168782183.1\|451555_451918_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_168783777.1\|434801_435347_-\|phosphoribosylglycinamide-formyltransferase	unknown	unknown	gnl\|CDD\|235544
NZ_CP051542.1\|WP_139305927.1\|443905_444412_-\|5-formyltetrahydrofolate-cyclo-ligase	unknown	unknown	gnl\|CDD\|274270
NZ_CP051542.1\|WP_168782186.1\|458183_458897_+\|dTMP-kinase	unknown	unknown	gnl\|CDD\|184429
NZ_CP051542.1\|WP_168782187.1\|458899_460009_+\|DNA-polymerase-III-subunit-delta'	unknown	unknown	gnl\|CDD\|236022
NZ_CP051542.1\|WP_168783778.1\|454945_456193_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223587
NZ_CP051542.1\|WP_036701360.1\|448720_449752_-\|cysteine-synthase-A	unknown	unknown	gnl\|CDD\|182672
NZ_CP051542.1\|WP_168782184.1\|452135_454409_+\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	unknown	unknown	gnl\|CDD\|274168
NZ_CP051542.1\|WP_156114342.1\|436672_436843_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_052512846.1\|456993_458163_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP051542.1\|WP_168782188.1\|460038_460893_+\|TatD-family-hydrolase	unknown	unknown	gnl\|CDD\|223162
NZ_CP051542.1\|WP_168782182.1\|450007_451519_+\|acyl--CoA-ligase	unknown	unknown	gnl\|CDD\|223395
NZ_CP051542.1\|WP_168782185.1\|456310_456883_+\|thymidine-kinase	unknown	unknown	gnl\|CDD\|235272
NZ_CP051542.1\|WP_168782178.1\|437206_437698_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|376570
NZ_CP051542.1\|WP_036701362.1\|444481_445867_-\|magnesium-transporter	unknown	unknown	gnl\|CDD\|225148
NZ_CP051542.1\|WP_168782177.1\|436850_437210_-\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|376491

Protein	Function_ID	Function_description	E-value
NZ_CP051542.1\|WP_168782181.1\|439850_443486_-\|vitamin-B12-dependent-ribonucleotide-reductase	gnl\|CDD\|236049	PRK07562, PRK07562, vitamin B12-dependent ribonucleotide reductase.	0
NZ_CP051542.1\|WP_168782179.1\|437770_439435_-\|formate--tetrahydrofolate-ligase	gnl\|CDD\|376511	pfam01268, FTHFS, Formate--tetrahydrofolate ligase.	0
NZ_CP051542.1\|WP_168782176.1\|435424_436468_-\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP051542.1\|WP_168783777.1\|434801_435347_-\|phosphoribosylglycinamide-formyltransferase	gnl\|CDD\|235544	PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed.	3.09461e-87
NZ_CP051542.1\|WP_139305927.1\|443905_444412_-\|5-formyltetrahydrofolate-cyclo-ligase	gnl\|CDD\|274270	TIGR02727, Uncharacterized_protein_YqgN, 5,10-methenyltetrahydrofolate synthetase. This enzyme, 5,10-methenyltetrahydrofolate synthetase, is also called 5-formyltetrahydrofolate cycloligase. Function of bacterial proteins in this family was inferred originally from the known activity of eukaryotic homologs. Recently, activity was shown explicitly for the member from Mycoplasma pneumonia. Members of this family from alpha- and gamma-proteobacteria, designated ygfA, are often found in an operon with 6S structural RNA, and show a similar pattern of high expression during stationary phase. The function may be to deplete folate to slow 1-carbon biosynthetic metabolism. [Central intermediary metabolism, One-carbon metabolism].	7.63113e-39
NZ_CP051542.1\|WP_168782186.1\|458183_458897_+\|dTMP-kinase	gnl\|CDD\|184429	PRK13973, PRK13973, thymidylate kinase; Provisional.	6.03541e-73
NZ_CP051542.1\|WP_168782187.1\|458899_460009_+\|DNA-polymerase-III-subunit-delta'	gnl\|CDD\|236022	PRK07471, PRK07471, DNA polymerase III subunit delta'; Validated.	2.87929e-135
NZ_CP051542.1\|WP_168783778.1\|454945_456193_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223587	COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis].	8.19484e-152
NZ_CP051542.1\|WP_036701360.1\|448720_449752_-\|cysteine-synthase-A	gnl\|CDD\|182672	PRK10717, PRK10717, cysteine synthase A; Provisional.	0
NZ_CP051542.1\|WP_168782184.1\|452135_454409_+\|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase	gnl\|CDD\|274168	TIGR02504, ribonucleotide_reductase, ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent. This model represents a group of adenosylcobalamin(B12)-dependent ribonucleotide reductases (Class II RNRs) related to the characterized species from Pyrococcus, Thermoplasma, Corynebacterium, and Deinococcus. RNR's are responsible for the conversion of the ribose sugar of RNA into the deoxyribose sugar of DNA. This is the rate-limiting step of DNA biosynthesis. This model identifies genes in a wide range of deeply branching bacteria. All are structurally related to the class I (non-heme iron dependent) RNRs. In most species this gene is known as NrdJ, while in mycobacteria it is called NrdZ. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP051542.1\|WP_052512846.1\|456993_458163_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	8.66315e-115
NZ_CP051542.1\|WP_168782188.1\|460038_460893_+\|TatD-family-hydrolase	gnl\|CDD\|223162	COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair].	1.71447e-100
NZ_CP051542.1\|WP_168782182.1\|450007_451519_+\|acyl--CoA-ligase	gnl\|CDD\|223395	COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	5.46523e-92
NZ_CP051542.1\|WP_168782185.1\|456310_456883_+\|thymidine-kinase	gnl\|CDD\|235272	PRK04296, PRK04296, thymidine kinase; Provisional.	2.76617e-112
NZ_CP051542.1\|WP_168782178.1\|437206_437698_-\|GAF-domain-containing-protein	gnl\|CDD\|376570	pfam01590, GAF, GAF domain. This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyze ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalyzed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyzes the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.	4.20324e-05
NZ_CP051542.1\|WP_036701362.1\|444481_445867_-\|magnesium-transporter	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	2.82067e-140
NZ_CP051542.1\|WP_168782177.1\|436850_437210_-\|YigZ-family-protein	gnl\|CDD\|376491	pfam01205, UPF0029, Uncharacterized protein family UPF0029.	8.04445e-26

>NZ_CP051542.1|WP_036701362.1|444481_445867_-|magnesium-transporter
MTDPRPRDNDPEDDDFVPARALVAEVVEAIDAGDAAGLNALLEPVHGADIADLIEQLPPHRRREFIRLYSGEIDAEILTEIDESLREEVIEQLPREVVAEAVREMDTDDVVDLLEDLDPPEREQILAALDAEDRVAVEQSLTYPEYSAGRLMQSEVVTAPQHWTVGETIDFLRREDWLPDQFYHVILVDPRRHPVGYVTLGRLLSAQRTTRLADIAEDSFRTIGVLQDEGDVAYAFNQYHLISAPVVDADDRLVGVITIDDAMGVLDEEHEEDMLRLSGVNEESHVSDGAFATARQRLPWLVVNLFTASLSAIVISRFEDTISSLVMLAALMPIVASTGGIAGTQSLAVAVRALATRDLTSSNARRVVRRELFAGMLNGMGLALILGLAGTLIFGDPKLGMVLAMAMIVNQIVAALGGVLVPLTLERLGLDPALASGTFVTTLTDVMGFLAFLGLATVILL
>NZ_CP051542.1|WP_139305927.1|443905_444412_-|5-formyltetrahydrofolate-cyclo-ligase
MTGRLAGGDAAALAANLRRALAPHAGRVLAGYWPMRGEADPRPAMEAHDGPLCLPVVPGRGQPLVFRLWRGEALVPGSFGTSNPPDSAPEVTPEVLIVPLVGFDAALQRLGYGGGFYDRTLARLRAAGPVTAIGLGWAGQQLPAIPATATDERLDAIVTDRGILATPA
>NZ_CP051542.1|WP_168782181.1|439850_443486_-|vitamin-B12-dependent-ribonucleotide-reductase
MKIDRRYTTTETGAYGGIDFVTTTSEIRNPDGTVVFRNDAVEVPEGWSQVASDVIAQKYFRKAGVPARLKRVKEKGVPEFLWRSVADEAALAALPEGERNVGETSARQVFDRLAGAWAYWGWKGGYFTTEADARAYYDEMRHMLARQMGAPNSPQWFNTGLHWAYGIDGPSQGHFYVDYRTGALVKSDSAYEHPQPHACFIQSVSDDLVNEGGIMDLWVREARLFKYGSGTGTNFSSLRGEGEKLSGGGKSSGLMGFLKIGDRAAGAIKSGGTTRRAAKMVICDMDHPDIEQFINWKVIEEQKVASLVAGSKQHEAKLNEIFAAIRQWDGSADGATDPVQNAALKGAIRAAKRAMIPETYINRVLQYARQGFDSIEFPTYDTDWDSEAYASVSGQNSNNSVRVTDAFLKAVREDADWALIRRTDGKTAKTVKARELWDQIGHAAWACADPGIQFHDTVNAWHTCPEDGPIRGSNPCSEYMFLDDTACNLASMNLLTFLNGGQFDAQGYVHATRLWTVTLEISVLMAQFPSREIAQRSYDFRTLGLGYANIGGLLMNLGLGYDSDEGRALCGALTALMTGVSYATSAEMAGELGPFPGYAKNADHMLRVIRNHRAAAHGTEAYEAVNVAPVALDVENCPDPELAVMAQRAWDKALALGEEHGFRNAQTTVIAPTGTIGLVMDCDTTGIEPDFALVKFKKLAGGGYFKIINQSVPAALETLGYGSAQIEEIVAYAVGHASLGNCPGINHAALVGHGFGPRELEKVDAALASAFDIRFVFNQWTLGEDFCKGTLGIPAEKLSDPGFDLLRHLGFTRAQIDAANDHVCGTMTLEGAPFLKPEHYAVFDCANACGKKGTRYLSVDSHIRMMAAAQSFISGAISKTINMPNSATIADALAAYELSWSLGIKANALYRDGSKLSQPLASALVEDDDEAAEVLESGSAQEKATVIAEKIVERIIVKEAIRSNREKLPARRKGYTQKAIIGGHKVYLRTGEYDDGKLGEIFIDMHKEGAGFRAMMNNFAIAVSVGLQYGVPLEEFVDAFTFTRFEPAGMVQGNDSIKNATSILDYIFRELAVSYLDRTDLAHVKPNGTSFDDLGNGHREGQPELVPAETGASKSVELLKQISSTGYLRKRMPQELMVLQGGVSTVAVASGLAEEAAVFESTTVAVTMDARTKAKMQGYEGDPCGECGNYTLVRNGTCMKCNTCGGTSGCS
>NZ_CP051542.1|WP_168782180.1|439649_439838_-|hypothetical-protein
MATNTGDGYRKGSVTDRTQTQHPSGDWVKRDTRTGEFMDRKSSDGPFKGVAREPDGRRSPQK
>NZ_CP051542.1|WP_168782179.1|437770_439435_-|formate--tetrahydrofolate-ligase
MLTDIEIARAATPRNIAEIAARLDIGAGDILPYGHDKAKISRDFIAGLDGAPEGRLVLVTAINPTPAGEGKTTTTVGLGDALNRIGKAATVCIREASLGPNFGMKGGAAGGGRAQVIPMEDMNLHFTGDFHAITSAHNLLAALIDNHIHWGNALDIDPGRVAWRRVMDMNDRALRAMVLGLGGPANGTPRESGFDITVASEVMAILCLANDLNDLQERLARIIVARTRDGRPVTARDLKADGAMTVLLRDALQPNLVQTLENNPALVHGGPFANIAHGCNSVIATRTALRLSDYVVTEAGFGADLGAQKFFDIKCRAAGLRPAAVVLVATVRALKMNGGVARADLGTEDVAAVRRGLPNLLRHIENLRLYGPPVVVAINHFSSDSKAEAQAIIDAAVAVGVTAVVCRHWAEGGAGAEDLARAVVAAAETPSDFNILYPDTLPLWEKVETICTRIYRADHVEAPPAVRRQLDEWQAAFGHLPVCMAKTQYSFSSDPKLLGAPEGHVIPIREVRLSAGAGFVVAICGDIMTMPGLPREPAADRIGLDAAGQVVGLF
>NZ_CP051542.1|WP_168782178.1|437206_437698_-|GAF-domain-containing-protein
MSHDLSAALADPDPQAALAALEALVQATVGARLYTVMALDPDTGMARRVWTSDPDTYPVGGEKPLPENRWTEIVIRARRTWVANTPEEVAELLFDHATIARLGCGAALNLPVTVGGRVIGTVNLLDRAGHFTPDRVAAAEALRLPAQAVLMRVALARAADGAA
>NZ_CP051542.1|WP_168782177.1|436850_437210_-|YigZ-family-protein
MTLTTFDRIIRDRGSVYAVSGGPVADRAAIEAALSALTAQRRFAKATHNSWAARLGGEGLKADDGEAGAGAIILRMLETEGLDDHLVVVTRWYGGKHLGGDRFRHVIGAVRHYLAERPR
>NZ_CP051542.1|WP_156114342.1|436672_436843_+|hypothetical-protein
MKTGFLQVMGWLQIAVAIANMILPDSQARTFFTAISLGFGLILLALAWILAELQRR
>NZ_CP051542.1|WP_168782176.1|435424_436468_-|phosphoribosylformylglycinamidine-cyclo-ligase
MTENSALTYAQAGVDIDAGNALVDRIKPAAKSTDRPGVMAGLGGFGALFDLKAAGYADPVLVAATDGVGTKLRIAIDTGIVAGVGTDLVAMCVNDLVCQGAEPLFFLDYFATGKLDVAQAAAVVEGIAAGCKAAGCALIGGETAEMPGMYHGGDFDLAGFAVGAMERGAHLPQGVAEGDVLLGLASSGVHSNGYSLVRRIVERTGLGWDAAAPFGRGKLGAALLEPTRFYVRPVLEAMRAGGVHAAAHITGGGITENLPRVLPEGLGAIVDLDAWEPPALFRWLAEEGGVSEAEMLKTFNCGIGMILVVARDRAQPLAAGLRAAGETVREIGEVGGRAGVGYTGTLW
>NZ_CP051542.1|WP_168783777.1|434801_435347_-|phosphoribosylglycinamide-formyltransferase
MVALADSMTGDHPARPVLVLSNDPAAGGLAKAAARGIPTAAVDHRPFRGDRAAFEAALLGPLEAARPDIICLAGFMRILTPAFVARFGGRMLNIHPSLLPLYPGLDTHARALAAGDAEAGASVHLVTPELDGGPILGQARVPVVAGDTPETLAARVLAAEHRLYPAVLRRFAAGETGRLDL
>NZ_CP051542.1|WP_036701360.1|448720_449752_-|cysteine-synthase-A
MRNASDLAALIGRTPLIRLNRASEATGCEIWGKCEFMNPGQSVKDRAALYIIRDAVARGALGPGGTIVEGTAGNTGIGLALVGASMGFRSVIVIPETQSQEKKDMLRLAGAELVEVPAAPYRNPNNYVRYSGRLAEALAATLPGGAVWANQFDNTANRQAHLETTGPEIWDQTGGGVDGFICSVGSGGTLAGVGMALQPKGVKIGIADPEGSALFAWYTQGELDAPGNSITEGIGQGRVTANLDGFTPDFACRVPDSEALPILYDLLEHEGLCLGGSSGINVAGAIRMAREMGPGKTIVTVLCDSGTRYQTKLWNPVFLRDKGLPVPHWLETRESALPDVTEA
>NZ_CP051542.1|WP_168782182.1|450007_451519_+|acyl--CoA-ligase
MTQTPPPAPAPSRPLNLAAHVLAAGQATPDKLALAVVSPTRADRWSYGRLTAAVRGTATGLLARGLNPGDRVLLRIGNEPAFPIAYLGCIAAGLVPVPTSAMLTAREVGKIAAEITHALTIAGPGIALPEGDTAPVLPVAELAAMATLPPGEFAEGDPDRLAYIVYTSGTSGQPRAVMHAHRAILARAMMFQGWYGLTPNDRLMHAGAFNWTFTLGTGLMDPWTVGATALIPAEGTALEQIPLLAARHGATILATAPGVFRRILRADWAPVPSLRHGLTAGERLDPALRDAWRARTGTELHEAMGMSECSTFLSGSPARPAPPGTAGYPQPGRRVAILSEDGAENPPGTPGVLAVHRSDPGLFLGYLGQPEETAARHQGDWFLTGDLAVAAEDGAISTLGRADDMMNAGGFRVAPAEVEDVLAPVPGAGDVAAAELTVAGGASIIAAFWTGDATQDALEAAAEAGLARYKQPRRYVRVDALPRTPTGKVNRRALREAHRPHPG
>NZ_CP051542.1|WP_168782183.1|451555_451918_-|hypothetical-protein
MIRKRISAGILAATVLGAAPALASQPGEMETGPQTAGVAAPINLVPARPVPMAVMTYEVFEATVDHADLAECPKALAREGRFCRVVLHGDALHVFAFSEDLDQPLQAVMEYPLDVIRFPE
>NZ_CP051542.1|WP_168782184.1|452135_454409_+|adenosylcobalamin-dependent-ribonucleoside-diphosphate-reductase
MTRFAAPIAEQIWDMKYRLRDADGTPRDGSVEDSWRRVARDLASVEADPAAWEDRFYAALEDFRFLPAGRILSGAGTGRSVTLFNCFVMGTIPDSMEGIFQSLKEAALTMQQGGGIGYDFSTIRPKGAPVTGVAADASGPLSFMDVWDAMCRTIMSAGSRRGAMMATMRCDHPDIEAFIAAKQDSARLRMFNLSVLVTDDFMAALKADGDWPLVFGGQVYRTLRARDLWDRIMRATYDYAEPGVIFIDRINAMNNLGYAETIAATNPCGEQPLPPYGACLLGSVNLARLVRDPFGPEAALDEDALAKLVTVAVRMMDNVVDASRFPLPQQAAEARAKRRIGLGVTGLADALMMVGLRYGAPEAAAATRRWMRRIARAAYLASADLAREKGAFPLYDAEAFLASGFMQRMDEDVRAAIRTHGIRNALLTSVAPTGTISLYAGNVSSGIEPVFALSYTRKILQKDGTRSEEEVVDYAASLWRERMGDAPLPDWFVDAQTLDPLDHVAMQAAAQEWVDSSISKTINCPPDIPFEAFKDVYLAAWDQGCKGCTTYRPNAVTGSVLSVAEPAAAPAAVPAEQLPAFYLEAPMDRPQALEGATYKLKFPGSEHAIYITLNDIEEGGRRRPFEVFINSKNMEHYAWTVALTRMISAVFRRGGDVSFVVEELKAVFDPRGGAWIAGRYVPSILAAIGGVIERHMVAIGFLAAEGAGLKADPTADAAPPAPGAVPVGPSCPACGMPGMRMVEGCLTCPSCGHSKCG
>NZ_CP051542.1|WP_168783778.1|454945_456193_+|DEAD/DEAH-box-helicase
MDTAFTRMGIDPRVAINLPELGLNEPTPIQAEAIPALVAGRDLLGLAQTGTGKTAAFSLPMLTRLVTKGERAEPLSCKALILAPTRELATQIAQNVEAFARGTGIRSFRVVGGASINAQVDRLARGVDVLIATPGRLIDLIERKAVRFDQTRYLVLDEADQMLDIGFIHALRRIAKLLPAERQTMLFSATMPKLMEELADSYLTDPVRVAVNPPGKAAEKIDQGVHFVNQGDKAALLAEYLSKHPGELAIVFGRTKHGSEKLSKLLEKWGFSVAAIHGNKSQGQRERALSSFRSEETQVLVATDVAARGLDIPQVAHVYNFDLPNVPENYVHRIGRTARAGRDGRAVAFCAPAEVGELRAVEKAMKAQIPVIGGEPPAGPVPSPRKPGARPQGDGAARKRPARRPSRAPKGQQRG
>NZ_CP051542.1|WP_168782185.1|456310_456883_+|thymidine-kinase
MAKLYFHYSTMNAGKSTLLLQAAHNYRERGMTPLLLIAALDTRAGPGRIGSRIGLGADAIAFDADTDLFALIAAEGPDAACIFVDEAQFLTPAQVWQLARVADDCGQPVMAYGLRTDFRGELFPGSAALLAIADDLREVRTICHCGRKATMVVRLGPDGAVLREGAQIQVGGNESYVSLCRRHWRAAMGA
>NZ_CP051542.1|WP_052512846.1|456993_458163_+|D-alanyl-D-alanine-carboxypeptidase
MRLSSLSCTARGALAAAILALTALPAAAFDTTARAAWVYDVATGTVLMEKDADRAIPPASMSKLMTVYMLFEAIHEGRVSLDTRFPVSTKARQMKGSTMFLNERDRPTVEELIKGIIVLSGNDACVVVAEGLAGTEEAFAREATARAKALGLTETHLTNASGWPDPGHRMSTHDLGVLAQHLITDFPELYKNFAIKEYAFDNRAPANRHNRNPILGLGIGADGLKTGHTEEAGYGLVGSAVQDGRRVIFVLSGLGSEKARAEESERIVNWAFRQFTMKTVVPKGERVAWAPVWLGAARRVALTTQDGVNVLIPAGAAAGVTAEAVFDGPIEAPITAGQRLGELVVTVPGSVQSRLPLVAADDVPRAGFMGRMQNAAMRLGRQAAAAVGG
>NZ_CP051542.1|WP_168782186.1|458183_458897_+|dTMP-kinase
MFISLEGIDGSGKSTQARRLAEALRAEGHEVVLTREPGGAPGAEDIRRLLVEGSADRWSAETELLLFTAARRDHLERTIRPALDRGAWVVTDRFADSTRVYQGATRGDLRGAVDALHALMIGVEPDRTFVIDLDPAEALARTLRRQQPGDLPPAAELAEAAARAVAAPPVAAVPAGTHLPSSDDAAAEDRFESMGLPFQRALRDGFRALAAAHPDRIRLIDGSGPAEAVAARVRAAL
>NZ_CP051542.1|WP_168782187.1|458899_460009_+|DNA-polymerase-III-subunit-delta'
MARDLAPDDPPVESDRVPGAPHPRETPRVIGQDEAAAGFLDAAAAGRLHHGWLITGPRGTGKATLAWAIARWLIAGGEPGRLEVDPDHPAARRMRALAEPRLHLVRRSEDDKGRLRAEIVIDDIRRMIEFFHLSAIDGGRRVVIIDAADDMNPQSANAVLKMLEEPPRDAMLLLISHQPGRLLPTIRSRCRQLRLGPLSPDDMAAALAPLEVEGDPARLAALAAGSVGEALRLAGQDGLSRYADLVALFQTLPRMDRSRAAALAETAGGRPGPDGDPFDLTMTLLDRFLARAARAGLMGPPLPEAADGEAALLARLSPDEPAARRWAEAQAELSARARRGRAVNLDPAALVMDMLMTLAQTGADAPARG
>NZ_CP051542.1|WP_168782188.1|460038_460893_+|TatD-family-hydrolase
MSTDAPRPARSPEPVAQNPADRPQLVDSHCHLDFPDFAGELPALVDRARAAGVTRMVTICTRLRLEPSVRAIAEAHDGVFYAAGTHPMYAAEEPLATVEDLVALARHPKFVGIGETGLDYHYTAESAARQAESLLVHIEAARRTGLPLIIHARDADDDMAAILTREHAAGGFTGVMHCYTSGPALAEAALGIGFYLSMSGIAAFPRSTELREIFAAAPRDRILVETDAPYLAPPPHRGKRNEPAYVAHTARVGAALFEMEEAAFAALTSANFDRLFTRAAGVTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051542_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051542_5

2230508-2230597

Orphan

Consensus_repeat	Method
CGTAGGGTGCGTGTTTACACGCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051542_5

>merge|NZ_CP051542|5|2230508-2230597|CRISPRCasFinder
CGTAGGGTGCGTGTTTACACGCACCATTGACGGACGGTCGGGCGACCGTGGGAAGGGGCGAAGGTCGTAGGGTGCGTGTTCACACGCACC

>NZ_CP051542|5|5|2230508-2230597|CRISPRCasFinder
CGTAGGGTGCGTGTTTACACGCACC	ATTGACGGACGGTCGGGCGACCGTGGGAAGGGGCGAAGGT
CGTAGGGTGCGTGTTCACACGCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051542.1\|WP_168783163.1\|2234919_2235462_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_168783166.1\|2240185_2241007_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197666
NZ_CP051542.1\|WP_168783165.1\|2239117_2239993_-\|PQQ-binding-like-beta-propeller-repeat-protein	unknown	unknown	gnl\|CDD\|369882
NZ_CP051542.1\|WP_168783168.1\|2242121_2242883_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|237896
NZ_CP051542.1\|WP_168783908.1\|2232109_2234719_+\|DUF4175-domain-containing-protein	unknown	unknown	gnl\|CDD\|372724
NZ_CP051542.1\|WP_168783160.1\|2228393_2229821_+\|argininosuccinate-lyase	unknown	unknown	gnl\|CDD\|179143
NZ_CP051542.1\|WP_139305904.1\|2230095_2230320_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051542.1\|WP_036733044.1\|2236591_2237266_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|225438
NZ_CP051542.1\|WP_168783161.1\|2229817_2229979_+\|argininosuccinate-lyase	unknown	unknown	unknown
NZ_CP051542.1\|WP_036735208.1\|2227817_2228363_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
NZ_CP051542.1\|WP_168783159.1\|2227122_2227716_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NZ_CP051542.1\|WP_168783157.1\|2224850_2225543_+\|ribulose-phosphate-3-epimerase	unknown	unknown	gnl\|CDD\|238244
NZ_CP051542.1\|WP_168783155.1\|2221926_2222919_-\|hexose-kinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP051542.1\|WP_036733074.1\|2237385_2238282_+\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|225088
NZ_CP051542.1\|WP_168783158.1\|2226194_2227028_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP051542.1\|WP_168783164.1\|2238281_2239121_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP051542.1\|WP_036735199.1\|2222915_2223323_-\|metallopeptidase-family-protein	unknown	unknown	gnl\|CDD\|240572
NZ_CP051542.1\|WP_168783162.1\|2230775_2232041_+\|diaminopimelate-decarboxylase	unknown	unknown	gnl\|CDD\|143501
NZ_CP051542.1\|WP_168783167.1\|2241036_2242125_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP051542.1\|WP_168783156.1\|2223404_2224727_+\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|183594

Protein	Function_ID	Function_description	E-value
NZ_CP051542.1\|WP_168783165.1\|2239117_2239993_-\|PQQ-binding-like-beta-propeller-repeat-protein	gnl\|CDD\|369882	pfam08450, SGL, SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.	1.3332e-06
NZ_CP051542.1\|WP_168783166.1\|2240185_2241007_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	3.30658e-15
NZ_CP051542.1\|WP_168783168.1\|2242121_2242883_+\|ABC-transporter-permease	gnl\|CDD\|237896	PRK15066, PRK15066, inner membrane transport permease; Provisional.	1.79972e-63
NZ_CP051542.1\|WP_168783908.1\|2232109_2234719_+\|DUF4175-domain-containing-protein	gnl\|CDD\|372724	pfam13779, DUF4175, Domain of unknown function (DUF4175).	0
NZ_CP051542.1\|WP_168783160.1\|2228393_2229821_+\|argininosuccinate-lyase	gnl\|CDD\|179143	PRK00855, PRK00855, argininosuccinate lyase; Provisional.	0
NZ_CP051542.1\|WP_036733074.1\|2237385_2238282_+\|FtsX-like-permease-family-protein	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	2.61337e-24
NZ_CP051542.1\|WP_036733044.1\|2236591_2237266_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	8.89225e-82
NZ_CP051542.1\|WP_036735208.1\|2227817_2228363_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	4.26173e-47
NZ_CP051542.1\|WP_168783159.1\|2227122_2227716_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	1.69417e-119
NZ_CP051542.1\|WP_168783157.1\|2224850_2225543_+\|ribulose-phosphate-3-epimerase	gnl\|CDD\|238244	cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose phosphate pathway. In the Calvin cycle Ru5P is phosphorylated by phosphoribulose kinase to ribulose-1,5-bisphosphate, which in turn is used by RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) to incorporate CO2 as the central step in carbohydrate synthesis.	2.93757e-116
NZ_CP051542.1\|WP_168783155.1\|2221926_2222919_-\|hexose-kinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	1.59777e-76
NZ_CP051542.1\|WP_168783158.1\|2226194_2227028_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.89292e-66
NZ_CP051542.1\|WP_168783164.1\|2238281_2239121_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	6.21987e-33
NZ_CP051542.1\|WP_036735199.1\|2222915_2223323_-\|metallopeptidase-family-protein	gnl\|CDD\|240572	cd12952, MMP_ACEL2062, Minimal MMP-like domain found in Acidothermus cellulolyticus hypothetical protein ACEL2062 and similar protein. The subfamily includes an uncharacterized protein from Acidothermus cellulolyticus (ACEL2062) and its homologs from bacteria. Although its biological role remains unclear, ACEL2062 contains a minimal metalloprotease (MMP)-like domain consisting of 3-stranded mixed 2-beta sheets and a HExxHxxGxxD/S (x could be any amino acid) motif. It may belong to a superfamily of bacterial zinc metallo-peptidases, which is characterized by a conserved HExxHxxGxxD motif.	1.22889e-42
NZ_CP051542.1\|WP_168783162.1\|2230775_2232041_+\|diaminopimelate-decarboxylase	gnl\|CDD\|143501	cd06828, PLPDE_III_DapDC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase. Diaminopimelate decarboxylase (DapDC, EC 4.1.1.20) participates in the last step of lysine biosynthesis. It converts meso-2,6-diaminoheptanedioate to L-lysine. It is a fold type III PLP-dependent enzyme that contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. DapDC exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	0
NZ_CP051542.1\|WP_168783167.1\|2241036_2242125_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	5.41649e-104
NZ_CP051542.1\|WP_168783156.1\|2223404_2224727_+\|glutamate--tRNA-ligase	gnl\|CDD\|183594	PRK12558, PRK12558, glutamyl-tRNA synthetase; Provisional.	0

>NZ_CP051542.1|WP_139305904.1|2230095_2230320_+|hypothetical-protein
MSSLNAWGGRGTGIGMGLVAVLALAACGGETRRTTVDGPETAVMIQKGTYVYNPNRPHPPVSLSRSDLEGIAIR
>NZ_CP051542.1|WP_168783161.1|2229817_2229979_+|argininosuccinate-lyase
MIRAWLGLAALAALAGCGVDGAPVAPAAPTATQVTVQPGVRVTGDAYVGMRYN
>NZ_CP051542.1|WP_168783160.1|2228393_2229821_+|argininosuccinate-lyase
MTDPQTPDRDAERSANTMWGGRFAAGPDAIMEAINASIGYDRRMSAQDIRGSRAHAAMLAAQGIISPSDAEAIREGLLTVLSEIEGGDFVFSTALEDIHMNVEARLKALIGEPAGRLHTARSRNDQVATDFRLWVRDQCDAAVGGLQALIRALVAQAEAGADWVMPGFTHLQTAQPVTWGHHMMAYVEMLGRDIGRFTDARARMNECPLGAAALAGTGFPIDRHATAQALGFDRPSANSLDAVSDRDFALEFLSAAAICATHLSRLAEELVIWSSAQFRFVAMSDRWSTGSSIMPQKRNPDAAELIRAKIGRILGAAVALFTVMKGLPLAYSKDMQEDKEQVFDAADTLMLALAATTGMMSDLTVNRDRLEAAASSGFSTATDLADWLVREAGLPFRDAHHATGALVAAAEKRGVDLPELTLVEMQAVNSAITQQVYEVLGVHNSVASRQSYGGTAPDQVRAQIARWKGVMEGWE
>NZ_CP051542.1|WP_036735208.1|2227817_2228363_-|TlpA-family-protein-disulfide-reductase
MLRSLALYTSLLLAANAAAGGAVDWQAARDAGLPKLVESTPAPAPETTFTDLTGGTHTLADWKGKVVLLNFWATWCAPCREEMPALDALQKARGGDRFAVLTVASGRNTEAAITRFFAEAGVSALPTLTDPQMALARSMGVLAMPVTVLIDAEGREVARMTGDADWSSPAALALIDAMLAE
>NZ_CP051542.1|WP_168783159.1|2227122_2227716_+|DNA-3-methyladenine-glycosylase-I
MTPERCPWCGTDPLYQAYHDDEWGVPETDPQALWEKLVLDGFQAGLSWITILKKRDNFRAAFDGFDPARVARWGEAEVARALADPGIVRHRGKIEATVAGARKYLELEERSGGFAGFLWGFVDGKPIRNAWRGPAEVPTETAESRAMARALKAEGFRFCGPVISYAFMQATGMVNDHLVTCHRHQPVAALGKTAMHR
>NZ_CP051542.1|WP_168783158.1|2226194_2227028_-|EAL-domain-containing-protein
MTPDPDQIVLDGTSSPLDFAADRQSRLTMSTVRGAVERGDAVLAFQPIVPSDRPTRPAFYEGLIRIIDETGRFVPLRDFMPLAELSELGRRIDCLSLSIGLRSLAEQPALRLSVNMSARSVGYPDWMRTLEQGLAQDHSVAERLILEITESSAMGLADEVRPFMQDLQSRGISFALDDFGAGYTSFRYLREFAFDLIKIDGQFIRQISAQRDNQVLTEALMSIARHFDMFTVAEQVETADDAAFLINLGIDCLQGFYFGAPTISPPWRTPQAATARG
>NZ_CP051542.1|WP_168783157.1|2224850_2225543_+|ribulose-phosphate-3-epimerase
MEFDRRIRIAPSILSADFADFGREIAAIEAHGADWVHVDVMDGHFVPNLTFGPPAVRAFRKHVTTFMDVHLMIAPVDPYIEAYAEAGAEMIVAHVEAGPHIHRTLQAIRATGAKAGVALNPGTSPEAVGYALDLCDMVLVMSVNPGFGGQKFIPSSVEKIARLREMIGERPIHIQVDGGIDPVTAPLVAAAGADVLVAGSAVFKGGSVATPEVYGRAIRAIREAAEAAVR
>NZ_CP051542.1|WP_168783156.1|2223404_2224727_+|glutamate--tRNA-ligase
MTTTRFAPSPTGHIHVGNLRTALMNWLIARKAGGTFILRLDDTDRERSKQEYADGIQRDLEWLGLTWDRIERQSDRLDRYAEAAEGLRAAGRLYEVFETPTELDLKRKKLLNMGRPPVYDRAGLGLTEAQKEALRAEGREGYWRFRLDQQRIEWPDGIIGDVSIDAASVSDPVLIRADGQVLYTFASSVDDVDMGVTDIVRGADHVTNTATQIQIIEALGGTPPRFAHHSLLTGPQGEELSKRLGTLSLRDLRERGVAPEALLSLMARLGSNQPVELRLSLDELAEGFDLAQFGASPTKFDAEDLWPLTRERNQNLPLSAVADRLAALGVPDELAPAVWEVARHNITRLDEVEGWWTLMRDGADPVIDPEDAEFVAQALALLPPRPWTAATWGEWTGAVKAATGRKGKGLFMPLRKALTGMDHGPEMAALMPLLQVVRAG
>NZ_CP051542.1|WP_036735199.1|2222915_2223323_-|metallopeptidase-family-protein
MTDWTDRAAPTTAEIESLAREVLAGLPVEFAGHAQDVILRVEEFAGEEVLDELEIDDPLELTGLYDGVPLTEKSPSEPQHFPDTVYLYRRAILDEWADRGDVTLGALVGHVVVHEFAHHFGWSDDDIARIDRWWE
>NZ_CP051542.1|WP_168783155.1|2221926_2222919_-|hexose-kinase
MIPAGAGGQAPILTVTLNPALDVATSAEAVVPELKLRCEAPQVDPGGGGINVSRAIARMGGRSTALVALGGGTGARLCDLMRAEGLAMLRLDAPGETRQSLSVTDRGSGAQFRFVLPGPDWGAPEVGLALDSIAAAASPGGIVVLSGSNPPGVPAEFAARLGARLARQGDGTGVGAVRLFVDTSGAALAAVAAGTGGPVAVLRMDGPEAEGLAGRPLATRAETADFAAALAASGAARTVIVARGADGNILAGPEGRWHAEAHRVEIVSKVGAGDSFVAGYTLAVARGMAAPEALGLAAACASAACMTPATELCRSEDVARLYDTRVVTPI
>NZ_CP051542.1|WP_168783162.1|2230775_2232041_+|diaminopimelate-decarboxylase
MDHFTYRDGALDAEEVPLARIAAEVGTPVYVYSAATLTRHFNLFREALAWTPHLVCYAVKANSNLAVLRLLGGLGAGMDVVSGGEYARAVAAGVPGERIVFSGVGKTRDEMARAIAGGIRQFNVESEPELAVLSEVAAAMGAEVPIAVRVNPDVDARTHAKIATGKSENKFGIPIARAREVYAQAARLPGLRVVGIDMHIGSQLTDLAPYRQAYGKMADLCRVLRADGHAISRLDMGGGLGIPYRRGNEAPPLPLEYGQVIRETVGDLGCEIEIEPGRNIVGNAGVLLASVIFLKRGEGRDFLILDAAMNDLIRPAMYDAHHDIVPVVERAPGSAVAPVDVVGPVCESGDTFARGVELPGLEAGELVAFRSAGAYGAVMASEYNSRPLVPEVLVSGDRYAVIRARPTIEEMLGRDRIPDWL
>NZ_CP051542.1|WP_168783908.1|2232109_2234719_+|DUF4175-domain-containing-protein
MPRAARRAVALTRAGLWWEALAASFWAPAALAAGLVAALALGVVAGLDAAGVPGWALAALGGFWALIFAATALAGWLRFRAPRRAEALARVDRRLAGRPLSALGDRMALGGPEAAALWEAHLDRAWAAAAAARPVVPDAGLVRRDPYGLRLMALTALVMALVFGGLAPAGQGLSAMASGWRPLRDAPDPGASAGPAWEGWAEPPAYTRRPTIYLNALEADGLVVPEGTVLSFRLYGDGLAVAQDVGEPLAEPAGAAGAPEAVRLERVTARRDGTVSVGDRRFALTVTPDAAPEVSLAALATRRADGRLAQGFSARDDNGVAAGTARIALDLQAVDRRFGLTPDPEPREALSLPLPLPAAGARRQVQGTLGADLARHPWANLPVRITLEVQDGIGQTGATPPVAMVLPGRRFFDPLAAGLAEVRRDLMWSRDNAARSARLIRAMVWRPDRAVPDDAARAIVAAVQALEAGPLTPEARDAVAEGLWTAAVAIEDGGLSDALARMRQAQERLSQAIRQGASPDEIARLMDELKAATDAYTEMLAQQGEDPAARFDRSERPVQEITGDQIQQMMDEIQRLMNEGRMSEAAELLEQFNRMMENLEMREGGAGGEGAPGSRAQRRLSETLREQQDLADEALREAQRDPFGLGRQGMDPESGAAPGEGEAGAGPEGAQPGEPGAGAGEGEGEAEGGSLADRQRGLREELGRQRGLMPGRGTPEGEAAGREIDRAGRAMEDAEQALRDGDPAGAMDRQAEAIEALREGMRALGDLAARQGGERGQPGDQGTGEDGQAGMTGRAQGEGEGRADRPGRDPLGRDRSGQGGNIASGEALAEGERQAGRARELQDEIRRRAGEPARPRAERDYLGRLLGAE
>NZ_CP051542.1|WP_168783163.1|2234919_2235462_-|hypothetical-protein
MKVGLPAALTVHGTAYDLAHLAPFRLTLAGQAAGGRDLAVRVTFSSHVFSTAPVGAAHDFLDENGAPRSLCGQRFHRSLTLANDIRQIVAANAYSWPSRDRNQVNHLAVLPAPQAALLNGVHWVLFYYLYPSAIDDLDVEMSIRSCYQQPLNFQKHPRREKIRSLIKTAHFKNCRVPAQR
>NZ_CP051542.1|WP_036733044.1|2236591_2237266_+|ATP-binding-cassette-domain-containing-protein
MIEMRDVAFAYPRGGALFKGLTLSLPRGSFHFLTGPSGAGKTTFLRLCIADLLPSAGQMTLFGEDAATLGRDAIAGVRRRIGVVHQDTQFLDHLPVAENIALPMMVAGQPIDMQAIRDLLAWVQMTGQARAMPPSLSGGERQRAALARAVILSPDVILADEPTGNLDWEMSLRLLQLLVELNRSGKTVLIATHDLNLIRAAKQMVSARVLRIAGGRLQTAGAEL
>NZ_CP051542.1|WP_036733074.1|2237385_2238282_+|FtsX-like-permease-family-protein
MATLWRGLIGRQAGLADRIVPPTGMNARLTVFAAGVMAFLAVFALALALATGRLADRWAEGLAQTVTVRVSAPPEAIEAETAAVMAALETTPGVAERRLLPPDEVEALLEPWFGPDVPVDALPVPRLIEVHTDDDFDAAALRLRLEGEAPGAVLDDHTQWRRPLVAAASRLRTLGWLSLALIGAAGAAIVTLAAQASLAANGQVIRVMRLIGARDLTIAQAFVRRLTRRVALGSAGGTLIGMLAVWALPDMNAAGGFLTGLGFTGWGWLAPLLIPVVGVLVGFVATRAAALRMLRAVR
>NZ_CP051542.1|WP_168783164.1|2238281_2239121_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MARRVETPGWALDHGPAADPAAYRPGPLPALWRVRTTVYYLWIAGVTLVMGLWWLPKVMRDPRNAHVLPVVWTGRLLAAARTILGVSVELRGTPPTTDAIIAAKHQSFLDILAISHAVPQCGFIMKREVMRVPVMGYYARRAGCIPIDRARGVEAMRQITGEIAERMAGPEGLGQLIIYPEGTRTRPGERRRYKHGVGTVQAATGLNVHPVAVNCGMFWPREGLRIRPGRSVIEFLPPVPPEADPPETVARLEALIEGRSDALMAMAGLALPAAEAPRA
>NZ_CP051542.1|WP_168783165.1|2239117_2239993_-|PQQ-binding-like-beta-propeller-repeat-protein
MRFTLAAAAPVPALVPVLVAALVAAGPAVADAPALAHPESVVMAGEQGFVSNLGQALDTSTRDGDGFIARIGPQGEVLDGPAIPQPDTPLDSPKGLALLGGRLYVADIDRIVAFDPTTGRQLAEYRPAGARSLNDLAPAGERLLVTDFEAGRVLSLDPGTGRFEVIASGIGGANGVVADGDRAYVVATGAQLEGGGITRIDLTSGATAPVGDLHGRFDGVALAADGALIVSDWVAMGTPTPGRILRVDPATGAAEPVAAPAMQGPADLARSGDSLLVPVMPEHRVEVLPAP
>NZ_CP051542.1|WP_168783166.1|2240185_2241007_+|helix-turn-helix-domain-containing-protein
MVPPPAAGPVPGTGKVGAGPGLFTYCALSRERIADVLVEQPAVGIVLEGRKELWLGADEAAVCRPGDAFIVPADTPLTAVNIPDPQRGWYRALIIELGAAALPVSARRAGPGLALTMTGALEAALWHAAQAIADAPSRPAVRQARLDELAALVLDDPVGGWLLRARAGQRLARLLAADPARDWTVDQAAAALGLGNATLRRRLAAEKTSFRALLRSARLERAHRVLSETGRSGAAAAAAGLRSRGHFARAYRARFGHNPAQSGPGLDNPPHHP
>NZ_CP051542.1|WP_168783167.1|2241036_2242125_+|ABC-transporter-ATP-binding-protein
MPPIIEVDRLSKRYGSGTVALDEVSLAIEPGEILALLGPNGAGKTTLISIICGLVVPTGGTVRVGGHDIRTDWRAARRLIGLVPQEIALEPFETVIDSVRFTRGLYGEGPDEAYLEQLLRSLALWEKRGAKTRELSGGMKRRVLIAKALSHRPRVLFLDEPTAGVDVHLRREMWQVVRDLRAQGVTIILTTHYLEEAEDMADRIGVIDKGRLLLVRPKAELMGEFGRKRLTVEVDRPLAALPEGLPPGIAAGLTLAPGGLRLDYDYDARAARTGIGALLAALNERGIAVRDVATTQSSLEEVFMALLEHGGAAGGAAGRLGAGATDEGPAPAAPPVTEALGEAAGAEAGDAAVARDAGRGTA
>NZ_CP051542.1|WP_168783168.1|2242121_2242883_+|ABC-transporter-permease
MNWQSVRAMYRHEMARFFRTIWQSLASPVLSTVLYFIVFGAAIGGRIQAVEGIAYGAFIVPGLMMLTVLQQSVSNASFGIYFPKFSGTIYEYLVAPTGWAEVALGFVGAAATKAVLIALIILVTSFAFVGVHIAHPVWMLVFLVLTALAFSLLGFIIGLWAKNFEQLQLVPMMVITPLVFLGGAFYSASMLPAPWDRIATFNPVLHLISGFRWSFFGMADVPVGLSLAAVVVMIAVLLVAVRWIFLTGWRLRE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010648	Phaeobacter piscinae strain P36 plasmid pP36_e, complete sequence	18356-18383	2	0.929
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	392645-392672	2	0.929
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	360207-360234	2	0.929
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	631286-631313	2	0.929
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	96910-96937	2	0.929
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	258615-258642	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	169066-169093	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	164026-164053	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	36786-36813	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	58254-58281	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	6515-6542	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	22067-22094	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	72495-72522	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	54965-54992	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	69288-69315	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	54911-54938	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022424	Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence	131110-131137	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	108727-108754	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021807	Sinorhizobium meliloti strain T073 plasmid accessoryA, complete sequence	139267-139294	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	713534-713561	3	0.893
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	807152-807179	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1789250-1789277	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	590361-590388	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	181693-181720	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP022305	Thalassococcus sp. S3 plasmid pS3B, complete sequence	58031-58058	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	6800-6827	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	373912-373939	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	35295-35322	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	775711-775738	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	161798-161825	3	0.893
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	258264-258291	3	0.893
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP013104	Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence	558673-558697	3	0.88
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_LR594691	Variovorax sp. WDL1 plasmid 3	12634-12658	3	0.88
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	639266-639290	3	0.88
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP021083	Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence	373762-373786	3	0.88
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	401742-401769	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	381574-381601	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	356983-357010	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	372448-372475	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	373324-373351	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040761	Paracoccus sp. 2251 plasmid unnamed5, complete sequence	6434-6461	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_LR723674	Rhizobium flavum strain YW14 plasmid 5	84050-84077	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	226225-226252	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	226810-226837	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	226558-226585	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	226252-226279	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010614	Phaeobacter inhibens strain P92 plasmid pP92_d, complete sequence	65922-65949	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010626	Phaeobacter inhibens strain P51 plasmid pP51_c, complete sequence	64252-64279	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010671	Phaeobacter inhibens strain P57 plasmid pP57_c, complete sequence	64337-64364	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1565749-1565776	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1422350-1422377	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032326	Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence	188556-188583	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1504251-1504278	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021045	Phaeobacter gallaeciensis strain P129 plasmid pP129_e, complete sequence	64444-64471	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	453058-453085	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010678	Phaeobacter gallaeciensis strain P75 plasmid pP75_e, complete sequence	64540-64567	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	827407-827434	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	922894-922921	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1496294-1496321	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	581879-581906	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	46591-46618	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015747	Shinella sp. HZN7 plasmid pShin-11, complete sequence	16231-16258	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	34944-34971	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	65964-65991	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_023142	Phaeobacter gallaeciensis DSM 26640 plasmid pGal_F69, complete sequence	64569-64596	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1049208-1049235	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1504229-1504256	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	1241643-1241670	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010789	Phaeobacter gallaeciensis strain P63 plasmid pP63_e, complete sequence	64534-64561	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1504258-1504285	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040763	Paracoccus sp. 2251 plasmid unnamed4, complete sequence	7107-7134	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040763	Paracoccus sp. 2251 plasmid unnamed4, complete sequence	7350-7377	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	246825-246852	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	165106-165133	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1419782-1419809	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010685	Phaeobacter piscinae strain P14 plasmid pP14_d, complete sequence	64283-64310	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	5773-5800	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	148920-148947	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1939971-1939998	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1503744-1503771	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010720	Phaeobacter piscinae strain P18 plasmid pP18_e, complete sequence	65028-65055	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	554396-554423	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1213401-1213428	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1428596-1428623	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010660	Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence	64530-64557	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1425324-1425351	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1604752-1604779	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	627797-627824	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010605	Phaeobacter inhibens strain P83 plasmid pP83_f, complete sequence	66052-66079	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010744	Phaeobacter inhibens strain P59 plasmid pP59_c, complete sequence	64288-64315	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010622	Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_e, complete sequence	64282-64309	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1515225-1515252	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1604719-1604746	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1478956-1478983	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1514009-1514036	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1603513-1603540	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010732	Phaeobacter inhibens strain P88 plasmid pP88_g, complete sequence	65935-65962	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1500249-1500276	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1414060-1414087	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1479268-1479295	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1514009-1514036	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1414467-1414494	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1603549-1603576	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1478956-1478983	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010642	Phaeobacter gallaeciensis strain P73 plasmid pP73_f, complete sequence	64540-64567	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010773	Phaeobacter piscinae strain P13 plasmid pP13_f, complete sequence	65000-65027	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010655	Phaeobacter inhibens strain P54 plasmid pP54_e, complete sequence	64288-64315	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1359741-1359768	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1414706-1414733	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1478159-1478186	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1514009-1514036	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1514009-1514036	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1514009-1514036	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1603549-1603576	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	161447-161474	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	190338-190365	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010711	Phaeobacter inhibens strain P66 plasmid pP66_f, complete sequence	66052-66079	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	81970-81997	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010702	Phaeobacter inhibens strain P24 plasmid pP24_f, complete sequence	64379-64406	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010748	Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_c, complete sequence	64281-64308	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1181253-1181280	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP019311	Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-4, complete sequence	31787-31814	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1713416-1713443	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1603538-1603565	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1414082-1414109	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1421343-1421370	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1401996-1402023	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1454940-1454967	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1494130-1494157	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1511324-1511351	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1603538-1603565	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1414082-1414109	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1479267-1479294	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1604539-1604566	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1414082-1414109	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1414082-1414109	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1603549-1603576	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1514012-1514039	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1603560-1603587	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1603361-1603388	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010593	Phaeobacter gallaeciensis strain P11 plasmid pP11_e, complete sequence	64566-64593	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010739	Phaeobacter inhibens strain P72 plasmid pP72_d, complete sequence	64446-64473	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1211135-1211162	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	120506-120533	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	620313-620340	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	119440-119467	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031958	Phaeobacter sp. LSS9 plasmid unnamed2, complete sequence	16650-16677	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1407907-1407934	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1407988-1408015	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	21024-21051	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	492494-492521	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	893028-893055	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	101668-101695	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	687848-687875	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	132341-132368	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	99754-99781	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	100144-100171	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	100690-100717	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	101080-101107	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	101629-101656	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	102019-102046	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	968902-968929	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	237353-237380	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1619985-1620012	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031955	Phaeobacter inhibens strain 2.10 plasmid unnamed3, complete sequence	5620-5647	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_018422	Phaeobacter inhibens 2.10 plasmid pPGA2_71, complete sequence	5383-5410	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1613323-1613350	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	418980-419007	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	564298-564325	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1604445-1604472	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	537534-537561	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	100399-100426	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	532098-532125	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	532098-532125	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	620313-620340	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	9691-9718	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	12772-12799	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	113692-113719	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	117400-117427	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021409	Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence	45685-45712	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009112	Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence	251429-251456	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	86571-86598	4	0.857
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP025584	Paracoccus jeotgali strain CBA4604 plasmid pCBA4604-01, complete sequence	77515-77542	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	2089-2116	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	636869-636896	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	590604-590631	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	91327-91354	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	292870-292897	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	578756-578783	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP015420	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence	27639-27666	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	134587-134614	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020385	Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence	105731-105758	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	292345-292372	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_AP014801	Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351	58573-58600	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	241792-241819	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	205188-205215	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	161035-161062	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	146396-146423	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	241490-241517	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP015065	Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence	342142-342169	4	0.857
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	359414-359441	4	0.857
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	938262-938286	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	143663-143687	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	230919-230943	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1068834-1068858	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	MK937599	Gordonia phage Dmitri, complete genome	36325-36349	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	AF440695	Virus PhiCh1, complete genome	42358-42382	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NC_004084	Natrialba phage PhiCh1, complete genome	42358-42382	4	0.84
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	LR535912	XXX	28237-28261	4	0.84
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010648	Phaeobacter piscinae strain P36 plasmid pP36_e, complete sequence	18251-18278	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP051471	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence	36408-36435	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP030274	Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence	57876-57903	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	376360-376387	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377860-377887	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	377263-377290	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015215	Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence	21689-21716	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047034	Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence	55344-55371	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015291	Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence	69666-69693	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP047040	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence	55289-55316	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022424	Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence	262694-262721	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	108451-108478	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_011962	Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence	109105-109132	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	226504-226531	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	227362-227389	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	671034-671061	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	68419-68446	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	589595-589622	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	588263-588290	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040763	Paracoccus sp. 2251 plasmid unnamed4, complete sequence	7404-7431	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	163300-163327	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_021911	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence	164269-164296	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1591182-1591209	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1592067-1592094	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	674390-674417	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	672985-673012	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	695913-695940	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	2692-2719	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	633272-633299	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	633761-633788	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	637472-637499	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	3244-3271	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	638024-638051	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	742692-742719	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	743577-743604	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	763529-763556	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	764414-764441	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1513928-1513955	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	742692-742719	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	743577-743604	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	763529-763556	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	764414-764441	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1513928-1513955	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	742692-742719	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	743577-743604	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	527018-527045	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	297285-297312	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	298029-298056	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	693426-693453	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	742696-742723	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	743581-743608	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	763529-763556	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	764414-764441	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1513928-1513955	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	763529-763556	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	764414-764441	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1513928-1513955	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	763529-763556	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	764414-764441	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1513928-1513955	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	583691-583718	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	290083-290110	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	290509-290536	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	691587-691614	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	171126-171153	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1059538-1059565	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1511243-1511270	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1420750-1420777	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1421635-1421662	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	742692-742719	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	743577-743604	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	763531-763558	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	764416-764443	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1513931-1513958	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	713399-713426	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	118765-118792	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP034347	Roseovarius sp. MME-070 plasmid pMME07001, complete sequence	52343-52370	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	488273-488300	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	489533-489560	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	491285-491312	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	492746-492773	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	851734-851761	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1413875-1413902	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	851815-851842	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	232157-232184	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	209002-209029	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	214886-214913	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1072840-1072867	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1315059-1315086	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	352696-352723	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90724-90751	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94435-94462	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	94924-94951	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	90172-90199	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	91554-91581	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	532179-532206	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1301134-1301161	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1302019-1302046	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	532179-532206	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1301134-1301161	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1302019-1302046	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	45276-45303	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	38948-38975	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	122209-122236	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	38933-38960	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_010580	Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01, complete sequence	24506-24533	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	74571-74598	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	73470-73497	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033323	Azospirillum brasilense strain Cd plasmid p5, complete sequence	69896-69923	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	82746-82773	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033317	Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence	128113-128140	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	136644-136671	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	49115-49142	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	117895-117922	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	122617-122644	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	109246-109273	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	110230-110257	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032348	Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence	118447-118474	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	110617-110644	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022542	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence	78359-78386	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	41425-41452	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	94520-94547	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	25796-25823	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP017947	Bosea sp. Tri-49 plasmid unnamed1, complete sequence	30145-30172	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	50359-50386	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP040760	Paracoccus sp. 2251 plasmid unnamed6, complete sequence	93201-93228	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	194635-194662	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP019083	Paludisphaera borealis strain PX4 plasmid PALBO1, complete sequence	5438-5465	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	1715199-1715226	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	93129-93156	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	72827-72854	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP035421	Leisingera sp. NJS204 plasmid unnamed4, complete sequence	119184-119211	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	273403-273430	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1286387-1286414	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	235515-235542	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1634343-1634370	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	4237-4264	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1316087-1316114	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1316972-1316999	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1317857-1317884	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1318742-1318769	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1500172-1500199	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	922089-922116	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	922974-923001	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1674293-1674320	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1097563-1097590	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1098448-1098475	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1099333-1099360	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1100218-1100245	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1799597-1799624	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	498757-498784	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1460522-1460549	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP039967	Pseudorhodobacter sp. S12M18 plasmid unnamed3, complete sequence	27919-27946	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	656396-656423	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	657281-657308	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1389308-1389335	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	116916-116943	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016588	Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence	286561-286588	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP035419	Leisingera sp. NJS204 plasmid unnamed2, complete sequence	41863-41890	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP035419	Leisingera sp. NJS204 plasmid unnamed2, complete sequence	43447-43474	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1239959-1239986	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP038236	Leisingera sp. NJS201 plasmid unnamed2, complete sequence	69371-69398	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP038236	Leisingera sp. NJS201 plasmid unnamed2, complete sequence	70954-70981	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	647415-647442	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1353109-1353136	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1353994-1354021	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1354879-1354906	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1355764-1355791	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	396819-396846	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1151185-1151212	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1152070-1152097	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1152955-1152982	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1153840-1153867	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020447	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed7, complete sequence	115256-115283	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1242313-1242340	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1949790-1949817	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1950675-1950702	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1951560-1951587	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1952445-1952472	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	311820-311847	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	591387-591414	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	88044-88071	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1481412-1481439	5	0.821
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	73682-73709	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1789979-1790006	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1789736-1789763	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1791194-1791221	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032343	Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence	630797-630824	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	589875-589902	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	591090-591117	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP012917	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence	97399-97426	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	294787-294814	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	808083-808110	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	72738-72765	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	695643-695670	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	693129-693156	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	691317-691344	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP039640	Azospirillum sp. TSH100 plasmid p1, complete sequence	39283-39310	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	843205-843232	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029359	Azospirillum sp. CFH 70021 plasmid unnamed4	94249-94276	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	352966-352993	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	MT521993	Gordonia phage RedWattleHog, complete genome	124992-125019	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	MN586040	Gordonia phage Stormageddon, complete genome	125939-125966	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	566658-566685	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_010627	Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence	24585-24612	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_018696	Paraburkholderia phenoliruptrix BR3459a plasmid pSYMBR3459, complete sequence	24588-24615	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	753905-753932	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	1203924-1203951	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525038-525065	5	0.821
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	284499-284526	5	0.821
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	520268-520292	5	0.8
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	258102-258129	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	58597-58624	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	317746-317773	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	318482-318509	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	68311-68338	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	68710-68737	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	321727-321754	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	580553-580580	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015747	Shinella sp. HZN7 plasmid pShin-11, complete sequence	14368-14395	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	35457-35484	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	644637-644664	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	2049466-2049493	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	323810-323837	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	149430-149457	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	2202793-2202820	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	322986-323013	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	332101-332128	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	319750-319777	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	318837-318864	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	323004-323031	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	337430-337457	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	321765-321792	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	335697-335724	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	383402-383429	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	314620-314647	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	337430-337457	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	321765-321792	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	337430-337457	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	613909-613936	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	314623-314650	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	337434-337461	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	321765-321792	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	321765-321792	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	321765-321792	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	23610-23637	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	161960-161987	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	19610-19637	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	298396-298423	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	314623-314650	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	332084-332111	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	332049-332076	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	326605-326632	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	324734-324761	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	320276-320303	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	314623-314650	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	337430-337457	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	335692-335719	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	314623-314650	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	314623-314650	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	321768-321795	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	335698-335725	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	306222-306249	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	120668-120695	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1077118-1077145	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	592113-592140	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	487802-487829	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	492521-492548	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	101830-101857	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1143339-1143366	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	68747-68774	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	647856-647883	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	759963-759990	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	319987-320014	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	365106-365133	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1774881-1774908	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1756940-1756967	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1756940-1756967	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1077122-1077149	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP030273	Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence	79741-79768	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP047033	Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence	73427-73454	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_009040	Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence	34036-34063	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP047039	Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence	73395-73422	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015213	Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence	117211-117238	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	180739-180766	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	107905-107932	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	107797-107824	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	108196-108223	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022542	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence	83469-83496	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP051470	Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence	6960-6987	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_011960	Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence	59336-59363	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015290	Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence	115644-115671	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	CP036421	Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence	1932-1959	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	180020-180047	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	75539-75566	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	75248-75275	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	75647-75674	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	596015-596042	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP035421	Leisingera sp. NJS204 plasmid unnamed4, complete sequence	120372-120399	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	154414-154441	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	312689-312716	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_019846	Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence	61410-61437	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1045943-1045970	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	383340-383367	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	475116-475143	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	94165-94192	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1312908-1312935	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021826	Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence	136627-136654	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP045395	Roseovarius sp. THAF27 plasmid pTHAF27_b, complete sequence	37798-37825	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021372	Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence	9872-9899	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	212653-212680	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021819	Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence	192834-192861	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	316006-316033	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	764737-764764	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	284194-284221	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010865	Marinovum algicola DG 898 plasmid pMaD10, complete sequence	51677-51704	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP010865	Marinovum algicola DG 898 plasmid pMaD10, complete sequence	10714-10741	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	116889-116916	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	142011-142038	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1217696-1217723	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	990379-990406	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1002331-1002358	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1794672-1794699	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1753355-1753382	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	228263-228290	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	659643-659670	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	338963-338990	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1618942-1618969	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	356711-356738	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP018229	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence	536087-536114	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	1105208-1105235	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	241681-241708	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_010578	Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND02, complete sequence	52986-53013	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	652702-652729	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	642510-642537	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	933774-933801	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP045413	Roseovarius sp. THAF8 plasmid pTHAF8_c, complete sequence	40738-40765	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012399	Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence	615025-615052	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1310439-1310466	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	996231-996258	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	903935-903962	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	449881-449908	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	205211-205238	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	566689-566716	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1530868-1530895	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1431301-1431328	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	666316-666343	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP024425	Paracoccus yeei strain TT13 plasmid pTT13-3, complete sequence	19768-19795	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP006372	Aureimonas sp. AU20 plasmid pAU20e, complete sequence	47117-47144	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	335713-335740	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	197544-197571	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_013857	Azospirillum sp. B510 plasmid pAB510c, complete sequence	566577-566604	6	0.786
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	134147-134174	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1790951-1790978	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP022305	Thalassococcus sp. S3 plasmid pS3B, complete sequence	24444-24471	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	568585-568612	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	614287-614314	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	23232-23259	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_012529	Deinococcus deserti VCD115 plasmid 2, complete sequence	73159-73186	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP040762	Paracoccus sp. 2251 plasmid unnamed2, complete sequence	91670-91697	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	580330-580357	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	455776-455803	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	234451-234478	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	148617-148644	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	MK291445	Paracoccus phage vB_PyeM_Pyei1, complete genome	46869-46896	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	303751-303778	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP042263	Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence	321482-321509	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	467632-467659	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP013634	Rhizobium sp. N324 plasmid pRspN324d, complete sequence	256509-256536	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	489008-489035	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	490760-490787	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	136059-136086	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	180398-180425	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP017563	Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence	452646-452673	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_011881	Pseudarthrobacter chlorophenolicus A6 plasmid pACHL02, complete sequence	109977-110004	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_LR027555	Epibacterium mobile isolate EPIB1 plasmid 3, complete sequence	2680-2707	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	95245-95272	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP015232	Epibacterium mobile F1926 plasmid unnamed2, complete sequence	53943-53970	6	0.786
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	74648-74675	6	0.786
NZ_CP051542_2	2.1\|74208\|28\|NZ_CP051542\|CRISPRCasFinder	74208-74235	28	NZ_CP034154	Rhodococcus sp. NJ-530 plasmid unnamed2, complete sequence	45041-45068	6	0.786
NZ_CP051542_3	3.2\|129500\|25\|NZ_CP051542\|CRISPRCasFinder	129500-129524	25	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1112884-1112908	6	0.76
NZ_CP051542_3	3.5\|129668\|34\|NZ_CP051542\|CRISPRCasFinder	129668-129701	34	NC_009717	Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence	188821-188854	6	0.824
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	68149-68176	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP015747	Shinella sp. HZN7 plasmid pShin-11, complete sequence	29795-29822	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1327049-1327076	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032327	Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence	121229-121256	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	119359-119386	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP021033	Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence	109100-109127	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP007798	Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence	102391-102418	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	805338-805365	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	12988-13015	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	17221-17248	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012919	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence	107635-107662	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022542	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence	118623-118650	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032344	Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence	75809-75836	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032350	Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence	141450-141477	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP031116	Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence	167096-167123	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP026928	Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609b, complete sequence	104532-104559	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NC_030917	Gordonia phage OneUp, complete genome	20102-20129	7	0.75
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP022416	Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-1, complete sequence	408060-408087	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	590118-590145	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	590847-590874	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	88124-88151	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	3691-3718	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	363506-363533	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	295170-295197	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	363936-363963	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	307044-307071	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	369941-369968	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP021126	Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence	315003-315030	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	62988-63015	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP032828	Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence	137177-137204	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP048421	Sphingomonas insulae strain KCTC 12872 plasmid unnamed3, complete sequence	118106-118133	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	16798-16825	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	MK660713	Microbacterium phage Theresita, complete genome	11130-11157	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	33523-33550	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NC_016110	Streptomyces pratensis ATCC 33331 plasmid pSFLA01, complete sequence	170895-170922	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	51415-51442	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	571669-571696	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	36659-36686	7	0.75
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	208593-208620	7	0.75
NZ_CP051542_2	2.1\|74208\|28\|NZ_CP051542\|CRISPRCasFinder	74208-74235	28	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	197624-197651	7	0.75
NZ_CP051542_3	3.3\|129548\|37\|NZ_CP051542\|CRISPRCasFinder	129548-129584	37	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	828955-828991	7	0.811
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	71692-71719	8	0.714
NZ_CP051542_1	1.2\|73992\|28\|NZ_CP051542\|CRISPRCasFinder	73992-74019	28	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	168354-168381	8	0.714
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	NZ_CP006370	Aureimonas sp. AU20 plasmid pAU20c, complete sequence	127833-127860	8	0.714
NZ_CP051542_1	1.3\|74046\|28\|NZ_CP051542\|CRISPRCasFinder	74046-74073	28	MN310541	Mycobacterium phage Jeeves, complete genome	47343-47370	8	0.714
NZ_CP051542_3	3.5\|129668\|34\|NZ_CP051542\|CRISPRCasFinder	129668-129701	34	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2143472-2143505	8	0.765
NZ_CP051542_3	3.5\|129668\|34\|NZ_CP051542\|CRISPRCasFinder	129668-129701	34	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1483830-1483863	8	0.765
NZ_CP051542_3	3.5\|129668\|34\|NZ_CP051542\|CRISPRCasFinder	129668-129701	34	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	149607-149640	10	0.706
NZ_CP051542_3	3.5\|129668\|34\|NZ_CP051542\|CRISPRCasFinder	129668-129701	34	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	51262-51295	10	0.706
NZ_CP051542_3	3.3\|129548\|37\|NZ_CP051542\|CRISPRCasFinder	129548-129584	37	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	517259-517295	12	0.676

1. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010648 (Phaeobacter piscinae strain P36 plasmid pP36_e, complete sequence) position: , mismatch: 2, identity: 0.929

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcctgcgccgccgttcaggt	Protospacer
.**********.****************

2. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 2, identity: 0.929

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgcgccgccatccaggt	Protospacer
********************.*.*****

3. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 2, identity: 0.929

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgcaccgccgtccaggt	Protospacer
**************.*******.*****

4. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.929

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccgagcccgccggtcagcg	Protospacer
 ********************.******

5. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 2, identity: 0.929

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccgagcccgccggtcagcg	Protospacer
 ********************.******

6. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgtgccgccgttcagcg	Protospacer
*************.************

7. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccagcgccgccgatcaggg	Protospacer
*********** ********* *****

8. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccagcgccgccgatcaggg	Protospacer
*********** ********* *****

9. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

10. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

11. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttcccggcgccgccgttcaggg	Protospacer
******** ** ***************

12. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

13. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgccccgccgtccagga	Protospacer
************** *******.****

14. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

15. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

16. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

17. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022424 (Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgtcgccggcgccgccgttcaggt	Protospacer
.******.*** ****************

18. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgttcatgt	Protospacer
.***** ****************** **

19. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021807 (Sinorhizobium meliloti strain T073 plasmid accessoryA, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgtttcccgcgccgccgttgagct	Protospacer
******** ************** ** *

20. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgcgccgccatccagat	Protospacer
********************.*.***.*

21. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 3, identity: 0.893

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggcaccgccgttcaggt	Protospacer
*.********* **.*************

22. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtatcgttgccgagcccgccgatcagcg	Protospacer
 ..*************************

23. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgagcccgccgatcagcc	Protospacer
 .*************************

24. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gcgtcgttgccgggcccgccgatcagcc	Protospacer
 ***********.**************

25. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022305 (Thalassococcus sp. S3 plasmid pS3B, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
cggtcgttgccgatcccgccgatcagcg	Protospacer
. *********** **************

26. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgagcccgccgatcaacg	Protospacer
 .***********************.**

27. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccggccccgccgatcagcg	Protospacer
 ***********. **************

28. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccggccccgccgatcagcg	Protospacer
 ***********. **************

29. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgtcgccgagcccgccgatcaggg	Protospacer
 ******.****************** *

30. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccggccccgccgatcagcg	Protospacer
 ***********. **************

31. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 3, identity: 0.893

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgccggccccgccgatcagcg	Protospacer
 ***********. **************

32. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013104 (Paraburkholderia caribensis strain MWAP64 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.88

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
gccgtcccggcgctcgtcgcggcgg	Protospacer
 .*******.***************

33. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_LR594691 (Variovorax sp. WDL1 plasmid 3) position: , mismatch: 3, identity: 0.88

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
gtcgtcccgacgctcctcgaggcgg	Protospacer
 ************** *** *****

34. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 3, identity: 0.88

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcccgacgctcgtcccgacgc	Protospacer
****************** **.**

35. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021083 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI2, complete sequence) position: , mismatch: 3, identity: 0.88

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcctgacgctcgccgcggcgc	Protospacer
*******.********.*******

36. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aaatcgtcgcccgcgccgccgttcaggg	Protospacer
* .****.*******************

37. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgttcagca	Protospacer
.*********** *************

38. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgccccgccgttcagca	Protospacer
*.************ ***********

39. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcaccgccggtcagga	Protospacer
.*************.****** *****

40. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtttatgg	Protospacer
* *********************.* *

41. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040761 (Paracoccus sp. 2251 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgtcgccctcgccgccgttcaggt	Protospacer
  *****.**** ***************

42. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_LR723674 (Rhizobium flavum strain YW14 plasmid 5) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgttcagca	Protospacer
.*.***********************

43. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgcccgcgccgccgtccagag	Protospacer
 *********************.***.

44. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgcccgcgccgccgtccagcg	Protospacer
 *********************.***

45. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcaccgccgctcaggc	Protospacer
.*************.******.*****.

46. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcctgcgccgccgctcaggt	Protospacer
.*.********.*********.******

47. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010614 (Phaeobacter inhibens strain P92 plasmid pP92_d, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

48. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010626 (Phaeobacter inhibens strain P51 plasmid pP51_c, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

49. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010671 (Phaeobacter inhibens strain P57 plasmid pP57_c, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

50. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

51. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

52. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032326 (Azospirillum brasilense strain MTCC4035 plasmid p5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgctccgccgtccagga	Protospacer
.************* *******.****

53. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

54. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021045 (Phaeobacter gallaeciensis strain P129 plasmid pP129_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

55. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccccggccgccgttcaggg	Protospacer
.***********  *************

56. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010678 (Phaeobacter gallaeciensis strain P75 plasmid pP75_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

57. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgccccgccgttcagca	Protospacer
*.************ ***********

58. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccggtcagga	Protospacer
.************* ****** *****

59. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

60. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgtcgcccgcgccgccgtccagcc	Protospacer
*******.**************.*** .

61. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccccggccgccgttcaggg	Protospacer
.***********  *************

62. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015747 (Shinella sp. HZN7 plasmid pShin-11, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atatcattgcccgcgccgccgttcagca	Protospacer
**.**.********************

63. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgtcgcccgtgccgccgttcagcg	Protospacer
*******.*****.************

64. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aaatcgtcgcccgcgccgccgttcaggg	Protospacer
* .****.*******************

65. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_023142 (Phaeobacter gallaeciensis DSM 26640 plasmid pGal_F69, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

66. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

67. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

68. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

69. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010789 (Phaeobacter gallaeciensis strain P63 plasmid pP63_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

70. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

71. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040763 (Paracoccus sp. 2251 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgcccgcgccgccgtaaaggc	Protospacer
 *********************  ***.

72. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040763 (Paracoccus sp. 2251 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccatacaggc	Protospacer
.*******************.* ****.

73. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcggtgcccgtgccgccgttcagcc	Protospacer
****** ******.************ .

74. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccagcgccgccgatcagcg	Protospacer
*********** ********* ****

75. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

76. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010685 (Phaeobacter piscinae strain P14 plasmid pP14_d, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

77. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aaatcgtcgcccgcgccgccgttcaggg	Protospacer
* .****.*******************

78. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgtcgcccgtgccgccgttcagcg	Protospacer
*******.*****.************

79. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

80. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

81. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010720 (Phaeobacter piscinae strain P18 plasmid pP18_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

82. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccgcgcagga	Protospacer
.********************. ****

83. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

84. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

85. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010660 (Phaeobacter piscinae strain P71 plasmid pP71_d, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

86. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

87. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

88. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcaccgccggtcagga	Protospacer
.*************.****** *****

89. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010605 (Phaeobacter inhibens strain P83 plasmid pP83_f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

90. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010744 (Phaeobacter inhibens strain P59 plasmid pP59_c, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

91. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010622 (Phaeobacter inhibens strain P30 isolate M4-3.1A plasmid pP30_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

92. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

93. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

94. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

95. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

96. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

97. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010732 (Phaeobacter inhibens strain P88 plasmid pP88_g, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

98. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

99. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

100. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

101. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

102. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

103. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

104. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

105. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010642 (Phaeobacter gallaeciensis strain P73 plasmid pP73_f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

106. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010773 (Phaeobacter piscinae strain P13 plasmid pP13_f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

107. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010655 (Phaeobacter inhibens strain P54 plasmid pP54_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

108. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

109. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

110. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

111. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

112. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

113. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

114. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

115. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgtcgcccgtgccgccgttcagcg	Protospacer
*******.*****.************

116. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcaccgccgttcaggg	Protospacer
.********** **.************

117. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010711 (Phaeobacter inhibens strain P66 plasmid pP66_f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

118. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcaccgccgttcaggg	Protospacer
.********** **.************

119. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010702 (Phaeobacter inhibens strain P24 plasmid pP24_f, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

120. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010748 (Phaeobacter inhibens strain P48 isolate M21-2.3 plasmid pP48_c, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

121. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgccccgccgttcagca	Protospacer
*.************ ***********

122. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP019311 (Phaeobacter inhibens strain DOK1-1 plasmid pDOK1-1-4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

123. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccggtcagga	Protospacer
.************* ****** *****

124. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

125. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

126. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

127. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

128. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

129. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

130. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

131. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

132. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

133. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

134. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

135. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

136. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

137. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

138. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

139. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

140. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

141. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010593 (Phaeobacter gallaeciensis strain P11 plasmid pP11_e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

142. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010739 (Phaeobacter inhibens strain P72 plasmid pP72_d, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

143. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

144. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtccaggc	Protospacer
.********** **********.****.

145. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

146. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tcgtcgttgccagcgccgccgttcagct	Protospacer
 .********* ************** *

147. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031958 (Phaeobacter sp. LSS9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

148. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

149. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

150. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcaccgccgttcaggg	Protospacer
.********** **.************

151. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccgctccgccgatcagcg	Protospacer
************** ****** ****

152. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgctccgccgatcaggc	Protospacer
.************* ****** *****.

153. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtccaggc	Protospacer
.********** **********.****.

154. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

155. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcaccgccgttcaggg	Protospacer
.********** **.************

156. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcggtgcccgcgccgccgatcaggt	Protospacer
. **** ************** ******

157. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcggtgcccgcgccgccgatcaggt	Protospacer
. **** ************** ******

158. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcggtgcccgcgccgccgatcaggt	Protospacer
. **** ************** ******

159. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcggtgcccgcgccgccgatcaggt	Protospacer
. **** ************** ******

160. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcggtgcccgcgccgccgatcaggt	Protospacer
. **** ************** ******

161. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcgtcggtgcccgcgccgccgatcaggt	Protospacer
..**** ************** ******

162. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

163. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

164. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccgcgcagga	Protospacer
.********************. ****

165. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031955 (Phaeobacter inhibens strain 2.10 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

166. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_018422 (Phaeobacter inhibens 2.10 plasmid pPGA2_71, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgttgccggcgtcgccgttcaggt	Protospacer
  ********* ***.************

167. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

168. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccggtcagga	Protospacer
.************* ****** *****

169. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

170. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

171. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcagcg	Protospacer
* ********* **************

172. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcaccgccggtcagga	Protospacer
.*************.****** *****

173. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

174. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatcagga	Protospacer
.********** ********* *****

175. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acatcgtcgcccgcgccgccgttcaggc	Protospacer
*..****.*******************.

176. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt--	CRISPR spacer
ctgtcgttgcccgcgccgccgt--agatca	Protospacer
 *********************  **.*

177. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgcgccgccgaacagga	Protospacer
*.*******************  ****

178. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgccccgccggtcagga	Protospacer
*.************ ****** *****

179. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccggtcagct	Protospacer
.********** ********* **** *

180. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021409 (Celeribacter manganoxidans strain DY25 plasmid pDY25-E, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atcgcgttgcccgcgtcgccgttcaggg	Protospacer
**  ***********.***********

181. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009112 (Rhodococcus opacus strain 1CP plasmid pR1CP1, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgtcgcccgcgccgccgtgcagat	Protospacer
 ******.************** ***.*

182. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgtgccgccgatcagga	Protospacer
* ***********.******* *****

183. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025584 (Paracoccus jeotgali strain CBA4604 plasmid pCBA4604-01, complete sequence) position: , mismatch: 4, identity: 0.857

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgcgccgccgtcgagct	Protospacer
*.********************. ** *

184. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ctgtcgttgccgaccccgccggtcagcg	Protospacer
..*********** *******.******

185. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ctgtcgttgccgaccccgccggtcagcg	Protospacer
..*********** *******.******

186. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccgatcagcc	Protospacer
 .************ ************

187. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ctgtcgttgccgaccccgccggtcagcg	Protospacer
..*********** *******.******

188. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgatgccgccgatcagcg	Protospacer
 .***********  *************

189. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
cggtcgttgccggccccgccgatcagcg	Protospacer
. **********. **************

190. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015420 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagacggtgccgagcccgccgatcagcg	Protospacer
  * ** *********************

191. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tcgtcgtcgccgaggccgccgatcagaa	Protospacer
*******.****** *********** .

192. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020385 (Rhodovulum sp. MB263 plasmid pRSMBA, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagacggtgccgagcccgccgatcagcg	Protospacer
  * ** *********************

193. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagtcggtgccgaggccgccgatcagcg	Protospacer
  **** ******* *************

194. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_AP014801 (Rhodovulum sulfidophilum plasmid Plasmid1 DNA, complete genome, strain: DSM 2351) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagacggtgccgagcccgccgatcagcg	Protospacer
  * ** *********************

195. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcgttgccgagtccgccgttcagct	Protospacer
*.************.****** *****

196. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcgttgccgagtccgccgttcagct	Protospacer
*.************.****** *****

197. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcgttgccgagtccgccgttcagct	Protospacer
*.************.****** *****

198. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcgttgccgagtccgccgttcagct	Protospacer
*.************.****** *****

199. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acatcgttgccggccccgccgatcagcg	Protospacer
 *.*********. **************

200. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015065 (Mesorhizobium ciceri biovar biserrulae strain WSM1284 plasmid pMc1284, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tagatgttgccgagcccgccgatgagcg	Protospacer
* * .****************** ****

201. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 4, identity: 0.857

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tagatgttgccgagcccgccgatgagcg	Protospacer
* * .****************** ****

202. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ggcatcccgacgatcgtcgcggcgg	Protospacer
  *.******** ************

203. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
atcgtcgcggcgctcgtcgcggcgc	Protospacer
 ***** **.**************

204. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcccgccgctcgtcacggcca	Protospacer
********* ********.**** .

205. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
gccgtccccgcgctcgtcgcggcgg	Protospacer
 .****** .***************

206. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to MK937599 (Gordonia phage Dmitri, complete genome) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ttcgtccagacgctggtcgcggcga	Protospacer
.****** ****** *********.

207. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to AF440695 (Virus PhiCh1, complete genome) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcccgacggtcgtcgcgatcg	Protospacer
************ ********.. *

208. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NC_004084 (Natrialba phage PhiCh1, complete genome) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcccgacggtcgtcgcgatcg	Protospacer
************ ********.. *

209. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to LR535912 (XXX) position: , mismatch: 4, identity: 0.84

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
ctcgtcgcgacgctggtcgcggcca	Protospacer
****** ******* ******** .

210. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010648 (Phaeobacter piscinae strain P36 plasmid pP36_e, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcaccgccgttgatga	Protospacer
* ************.******** * *

211. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP051471 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10B, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

212. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP030274 (Rhodobacter sphaeroides 2.4.1 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

213. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccggtcagcg	Protospacer
.************* ****** ****

214. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgatcagca	Protospacer
.*********** ******** ****

215. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgttgatgg	Protospacer
* ************ ******** * *

216. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015215 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid d, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

217. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047034 (Rhodobacter sphaeroides strain DSM 158 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

218. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015291 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid c, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

219. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP047040 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pB, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

220. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022424 (Vitreoscilla filiformis strain ATCC 15551 plasmid pVF1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgtgccgccgtccagcg	Protospacer
.************.********.***

221. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgcggcccgcgccgccgttcagcc	Protospacer
.*****. ****************** .

222. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_011962 (Rhodobacter sphaeroides KD131 plasmid pRSKD131A, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgcgccgccgtcgagcg	Protospacer
* ********************. **

223. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgcccgcaccgccgtccagcg	Protospacer
 *************.*******.***

224. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgcccgtgccgccgtccagca	Protospacer
 ************.********.***

225. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

226. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgttcatca	Protospacer
.********** *************

227. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccggtcagac	Protospacer
.************* ****** ****..

228. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggcgccgccgtccagcg	Protospacer
*.********* **********.***

229. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040763 (Paracoccus sp. 2251 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcattgcccgcgccgccggtcagcg	Protospacer
*.***.*************** ****

230. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccggtgatga	Protospacer
*********** ********* * * *

231. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_021911 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccggtgatga	Protospacer
*********** ********* * * *

232. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

233. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

234. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

235. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

236. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccgacgagga	Protospacer
*********** ********* . ***

237. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgctcagca	Protospacer
.*********** ********.****

238. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tcgtcgttgcccgccccgccggtcagga	Protospacer
 .************ ****** *****

239. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgatcagca	Protospacer
.*********** ******** ****

240. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgctcagca	Protospacer
.*********** ********.****

241. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccgtcgccgccgttcagcg	Protospacer
* *********  *************

242. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccgtcgccgccgttcagcg	Protospacer
* *********  *************

243. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

244. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

245. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

246. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

247. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

248. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

249. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

250. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

251. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

252. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

253. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

254. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

255. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccggtcagag	Protospacer
.********** ********* ****.

256. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

257. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

258. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccgacgagga	Protospacer
*********** ********* . ***

259. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

260. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

261. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

262. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

263. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

264. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

265. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

266. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

267. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

268. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

269. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

270. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccggtcagag	Protospacer
.********** ********* ****.

271. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

272. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

273. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccgacgagga	Protospacer
*********** ********* . ***

274. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

275. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

276. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

277. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

278. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

279. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

280. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

281. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

282. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

283. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

284. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccgacgagga	Protospacer
*********** ********* . ***

285. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt--	CRISPR spacer
gtgtcgatgcccgcgccgccgtc--ggtca	Protospacer
.***** ***************.  ***

286. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP034347 (Roseovarius sp. MME-070 plasmid pMME07001, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgctgcccgcgccgccgttcagca	Protospacer
  ****.*******************

287. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcaccgccgatcagtg	Protospacer
.*************.****** ****

288. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtccagca	Protospacer
.********** **********.***

289. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtccagca	Protospacer
.********** **********.***

290. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgctccgccgatcagtg	Protospacer
.************* ****** ****

291. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgctcagcg	Protospacer
.************* ******.****

292. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

293. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

294. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtccagcc	Protospacer
.********** **********.*** .

295. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgacccgccgttcatgc	Protospacer
.************  ********** *.

296. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

297. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

298. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

299. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgccggcgccgccgacgagga	Protospacer
*********** ********* . ***

300. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgctcagca	Protospacer
.*********** ********.****

301. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgatcagca	Protospacer
.*********** ******** ****

302. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tcgtcgttgcccgccccgccggtcagga	Protospacer
 .************ ****** *****

303. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccgtcgccgccgttcagcg	Protospacer
* *********  *************

304. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcgttgcccccgccgccgcggagga	Protospacer
************ ********.  ***

305. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

306. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtttcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

307. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

308. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

309. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtttcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

310. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

311. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

312. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

313. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

314. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

315. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_010580 (Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND01, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
atgtcattgcccgcgccgccgttgatca	Protospacer
*****.***************** *

316. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgctgcccgcgccgccggtcagcg	Protospacer
 *****.************** ****

317. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgtcgcccgcgccgccgtgcaact	Protospacer
* *****.************** **. *

318. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033323 (Azospirillum brasilense strain Cd plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccgccgccgccgttcagcg	Protospacer
.**********  *************

319. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

320. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033317 (Azospirillum brasilense strain Sp 7 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccgccgccgccgttcagcg	Protospacer
.**********  *************

321. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggtgccgccgttcagcg	Protospacer
.********** *.************

322. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccgccgaggc	Protospacer
.********************.. ***.

323. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccctcgccgccgctcagca	Protospacer
.*********** ********.****

324. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgtcgccggtcagca	Protospacer
.**************.***** ****

325. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcaccgccggtcagga	Protospacer
.*.***********.****** *****

326. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgccccgccggtcagcg	Protospacer
*.************ ****** ****

327. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032348 (Azospirillum brasilense strain MTCC4039 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccgtcgccgccgttcagcg	Protospacer
* *********  *************

328. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccgccgccgccgttcagcg	Protospacer
.**********  *************

329. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022542 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccagcgttcagca	Protospacer
.****************. *******

330. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

331. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

332. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgctcagcc	Protospacer
.********** *********.**** .

333. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP017947 (Bosea sp. Tri-49 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tggtcgtcgcccgcgccgccgtgcagga	Protospacer
  *****.************** ****

334. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccgccgccgccgttcagcc	Protospacer
.**********  ************* .

335. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040760 (Paracoccus sp. 2251 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgttcaacc	Protospacer
* ********* *************. .

336. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggcgccgccgatcagca	Protospacer
*.********* ********* ****

337. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP019083 (Paludisphaera borealis strain PX4 plasmid PALBO1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ttgtagttgcccgcgccgccggtcagcg	Protospacer
 *** **************** ****

338. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgcccgcgccgccgatcatta	Protospacer
*.******************* ***

339. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccggtcagag	Protospacer
.********** ********* ****.

340. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccgccgccgccgttcagcg	Protospacer
.**********  *************

341. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP035421 (Leisingera sp. NJS204 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt--	CRISPR spacer
gtgtcgatgcccgcgccgccgtc--ggtca	Protospacer
.***** ***************.  ***

342. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

343. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

344. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

345. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcccgccccgccgctcagcg	Protospacer
* ************ ******.****

346. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

347. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

348. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

349. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

350. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

351. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

352. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

353. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

354. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

355. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

356. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

357. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

358. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

359. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

360. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

361. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

362. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039967 (Pseudorhodobacter sp. S12M18 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aagtcattgcccgcgccgccgatcagcg	Protospacer
* ***.*************** ****

363. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

364. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

365. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

366. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggcgccgccggtcagcc	Protospacer
*.********* ********* **** .

367. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016588 (Azospirillum lipoferum 4B plasmid AZO_p6, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcggtgcccgcgccgccggtcagcg	Protospacer
*.**** ************** ****

368. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP035419 (Leisingera sp. NJS204 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccagcgccgcccttcagcg	Protospacer
* ********* ******** *****

369. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP035419 (Leisingera sp. NJS204 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccagcgccgcccttcagcg	Protospacer
* ********* ******** *****

370. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

371. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038236 (Leisingera sp. NJS201 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccagcgccgcccttcagcg	Protospacer
* ********* ******** *****

372. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038236 (Leisingera sp. NJS201 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccagcgccgcccttcagcg	Protospacer
* ********* ******** *****

373. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

374. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

375. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

376. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

377. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

378. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

379. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtttcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

380. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

381. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

382. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

383. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020447 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed7, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccgccgtccagca	Protospacer
* ********* **********.***

384. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

385. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcaccgccgatcagga	Protospacer
.* ***********.****** *****

386. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

387. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

388. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtctcgttgcccgcgccaccgatcagga	Protospacer
.* **************.*** *****

389. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgccggcgccgccgatcaggc	Protospacer
.*.******** ********* *****.

390. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgtcgagga	Protospacer
.*.*******************. ***

391. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
acgtcgttgccggccccgccgttcagca	Protospacer
*.********* ** ***********

392. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgccggcgccggcgttcagcg	Protospacer
* ********* ****** *******

393. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgtgccgccgtcgagat	Protospacer
.************.********. **.*

394. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccgatcaggc	Protospacer
 .************ ***********

395. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgtcgccgaggccgccgatcagcc	Protospacer
 .*****.****** ************

396. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgagaccgccgatgagcc	Protospacer
 .************ ******** ***

397. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032343 (Azospirillum brasilense strain MTCC4038 plasmid p4, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtatcgttgccgaccccgccggtcagcg	Protospacer
 ..********** *******.******

398. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccaccgatcagcc	Protospacer
 .************ **.*********

399. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccaatcagcc	Protospacer
 .************ *****.******

400. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012917 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p3, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtatcgttgccgaccccgccggtcagcg	Protospacer
 ..********** *******.******

401. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
cgatcgttgcccagcccgccgaacagcg	Protospacer
. .******** ********** *****

402. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 5, identity: 0.821

----tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagatcg----tgccgaccccgccgatcagcg	Protospacer
    ***    ****** **************

403. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgcggccgccgatcagca	Protospacer
 .********** * ************.

404. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgcggccgccgatcagca	Protospacer
 .********** * ************.

405. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgcggccgccgatcagca	Protospacer
 .********** * ************.

406. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgcggccgccgatcagca	Protospacer
 .********** * ************.

407. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039640 (Azospirillum sp. TSH100 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgagcccgccgtccagcc	Protospacer
 .******************* .****

408. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttcccgttggcgaacccgccgatcagcg	Protospacer
*. .***** ***.**************

409. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029359 (Azospirillum sp. CFH 70021 plasmid unnamed4) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtccttgccgaccccgccgatcagcc	Protospacer
 .*** ******* *************

410. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atgtcgttgccgcggccgccgatcagca	Protospacer
 .********** * ************.

411. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to MT521993 (Gordonia phage RedWattleHog, complete genome) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagacgttgccgagcacgtcgatcagcg	Protospacer
  * *********** **.*********

412. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gagacgttgccgagcacgtcgatcagcg	Protospacer
  * *********** **.*********

413. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ctgtcgtcgcccagcccgccgatcaggg	Protospacer
..*****.*** ************** *

414. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_010627 (Paraburkholderia phymatum STM815 plasmid pBPHY02, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tcgtcgttgccgagatcgccgatatgct	Protospacer
************** .*******  **

415. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_018696 (Paraburkholderia phenoliruptrix BR3459a plasmid pSYMBR3459, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tcgtcgttgccgagatcgccgatatgct	Protospacer
************** .*******  **

416. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgccgatgccgagaccgccgatcagcc	Protospacer
*.*.** ******* ************

417. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg-	CRISPR spacer
cggtcgttgcccagcccgccgat-accgc	Protospacer
. ********* *********** * **

418. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcattgccgagcccgccggtcatct	Protospacer
*.***.***************.*** *

419. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.821

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgccgatgccgagaccgccgatcagcc	Protospacer
*.*.** ******* ************

420. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.8

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
gggatcccgatgctcgtcgcggcgg	Protospacer
   .******.**************

421. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcatccttgccggcgccgccgttcaggc	Protospacer
...** ***** ***************.

422. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgcctccgtccagca	Protospacer
.*.************** ****.***

423. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
agatcgttgcccgcgccgccggccagcg	Protospacer
* .****************** .***

424. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

425. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgagca	Protospacer
.********** **********. **

426. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

427. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

428. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgccggcgccgccgatcagcg	Protospacer
  ********* ********* ****

429. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015747 (Shinella sp. HZN7 plasmid pShin-11, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgtcgcccgcgccgcctttcaccg	Protospacer
.******.************ ****

430. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcatccttgccggcgccgccgttcaggc	Protospacer
...** ***** ***************.

431. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

432. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

433. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

434. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcatccttgccggcgccgccgttcaggc	Protospacer
...** ***** ***************.

435. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

436. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

437. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

438. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

439. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

440. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

441. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

442. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

443. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

444. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

445. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

446. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

447. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

448. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

449. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

450. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

451. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

452. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtccgcga	Protospacer
.************* *******.*. *

453. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

454. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

455. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

456. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

457. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

458. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

459. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtccgcga	Protospacer
.************* *******.*. *

460. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcatccttgccggcgccgccgttcaggc	Protospacer
...** ***** ***************.

461. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aaatcgtcgcccgcgccgccattcagag	Protospacer
* .****.************.*****.

462. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgcctccgtccagca	Protospacer
.*.************** ****.***

463. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

464. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

465. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

466. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

467. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

468. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

469. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

470. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

471. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

472. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

473. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

474. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

475. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

476. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

477. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

478. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

479. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

480. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

481. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

482. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

483. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccggtgagcg	Protospacer
.*.****************** * **

484. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcaagcg	Protospacer
.********** **********. **

485. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgccggcgccgccgtccagaa	Protospacer
.*.******** **********.***.

486. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

487. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

488. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

489. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

490. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

491. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

492. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

493. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

494. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

495. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

496. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

497. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP030273 (Rhodobacter sphaeroides 2.4.1 plasmid pA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

498. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP047033 (Rhodobacter sphaeroides strain DSM 158 plasmid pEA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

499. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_009040 (Rhodobacter sphaeroides ATCC 17029 plasmid pRSPH01, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

500. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP047039 (Rhodobacter sphaeroides strain 2.4.1 substr. H2 plasmid pEA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

501. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015213 (Rhodobacter sphaeroides strain MBTLJ-13 plasmid b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

502. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgtcgcccgcgccgccgtcgacgg	Protospacer
 ******.**************. * *

503. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccattcatca	Protospacer
.********** ********.****

504. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgagca	Protospacer
.********** **********. **

505. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

506. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022542 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccctccagca	Protospacer
.*.***************** *.***

507. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP051470 (Rhodobacter sphaeroides strain CH10 plasmid pRspCH10A, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

508. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_011960 (Rhodobacter sphaeroides KD131 plasmid pRSKD131B, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgaccagca	Protospacer
  ******************* .***

509. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015290 (Rhodobacter sphaeroides strain MBTLJ-20 plasmid b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcgttgcccgcgccgccgagcagca	Protospacer
  *******************  ***

510. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to CP036421 (Rhodobacter sphaeroides strain HJ plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
agatcgttgccggagccgccgttcagcc	Protospacer
* .******** * ************ .

511. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtccgcga	Protospacer
.************* *******.*. *

512. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccattcatca	Protospacer
.********** ********.****

513. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

514. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgagca	Protospacer
.********** **********. **

515. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tcgacgatgcccgcgccgccgttcagca	Protospacer
 .* ** *******************

516. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP035421 (Leisingera sp. NJS204 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cggtcattgcccgcgccgccgtccagcg	Protospacer
  ***.****************.***

517. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

518. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

519. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_019846 (Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gggtcgttgcccgcgccgccgtcgattt	Protospacer
. ********************. *  *

520. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

521. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

522. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

523. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

524. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

525. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021826 (Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gggtcgttgcccgcgccgccgtcgattt	Protospacer
. ********************. *  *

526. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP045395 (Roseovarius sp. THAF27 plasmid pTHAF27_b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tggtcgctgcccgcgccgccgatcagcg	Protospacer
  ****.************** ****

527. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021372 (Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tagtcgttgccggcgccgccgtacagca	Protospacer
  ********* ********** ***

528. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

529. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021819 (Sinorhizobium meliloti strain M162 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gggtcgttgcccgcgccgccgtcgattt	Protospacer
. ********************. *  *

530. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

531. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

532. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

533. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010865 (Marinovum algicola DG 898 plasmid pMaD10, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcattgccggcgccgccgttcagca	Protospacer
. ***.***** **************

534. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP010865 (Marinovum algicola DG 898 plasmid pMaD10, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ctgtcgttgccggcgccgccgtcgatga	Protospacer
 ********** **********. * *

535. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgtcgccggcgccgccgttcagcc	Protospacer
  *****.*** ************** .

536. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcga	Protospacer
.********** ********* **  *

537. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

538. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

539. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

540. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aggtcgttgcgcgcgccgcctttcacaa	Protospacer
* ******** ********* **** .

541. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

542. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ttgtcgttgcccgcgccgccggtgatcg	Protospacer
 ******************** * *

543. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

544. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

545. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

546. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tcgtcgttgccctcgccgccgtacagcg	Protospacer
 .********** ********* ***

547. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP018229 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgtcgcccgcgccgccgatcatcg	Protospacer
.******.************* ***

548. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

549. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

550. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_010578 (Beijerinckia indica subsp. indica ATCC 9039 plasmid pBIND02, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ccagcgtggcccgcgccgccgatcaggt	Protospacer
 .. *** ************* ******

551. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

552. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

553. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgccgccgatgagcg	Protospacer
.*.****************** * **

554. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP045413 (Roseovarius sp. THAF8 plasmid pTHAF8_c, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tggtcgctgcccgcgccgccgatcagcg	Protospacer
  ****.************** ****

555. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012399 (Chelatococcus sp. CO-6 plasmid pCO-6, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
cagtcgtcgccggcgccgccgttcagcg	Protospacer
  *****.*** **************

556. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

557. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

558. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

559. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gagtcgttgcccgcgccgccttccatgg	Protospacer
. ****************** *.** *

560. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gggtcgttgcccgcgccgccgtcgattt	Protospacer
. ********************. *  *

561. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

562. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtcgaaga	Protospacer
.************* *******. *.*

563. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

564. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgctgccggcgccgccgttcaatc	Protospacer
.*****.**** *************. .

565. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024425 (Paracoccus yeei strain TT13 plasmid pTT13-3, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcgttgcccgcgcctccgtccagca	Protospacer
.*.************** ****.***

566. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP006372 (Aureimonas sp. AU20 plasmid pAU20e, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
ttatcgttgcctgcgccgccggtcagta	Protospacer
 *.********.********* ****

567. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtatcattgcccgcgccgcccttcagaa	Protospacer
.*.**.************** *****.

568. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgatgg	Protospacer
.********** **********. * *

569. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_013857 (Azospirillum sp. B510 plasmid pAB510c, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgatgg	Protospacer
.********** **********. * *

570. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
aagtcgttgccggcgccgccgttgatcg	Protospacer
* ********* *********** *

571. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccaatcaggc	Protospacer
 .************ *****.*****

572. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022305 (Thalassococcus sp. S3 plasmid pS3B, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccggccccgccgatcaggc	Protospacer
 .**********. ************

573. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
cggccgatgccgaccccgccgatcagca	Protospacer
. *.** ****** *************.

574. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccggccccgccgatcacgg	Protospacer
 .**********. ***********  *

575. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccggccccgccgatcacgg	Protospacer
 .**********. ***********  *

576. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_012529 (Deinococcus deserti VCD115 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gaagcgttgccgagcccgccgagcagca	Protospacer
  . ****************** ****.

577. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP040762 (Paracoccus sp. 2251 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgcgcccgccgaacaggt	Protospacer
 .********** ********* ***

578. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gcgacgttgccgagcccgccgagcacga	Protospacer
 ** ****************** **  .

579. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgtcgccaagcccgccgatcaggc	Protospacer
 .*****.***.**************

580. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgtcgccaagcccgccgatcaggc	Protospacer
 .*****.***.**************

581. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgtcgcccagcccgccgatcaggc	Protospacer
 .*****.*** **************

582. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to MK291445 (Paracoccus phage vB_PyeM_Pyei1, complete genome) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgcgcccaccgatcagga	Protospacer
 .********** ****.******** .

583. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagcccatgccgagcccgccgatcagca	Protospacer
  *.*  ********************.

584. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP042263 (Litoreibacter sp. LN3S51 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ttgtcgttgccgagcctgccgatccagt	Protospacer
*.**************.******* .

585. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagcccatgccgagcccgccgatcagca	Protospacer
  *.*  ********************.

586. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP013634 (Rhizobium sp. N324 plasmid pRspN324d, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagcccatgccgagcccgccgatcagca	Protospacer
  *.*  ********************.

587. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagtcgttgcccaccccgccgatcaagg	Protospacer
  ********* * ***********. *

588. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagtcgttgcccaccccgccgatcaagg	Protospacer
  ********* * ***********. *

589. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aagcccatgccgagcccgccgatcagca	Protospacer
  *.*  ********************.

590. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccggccccgccgatcacgg	Protospacer
 .**********. ***********  *

591. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP017563 (Paraburkholderia sprentiae WSM5005 plasmid pl1WSM5005, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ctgcccatgccgagcacgccgatcagcg	Protospacer
..*.*  ******** ************

592. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_011881 (Pseudarthrobacter chlorophenolicus A6 plasmid pACHL02, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
cctgcgttgccgaacccgccgatcatca	Protospacer
.*  *********.*********** *.

593. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_LR027555 (Epibacterium mobile isolate EPIB1 plasmid 3, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gggtcgttgccgcgcccgtcgatcacgg	Protospacer
  ********** *****.******  *

594. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gcggcgttgccgatcccgccgatcctag	Protospacer
 ** ********* **********   *

595. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015232 (Epibacterium mobile F1926 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gggtcgttgccgcgcccgtcgatcacgg	Protospacer
  ********** *****.******  *

596. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtatcgttgccgcgtccgccgatcaggg	Protospacer
 ..********* *.*********** *

597. spacer 2.1|74208|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP034154 (Rhodococcus sp. NJ-530 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

gtgtcggacccggtccccgagcggatcg	CRISPR spacer
ttgtcgaacacggtccccgagcgggcgg	Protospacer
 *****.** **************.. *

598. spacer 3.2|129500|25|NZ_CP051542|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.76

ctcgtcccgacgctcgtcgcggcgg	CRISPR spacer
gcagtcccgacgctcgtcgcgggct	Protospacer
 . *******************

599. spacer 3.5|129668|34|NZ_CP051542|CRISPRCasFinder matches to NC_009717 (Xanthobacter autotrophicus Py2 plasmid pXAUT01, complete sequence) position: , mismatch: 6, identity: 0.824

gcggtcgtcgccacggcggtcgtcgctggcgcgc-	CRISPR spacer
gcggtcgtcgccacggcgatcgtcgc-gattcgtt	Protospacer
******************.******* *.. **.

600. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

601. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP015747 (Shinella sp. HZN7 plasmid pShin-11, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccagcgccgccgtaaaccg	Protospacer
.********** **********  *

602. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccaccgtcgatca	Protospacer
.****************.****. *

603. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032327 (Azospirillum brasilense strain MTCC4035 plasmid p6, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

604. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgatgcccgcgccgccgtcgattg	Protospacer
.***** ***************. *

605. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021033 (Rhizobium sp. NXC14 plasmid pRspNXC14c, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccaccgttcgcag	Protospacer
.********** *****.******. .

606. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP007798 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p5, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

607. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccaccgtcgatca	Protospacer
.****************.****. *

608. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gcatcgttgcccgcgccgccgcgcagca	Protospacer
...******************. ***

609. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgagccgccgtagaccg	Protospacer
.************ ********  *

610. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012919 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p5, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

611. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022542 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-2, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccggcgataa	Protospacer
.******************** . * .

612. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032344 (Azospirillum brasilense strain MTCC4038 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

613. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032350 (Azospirillum brasilense strain MTCC4039 plasmid p5, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgatctcca	Protospacer
.********** ********* **

614. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031116 (Rubrobacter indicoceani strain SCSIO 08198 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgcgccgccgagtatcg	Protospacer
.********************  .*

615. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP026928 (Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609b, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgtgccgccgtcgatcc	Protospacer
.************.********. *  .

616. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NC_030917 (Gordonia phage OneUp, complete genome) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
tctgcgctgcccgagccgccgttcaggg	Protospacer
 .  **.****** *************

617. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP022416 (Sulfitobacter pseudonitzschiae strain SMR1 plasmid pSMR1-1, complete sequence) position: , mismatch: 7, identity: 0.75

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgccggcgccgccgtcgacag	Protospacer
.********** **********. * .

618. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccaatcaagc	Protospacer
 .************ *****.****.

619. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
gtgtcgttgccgaggccgccaatcaagc	Protospacer
 .************ *****.****.

620. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

621. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

622. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

623. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

624. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

625. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

626. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

627. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP021126 (Rhizobium sp. Kim5 plasmid pRetKim5b, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

628. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaacccatgccgagcccgccgatcagca	Protospacer
  ..*  ********************.

629. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032828 (Sphingomonas sp. YZ-8 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
catcccatgccgatcccgccgatcagcg	Protospacer
.  .*  ****** **************

630. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP048421 (Sphingomonas insulae strain KCTC 12872 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ggagcgtagccgagctcgccgatcagcc	Protospacer
  . *** *******.***********

631. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ccgtcgatgccgagcccgccgactgcca	Protospacer
.***** ***************... *.

632. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to MK660713 (Microbacterium phage Theresita, complete genome) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
acgtcgttgacgaacccgccgatcttgc	Protospacer
 ******** ***.**********

633. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ccgtcgatgccgagcccgccgactgcca	Protospacer
.***** ***************... *.

634. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NC_016110 (Streptomyces pratensis ATCC 33331 plasmid pSFLA01, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tcgtccttgccgagcccgccggccttgc	Protospacer
***** ***************..*

635. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ccgtcgatgccgagcccgccgactgcca	Protospacer
.***** ***************... *.

636. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
aaccagttgccgaagccgccgatcagcg	Protospacer
   . ********. *************

637. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
ccgtcgatgccgagcccgccgactgcca	Protospacer
.***** ***************... *.

638. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.75

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
tcgtccttgccgagcccgccggccttgc	Protospacer
***** ***************..*

639. spacer 2.1|74208|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

gtgtcggacccggtccccgagcggatcg	CRISPR spacer
tacaccaacccgatccccgagcggatcg	Protospacer
    * .*****.***************

640. spacer 3.3|129548|37|NZ_CP051542|CRISPRCasFinder matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.811

atcctcgcggcggtcgccgttgcggtc--cgccgcgcgg	CRISPR spacer
gtcctcgcggcggtagccgctgcggtcgtagccgggc--	Protospacer
.************* ****.*******   **** **

641. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.714

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtcggcca	Protospacer
.************* *******. .

642. spacer 1.2|73992|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 8, identity: 0.714

atgtcgttgcccgcgccgccgttcaggt	CRISPR spacer
gtgtcgttgcccgccccgccgtcggcca	Protospacer
.************* *******. .

643. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to NZ_CP006370 (Aureimonas sp. AU20 plasmid pAU20c, complete sequence) position: , mismatch: 8, identity: 0.714

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
agcccgttggcgagcccgccgatcaagc	Protospacer
   .***** ***************.

644. spacer 1.3|74046|28|NZ_CP051542|CRISPRCasFinder matches to MN310541 (Mycobacterium phage Jeeves, complete genome) position: , mismatch: 8, identity: 0.714

tcgtcgttgccgagcccgccgatcagcg	CRISPR spacer
atctcgttgccgagcccgtcgatcttgc	Protospacer
 . ***************.*****

645. spacer 3.5|129668|34|NZ_CP051542|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.765

gcggtcgtcgccacggcggtcgtcgctggcgcgc	CRISPR spacer
acccccggggccacgacggtcgtcgccggcgcgc	Protospacer
.*  .**  ******.**********.*******

646. spacer 3.5|129668|34|NZ_CP051542|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 8, identity: 0.765

gcggtcgtcgccacggcggtcgtcgctggcgcgc	CRISPR spacer
acccccggggccacgacggtcgtcgccggcgcgc	Protospacer
.*  .**  ******.**********.*******

647. spacer 3.5|129668|34|NZ_CP051542|CRISPRCasFinder matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 10, identity: 0.706

gcggtcgtcgccacggcggtcgtcgctggcgcgc	CRISPR spacer
acggtcgtcgcaacggccgtcgtcgcagcgatat	Protospacer
.********** ***** ******** *  ....

648. spacer 3.5|129668|34|NZ_CP051542|CRISPRCasFinder matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.706

gcggtcgtcgccacggcggtcgtcgctggcgcgc	CRISPR spacer
acggtcgtcggcacggcggtcggcgtgttcatcc	Protospacer
.********* *********** **.   *.. *

649. spacer 3.3|129548|37|NZ_CP051542|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 12, identity: 0.676

atcctcgcggcggtcgccgttgcggtccgccgcgcgg	CRISPR spacer
gctgaccgcgccgtcgccgttgcggtcggccgcgcct	Protospacer
...  *   ** *************** *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3724

Acidithiobacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781934.1\|994_1282_+	hypothetical protein	K4I011	Acidithiobacillus_phage	5.8e-12	52.6
WP_168781935.1\|1442_2117_+	DUF882 domain-containing protein	A0A0K1LLY2	Rhodobacter_phage	2.1e-44	47.7
WP_155046267.1\|2113_2371_+	hypothetical protein	NA	NA	NA	NA
WP_168781936.1\|2534_3724_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7

DBSCAN-SWA_2

8934 : 13725

Cronobacter_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781942.1\|8934_11829_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.5e-123	39.9
WP_168781943.1\|11892_13725_-\|protease	ATP-dependent zinc metalloprotease FtsH	M4QMW8	Micromonas_pusilla_virus	4.5e-105	43.4

DBSCAN-SWA_3

17609 : 24393

Stx2-converting_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781947.1\|17609_19109_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_036705738.1\|19167_19515_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.8e-36	60.7
WP_036712921.1\|19511_19907_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168781948.1\|20662_21139_+	hypothetical protein	NA	NA	NA	NA
WP_036704221.1\|21799_22006_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	5.1e-10	44.3
WP_168781949.1\|22443_24393_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	5.1e-115	37.1

DBSCAN-SWA_4

31428 : 36295

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781954.1\|31428_33186_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	34.5
WP_168781955.1\|33207_34428_+	glycosyltransferase	NA	NA	NA	NA
WP_168781956.1\|34435_36295_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-23	38.7

DBSCAN-SWA_5

42747 : 43839

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783750.1\|42747_43839_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-23	37.7

DBSCAN-SWA_6

50373 : 51285

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781961.1\|50373_51285_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	5.4e-11	25.5

DBSCAN-SWA_7

64961 : 68970

uncultured_Mediterranean_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700706.1\|64961_65294_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	3.1e-17	48.3
WP_168781971.1\|65306_66971_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_036700704.1\|66983_67979_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.2e-43	37.5
WP_168781972.1\|67978_68332_+	hypothetical protein	NA	NA	NA	NA
WP_168783752.1\|68340_68970_+	heme ABC exporter ATP-binding protein CcmA	G9BWD6	Planktothrix_phage	4.0e-05	28.9

DBSCAN-SWA_8

82319 : 85810

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781981.1\|82319_84758_-	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	1.6e-113	37.6
WP_168781982.1\|84802_85810_-	TerC family protein	K7QKE8	Escherichia_phage	8.0e-40	33.6

DBSCAN-SWA_9

90297 : 100305

Bodo_saltans_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781986.1\|90297_93264_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	3.4e-54	23.3
WP_168781987.1\|93267_93630_+	hypothetical protein	NA	NA	NA	NA
WP_036704172.1\|94562_94925_+	cell division protein ZapA	NA	NA	NA	NA
WP_168781988.1\|95007_95925_+	Ku protein	NA	NA	NA	NA
WP_168781989.1\|95931_98349_+	DNA ligase D	A0A068CDF3	Rhizobium_phage	5.8e-44	39.9
WP_168781990.1\|98345_98801_-\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
WP_168781991.1\|98797_99211_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_168781992.1\|99207_99636_-	YeeE/YedE family protein	NA	NA	NA	NA
WP_036704164.1\|99713_99941_-	hypothetical protein	NA	NA	NA	NA
WP_036704162.1\|100056_100305_+	DUF2312 domain-containing protein	A0A1X9HX62	Ruegeria_phage	3.3e-27	78.8

DBSCAN-SWA_10

105179 : 105842

Vibrio_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052172101.1\|105179_105842_+	ParA family protein	A2I303	Vibrio_virus	3.7e-17	31.6

DBSCAN-SWA_11

123391 : 131065

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703565.1\|123391_124177_-	ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA	G9BWD6	Planktothrix_phage	7.2e-28	35.4
WP_168782007.1\|124267_125650_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_168782008.1\|125791_126958_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.6e-100	50.1
WP_168782009.1\|127044_128658_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_168782010.1\|128680_131065_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.8e-51	33.6

DBSCAN-SWA_12

136295 : 144553

uncultured_Mediterranean_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783755.1\|136295_137336_+	beta-N-acetylhexosaminidase	A0A1B1IVS3	uncultured_Mediterranean_phage	8.6e-13	40.9
WP_168782014.1\|137339_138032_-	HAD hydrolase-like protein	NA	NA	NA	NA
WP_168783756.1\|138131_139544_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	2.8e-22	30.9
WP_168782015.1\|139547_141365_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1HVL7	Paramecium_bursaria_Chlorella_virus	1.4e-98	37.3
WP_168782016.1\|141544_142243_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_168782017.1\|143094_143796_-	urea ABC transporter ATP-binding subunit UrtE	W5SAS9	Pithovirus	6.9e-14	28.7
WP_168782018.1\|143812_144553_-	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	6.2e-05	23.3

DBSCAN-SWA_13

152012 : 156102

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783758.1\|152012_153566_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	3.5e-58	35.9
WP_168782022.1\|153643_154267_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_168782023.1\|154497_156102_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.8e-17	63.9

DBSCAN-SWA_14

159135 : 159996

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782027.1\|159135_159996_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.8e-32	35.4

DBSCAN-SWA_15

166409 : 170319

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036710158.1\|166409_166895_+	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	2.8e-22	40.3
WP_168782033.1\|167011_167521_-	thioesterase	NA	NA	NA	NA
WP_168782034.1\|167517_168117_-	recombination protein RecR	NA	NA	NA	NA
WP_036734060.1\|168134_168476_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_168782035.1\|168501_170319_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	7.2e-39	37.5

DBSCAN-SWA_16

173968 : 175504

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782039.1\|173968_175504_-	AMP-binding protein	A0A2K9KZV5	Tupanvirus	5.7e-21	23.4

DBSCAN-SWA_17

190199 : 202230

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782052.1\|190199_194819_-	LLM class flavin-dependent oxidoreductase	A0A2K9KZV5	Tupanvirus	2.2e-20	35.1
WP_168782053.1\|194815_195793_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_168782054.1\|195789_202230_-	SDR family NAD(P)-dependent oxidoreductase	D0R7J2	Paenibacillus_phage	4.6e-48	38.2

DBSCAN-SWA_18

206982 : 207360

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782058.1\|206982_207360_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.5e-34	61.9

DBSCAN-SWA_19

212638 : 213307

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036711822.1\|212638_213307_+	response regulator transcription factor	W8CYM9	Bacillus_phage	8.8e-19	31.1

DBSCAN-SWA_20

218977 : 226328

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036704323.1\|218977_219526_+	peroxiredoxin	H8ZMV3	Synechococcus_phage	8.2e-47	54.2
WP_168783761.1\|219700_220870_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052171991.1\|221079_221406_+	hypothetical protein	NA	NA	NA	NA
WP_168783762.1\|221437_223081_-	DUF853 family protein	A0A248XCZ8	Klebsiella_phage	3.6e-82	46.0
WP_168782066.1\|223778_224699_+	invasion associated locus B family protein	NA	NA	NA	NA
WP_168783763.1\|224798_226328_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.7e-26	37.1

DBSCAN-SWA_21

233357 : 233831

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782072.1\|233357_233831_+	CinA family protein	B5TK85	Pseudomonas_phage	4.6e-14	45.3

DBSCAN-SWA_22

241822 : 243802

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036702044.1\|241822_242110_+	co-chaperone GroES	A0A221S4G8	uncultured_virus	3.8e-19	53.3
WP_168782079.1\|242155_243802_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.9e-171	60.3

DBSCAN-SWA_23

260930 : 268788

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782088.1\|260930_262034_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	1.1e-26	29.7
WP_081969332.1\|262105_262894_+	molecular chaperone DjiA	NA	NA	NA	NA
WP_168782089.1\|263525_265727_-	DNA polymerase III subunit epsilon	A0A0N9SJX9	Paenibacillus_phage	7.7e-11	35.3
WP_036701953.1\|265723_266089_-	response regulator	NA	NA	NA	NA
WP_168782090.1\|266085_268788_-	histidine kinase	W8CYF6	Bacillus_phage	5.7e-24	30.3

DBSCAN-SWA_24

273132 : 278142

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052174938.1\|273132_275085_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.9e-86	40.6
WP_168782091.1\|275283_275793_+	pyridoxamine 5-phosphate oxidase	NA	NA	NA	NA
WP_036731317.1\|275850_278142_-	hypothetical protein	A0A2I7SAR4	Vibrio_phage	1.0e-05	45.9

DBSCAN-SWA_25

293266 : 296817

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782100.1\|293266_295084_+	translational GTPase TypA	A0A2K5B2A5	Erysipelothrix_phage	5.5e-23	44.7
WP_168782101.1\|295269_295863_+	hypothetical protein	NA	NA	NA	NA
WP_168782102.1\|295917_296817_-	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.4e-11	36.0

DBSCAN-SWA_26

303000 : 304431

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782104.1\|303000_304431_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.4e-44	28.4

DBSCAN-SWA_27

309567 : 311454

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703822.1\|309567_311454_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	2.3e-56	29.4

DBSCAN-SWA_28

321904 : 398415

Acidithiobacillus_phage(30.77%)

tRNA,transposase,protease,terminase,capsid,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782118.1\|321904_322840_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.8e-09	33.6
WP_168782119.1\|322860_323427_-	heme NO-binding protein	NA	NA	NA	NA
WP_168782120.1\|323485_323764_-	DUF3572 domain-containing protein	NA	NA	NA	NA
WP_168782121.1\|323888_325289_+	diguanylate cyclase	NA	NA	NA	NA
WP_168782122.1\|325788_327213_+\|tRNA	cysteine--tRNA ligase	A0A0U2SJ70	Niemeyer_virus	3.4e-36	31.8
WP_168782123.1\|327220_328834_+	citramalate synthase	NA	NA	NA	NA
WP_168783770.1\|328890_329580_+	squalene/phytoene synthase family protein	NA	NA	NA	NA
WP_168782124.1\|329684_330722_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_168782125.1\|331225_334492_-	TM0106 family RecB-like putative nuclease	NA	NA	NA	NA
WP_036700261.1\|334625_334904_-	hypothetical protein	NA	NA	NA	NA
WP_168783771.1\|336110_336704_+	hypothetical protein	NA	NA	NA	NA
WP_168783772.1\|336734_337133_-	hypothetical protein	NA	NA	NA	NA
WP_168782126.1\|337382_339194_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_168782127.1\|339856_340465_-	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
WP_036708509.1\|340606_341080_-	hypothetical protein	NA	NA	NA	NA
WP_168782128.1\|341281_343105_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
WP_168782129.1\|343853_345197_+	polyhydroxyalkanoate depolymerase	NA	NA	NA	NA
WP_168782130.1\|345285_345759_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_168782131.1\|345798_346557_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_168782132.1\|347284_347671_+	hypothetical protein	NA	NA	NA	NA
WP_168781936.1\|347686_348876_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168783773.1\|349276_349654_+	M23 family metallopeptidase	A0A2D0ZM66	Rhodococcus_phage	4.5e-20	44.9
WP_052042060.1\|350113_350734_-	cation transporter	NA	NA	NA	NA
WP_036700253.1\|351194_351632_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052042061.1\|351720_353949_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.6e-125	42.7
WP_168782133.1\|353952_354576_+	isoprenylcysteine carboxylmethyltransferase family protein	NA	NA	NA	NA
WP_036700251.1\|354572_355058_+	signal peptidase II	NA	NA	NA	NA
WP_081962575.1\|355044_355482_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_036708053.1\|355478_356138_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_131674989.1\|356147_356606_-	manganese-binding transcriptional regulator MntR	NA	NA	NA	NA
WP_036708058.1\|357927_359109_+	metal transporter	NA	NA	NA	NA
WP_036700244.1\|359337_359931_+	SCO family protein	NA	NA	NA	NA
WP_036700241.1\|359941_360400_+	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_036700237.1\|360396_361026_+	SCO family protein	NA	NA	NA	NA
WP_036732830.1\|361034_361490_+	metal-binding protein	NA	NA	NA	NA
WP_036700235.1\|361513_362029_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_036700233.1\|364388_364832_-	cytochrome c	NA	NA	NA	NA
WP_134725741.1\|364828_365185_-	hypothetical protein	NA	NA	NA	NA
WP_036708060.1\|365584_365917_+	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_036708062.1\|365954_366452_+	DUF305 domain-containing protein	NA	NA	NA	NA
WP_036708065.1\|367668_370098_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.9e-88	37.2
WP_040610800.1\|370633_371023_+	mercury transporter MerT	NA	NA	NA	NA
WP_168782134.1\|371041_371347_+	hypothetical protein	NA	NA	NA	NA
WP_168782135.1\|371351_371585_+	mercury resistance system transport protein MerF	NA	NA	NA	NA
WP_168782136.1\|371577_373014_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.2e-41	28.2
WP_040610785.1\|373064_373694_-	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	1.4e-53	53.9
WP_007426706.1\|373699_374011_-	hypothetical protein	NA	NA	NA	NA
WP_168782137.1\|374010_375024_-\|capsid	major capsid protein	K4I3Z3	Acidithiobacillus_phage	8.4e-37	32.2
WP_168782138.1\|375049_375415_-\|head	head decoration protein	A0A2H4JF15	uncultured_Caudovirales_phage	2.2e-08	42.9
WP_168782139.1\|375419_376445_-\|protease	Clp protease ClpP	S5M7Q8	Escherichia_phage	9.0e-47	53.1
WP_168782140.1\|377973_378189_-	hypothetical protein	K4HZB1	Acidithiobacillus_phage	7.2e-07	47.8
WP_168782141.1\|378192_380142_-\|terminase	phage terminase large subunit family protein	A0A2H4JIC6	uncultured_Caudovirales_phage	2.4e-210	59.7
WP_119000842.1\|380134_380719_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	6.5e-26	43.4
WP_119000841.1\|380830_381103_+	hypothetical protein	NA	NA	NA	NA
WP_114076598.1\|381787_381988_+	hypothetical protein	NA	NA	NA	NA
WP_111405742.1\|381997_382207_-	hypothetical protein	K4I1E3	Acidithiobacillus_phage	1.9e-12	60.9
WP_168782142.1\|382203_383193_-	DNA cytosine methyltransferase	D2XJU8	Escherichia_phage	6.6e-71	49.4
WP_168782143.1\|383192_384512_-	site-specific DNA-methyltransferase	A0A2H4JGF1	uncultured_Caudovirales_phage	1.0e-74	38.0
WP_021099076.1\|385026_385311_+	hypothetical protein	NA	NA	NA	NA
WP_021099075.1\|385307_385724_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_168781936.1\|385926_387116_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168782144.1\|387179_387644_-	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.4e-47	69.2
WP_168782145.1\|388294_389359_+	hypothetical protein	NA	NA	NA	NA
WP_168782146.1\|389390_391982_-	P-loop ATPase	A0A2D1GN57	Marinobacter_phage	8.6e-78	42.0
WP_168782147.1\|391990_393310_-	AAA family ATPase	A0A0F6SJ43	Sinorhizobium_phage	1.0e-63	37.3
WP_168782148.1\|393306_394056_-	hypothetical protein	NA	NA	NA	NA
WP_168782149.1\|394052_394850_-	hypothetical protein	K4HZA0	Acidithiobacillus_phage	2.3e-66	54.8
WP_168782150.1\|394846_395062_-	hypothetical protein	NA	NA	NA	NA
WP_168782151.1\|395058_395481_-	HNH endonuclease	A0A0B4N249	Escherichia_phage	1.5e-24	44.0
WP_168783774.1\|395493_395904_-	hypothetical protein	NA	NA	NA	NA
WP_168783742.1\|395861_396092_-	hypothetical protein	NA	NA	NA	NA
WP_168782152.1\|396171_396948_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	4.9e-21	38.8
WP_168782153.1\|396970_397828_-	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	2.9e-62	47.1
WP_168782154.1\|397932_398415_-	hypothetical protein	K4HZ96	Acidithiobacillus_phage	8.0e-22	39.6

DBSCAN-SWA_29

401719 : 407479

Acidithiobacillus_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782158.1\|401719_402652_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	1.8e-57	41.6
WP_168782159.1\|403092_403545_+	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	3.1e-23	45.8
WP_168782160.1\|403541_404852_+	recombinase family protein	K4ICM1	Acidithiobacillus_phage	1.2e-123	53.0
WP_168782161.1\|404848_405241_+	hypothetical protein	K4I1C7	Acidithiobacillus_phage	6.8e-11	37.7
WP_168782162.1\|405424_407479_+	SAM-dependent DNA methyltransferase	A0A142K7G3	Mycobacterium_phage	9.4e-11	27.4

DBSCAN-SWA_30

420898 : 423010

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036707896.1\|420898_423010_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	U5J9N6	Bacillus_phage	7.1e-14	36.0

DBSCAN-SWA_31

429988 : 431724

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081969044.1\|429988_430927_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.2e-10	24.8
WP_036701415.1\|431019_431724_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.4e-16	28.4

DBSCAN-SWA_32

434801 : 436468

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783777.1\|434801_435347_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.0e-22	39.5
WP_168782176.1\|435424_436468_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SR00	Cyanophage	6.8e-58	44.3

DBSCAN-SWA_33

439850 : 443486

Bradyrhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782181.1\|439850_443486_-	vitamin B12-dependent ribonucleotide reductase	A0A1X9SGV9	Bradyrhizobium_phage	0.0e+00	57.2

DBSCAN-SWA_34

448720 : 458897

Streptococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036701360.1\|448720_449752_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.7e-45	37.8
WP_168782182.1\|450007_451519_+	acyl--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.4e-25	28.5
WP_168782183.1\|451555_451918_-	hypothetical protein	NA	NA	NA	NA
WP_168782184.1\|452135_454409_+	adenosylcobalamin-dependent ribonucleoside-diphosphate reductase	M4QT32	Loktanella_phage	5.6e-267	61.7
WP_168783778.1\|454945_456193_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.1e-50	33.0
WP_168782185.1\|456310_456883_+	thymidine kinase	C4MZJ3	Enterobacteria_phage	3.2e-54	57.5
WP_052512846.1\|456993_458163_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	9.0e-43	33.3
WP_168782186.1\|458183_458897_+	dTMP kinase	M1PSC7	Streptococcus_phage	8.2e-23	34.2

DBSCAN-SWA_35

468568 : 477423

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036731119.1\|468568_469675_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-28	34.7
WP_168782194.1\|470003_473744_-	methionine synthase	A0A140XBC7	Dickeya_phage	9.7e-14	57.1
WP_168782195.1\|474059_474767_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_168782196.1\|475743_477423_+	cytochrome c oxidase subunit 1	R9VX24	Flavobacterium_phage	2.6e-06	33.0

DBSCAN-SWA_36

486380 : 522544

Bacillus_virus(22.22%)

protease,tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782203.1\|486380_487088_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_168782204.1\|487233_487863_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.8e-61	61.0
WP_036708137.1\|488068_489334_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.6e-133	58.3
WP_036712058.1\|490585_491482_+	polyphosphate kinase 2	NA	NA	NA	NA
WP_168782205.1\|491481_491790_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_043133758.1\|491892_492345_+	TerB family tellurite resistance protein	NA	NA	NA	NA
WP_168782206.1\|492418_493246_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-25	38.1
WP_168782207.1\|493272_494184_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_036704717.1\|494241_495126_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_036704716.1\|495122_495947_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_036712070.1\|495953_497288_+	glutamine synthetase	A0A2K9KZQ0	Tupanvirus	1.5e-09	25.4
WP_036704714.1\|497472_498507_+	rod shape-determining protein	NA	NA	NA	NA
WP_074825958.1\|498515_499511_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_036711685.1\|499515_500055_+	hypothetical protein	NA	NA	NA	NA
WP_168782208.1\|500120_502067_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_168782209.1\|502109_503252_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_168782210.1\|503292_504213_+	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
WP_168782211.1\|504278_505043_-	hypothetical protein	NA	NA	NA	NA
WP_168782212.1\|505039_505744_-	uracil-DNA glycosylase family protein	NA	NA	NA	NA
WP_036705915.1\|505979_506633_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_168782213.1\|506616_508494_+	capsule biosynthesis protein	NA	NA	NA	NA
WP_168782214.1\|508490_509384_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	3.9e-46	42.3
WP_168782215.1\|509380_510586_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_168782216.1\|511079_511787_+	hypothetical protein	NA	NA	NA	NA
WP_168782217.1\|511867_512365_+	hypothetical protein	NA	NA	NA	NA
WP_168781936.1\|512583_513772_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168782218.1\|513954_514440_-	hypothetical protein	NA	NA	NA	NA
WP_036712921.1\|514500_514896_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168782219.1\|514892_515240_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
WP_168781947.1\|515298_516798_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168782220.1\|517613_518642_+	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_168782221.1\|518886_519456_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_168782222.1\|519569_520550_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_036703254.1\|520553_521408_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_168782223.1\|521407_522544_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-19	31.6

DBSCAN-SWA_37

545699 : 546434

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036704070.1\|545699_546434_-	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	9.7e-11	33.3

DBSCAN-SWA_38

571994 : 578426

Tetraselmis_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036711395.1\|571994_572480_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.1e-15	49.1
WP_036703390.1\|572573_572792_-	DUF465 domain-containing protein	NA	NA	NA	NA
WP_036703389.1\|572977_573388_+	Hsp20 family protein	A0A2H4N7P1	Lake_Baikal_phage	4.6e-18	40.8
WP_036703387.1\|573403_573631_+	DUF1150 domain-containing protein	NA	NA	NA	NA
WP_168782256.1\|573617_574574_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
WP_168782257.1\|574570_575371_-	hypothetical protein	NA	NA	NA	NA
WP_139305987.1\|575507_577223_-	bifunctional sulfate adenylyltransferase/adenylylsulfate kinase	A0A2P1ELS9	Moumouvirus	3.9e-119	41.1
WP_168782258.1\|577394_578426_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	1.6e-64	45.0

DBSCAN-SWA_39

590169 : 595604

uncultured_virus(66.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783782.1\|590169_590496_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	1.6e-10	35.4
WP_168783783.1\|590831_592436_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.3e-27	34.6
WP_036699659.1\|593262_593421_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
WP_168782269.1\|593420_595604_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.6e-61	29.1

DBSCAN-SWA_40

601911 : 602751

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782274.1\|601911_602751_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	7.0e-05	49.0

DBSCAN-SWA_41

609082 : 610033

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782279.1\|609082_610033_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-21	30.4

DBSCAN-SWA_42

635119 : 639831

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782290.1\|635119_638023_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	61.4
WP_168782291.1\|638232_639831_+	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase/3'-nucleotidase	S4W4I8	Pandoravirus	1.4e-09	22.4

DBSCAN-SWA_43

644563 : 646435

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782297.1\|644563_646435_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.1e-17	30.3

DBSCAN-SWA_44

652192 : 653485

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036734443.1\|652192_653485_-	adenylosuccinate synthase	A0A0B5J049	Pandoravirus	7.4e-54	31.8

DBSCAN-SWA_45

663419 : 665809

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782307.1\|663419_664163_+	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	3.5e-16	36.7
WP_168782308.1\|664258_665809_+	hypothetical protein	F2Y1U7	Organic_Lake_phycodnavirus	5.6e-08	23.6

DBSCAN-SWA_46

674654 : 675665

Aeropyrum_coil-shaped_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782313.1\|674654_675665_-	NAD-dependent epimerase/dehydratase family protein	J7Q7J8	Aeropyrum_coil-shaped_virus	3.0e-18	25.2

DBSCAN-SWA_47

684392 : 686332

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036708896.1\|684392_685514_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	3.6e-49	38.3
WP_168782321.1\|685738_686332_-	riboflavin synthase	A0A1V0SE20	Indivirus	5.4e-20	36.2

DBSCAN-SWA_48

691686 : 692670

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783786.1\|691686_692670_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.9e-31	32.7

DBSCAN-SWA_49

696585 : 704192

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782325.1\|696585_698574_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	5.3e-35	34.1
WP_168782326.1\|698721_700611_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.2e-90	37.5
WP_036708884.1\|700702_701302_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_168782327.1\|701632_702160_+	hypothetical protein	NA	NA	NA	NA
WP_168782328.1\|702201_703365_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
WP_168782329.1\|703355_704192_-	alpha/beta hydrolase	A0A0B5A484	Mycobacterium_phage	1.3e-06	33.7

DBSCAN-SWA_50

710744 : 717189

Sphingobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782334.1\|710744_712976_-	NAD-dependent DNA ligase LigA	A0A1W6DX16	Sphingobium_phage	5.3e-108	38.3
WP_168782335.1\|713132_714149_-	Fe(3+) ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168782336.1\|714269_715301_+	serine hydrolase	NA	NA	NA	NA
WP_168782337.1\|715362_717189_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-31	25.7

DBSCAN-SWA_51

722443 : 723157

Roseobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036705087.1\|722443_723157_+	response regulator transcription factor	F4YXP8	Roseobacter_phage	4.8e-15	49.5

DBSCAN-SWA_52

742287 : 743010

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036701460.1\|742287_743010_-	amino acid ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-10	31.7

DBSCAN-SWA_53

756038 : 759940

Pectobacterium_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782357.1\|756038_757286_+\|tRNA	tyrosine--tRNA ligase	A0A1L2CUL7	Pectobacterium_phage	6.0e-61	35.4
WP_168782358.1\|757282_758173_+	kinase	NA	NA	NA	NA
WP_168782359.1\|758245_759154_+	pseudouridine-5'-phosphate glycosidase	NA	NA	NA	NA
WP_168782360.1\|759226_759940_+	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	3.4e-08	28.3

DBSCAN-SWA_54

765014 : 766241

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782364.1\|765014_766241_-	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	1.8e-09	33.9

DBSCAN-SWA_55

773587 : 774307

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081973086.1\|773587_774307_+	sulfate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-25	33.3

DBSCAN-SWA_56

788936 : 792104

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783797.1\|788936_792104_-	disulfide oxidoreductase	A0A248SJQ0	Salicola_phage	5.1e-16	31.5

DBSCAN-SWA_57

797161 : 798613

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782380.1\|797161_798613_-	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	1.5e-76	37.2

DBSCAN-SWA_58

805618 : 811670

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782387.1\|805618_807214_+	phosphoenolpyruvate carboxykinase	A0A2H4PQN1	Staphylococcus_phage	2.8e-135	48.1
WP_168782388.1\|807354_808665_+	short-chain fatty acid transporter	NA	NA	NA	NA
WP_168782389.1\|808734_809325_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
WP_168782390.1\|809396_811670_-	ribonuclease R	Q0GXV6	Lactococcus_phage	6.0e-51	30.4

DBSCAN-SWA_59

819164 : 819923

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036701908.1\|819164_819923_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.1e-44	40.9

DBSCAN-SWA_60

838571 : 839303

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036733407.1\|838571_839303_-	hypothetical protein	A0A218MM73	uncultured_virus	1.0e-07	31.3

DBSCAN-SWA_61

861192 : 862587

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783801.1\|861192_862587_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	4.2e-47	29.1

DBSCAN-SWA_62

870232 : 872711

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782419.1\|870232_871231_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	2.2e-26	33.8
WP_168782420.1\|871289_872078_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_168782421.1\|872147_872711_-	cell wall hydrolase	J9QM71	Pectobacterium_phage	7.7e-16	38.4

DBSCAN-SWA_63

877704 : 885815

Lake_Baikal_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036701785.1\|877704_878040_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	1.0e-15	43.6
WP_168783802.1\|878186_879386_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_168782423.1\|879396_880281_-	DMT family transporter	NA	NA	NA	NA
WP_036710487.1\|880309_881908_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	2.1e-13	32.7
WP_168782424.1\|882051_882702_-	OmpA family protein	NA	NA	NA	NA
WP_168782425.1\|882701_883166_-	hypothetical protein	NA	NA	NA	NA
WP_168782426.1\|883383_883572_-	hypothetical protein	NA	NA	NA	NA
WP_036710484.1\|883584_884337_-	NAD kinase	NA	NA	NA	NA
WP_043132696.1\|884531_885815_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	6.7e-100	52.8

DBSCAN-SWA_64

892701 : 894114

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783803.1\|892701_894114_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.6e-30	30.8

DBSCAN-SWA_65

898905 : 900648

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782434.1\|898905_900648_+	type I secretion system permease/ATPase	A0A2R8FG22	Brazilian_cedratvirus	7.2e-12	31.6

DBSCAN-SWA_66

909956 : 915024

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782440.1\|909956_912299_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-10	26.6
WP_168782441.1\|912340_913771_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_168782442.1\|913770_915024_-	PAS domain-containing sensor histidine kinase	W8CYF6	Bacillus_phage	1.7e-07	25.3

DBSCAN-SWA_67

924935 : 925382

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782448.1\|924935_925382_+	nucleoside deaminase	A0A0B5J096	Pandoravirus	1.9e-09	48.1

DBSCAN-SWA_68

930907 : 932373

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036734258.1\|930907_931597_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-10	26.3
WP_168782453.1\|931593_932373_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.4e-07	25.7

DBSCAN-SWA_69

935570 : 937202

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782455.1\|935570_937202_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	1.4e-49	32.0

DBSCAN-SWA_70

940938 : 941691

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782462.1\|940938_941691_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.3e-06	26.6

DBSCAN-SWA_71

944692 : 945526

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782463.1\|944692_945526_-	LOG family protein	A0A1D8KUT5	Synechococcus_phage	6.9e-13	31.6

DBSCAN-SWA_72

957039 : 961386

Xanthomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782472.1\|957039_957519_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	4.5e-33	51.0
WP_168782473.1\|957515_958685_+	molybdopterin-synthase adenylyltransferase MoeB	A0A1V0SAV8	Catovirus	2.7e-07	28.6
WP_168782474.1\|958905_959346_+	hypothetical protein	NA	NA	NA	NA
WP_168783806.1\|959453_960026_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_036704831.1\|960384_961386_+	D-glycerate dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	5.7e-22	28.2

DBSCAN-SWA_73

983164 : 985057

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783809.1\|983164_985057_-	cation-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.1e-77	33.9

DBSCAN-SWA_74

994233 : 996132

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036707580.1\|994233_995235_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-42	33.8
WP_139305966.1\|995238_996132_-	NTP transferase domain-containing protein	A0A127AW70	Bacillus_phage	2.5e-61	44.4

DBSCAN-SWA_75

999916 : 1003086

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036730829.1\|999916_1001827_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	4.4e-156	52.8
WP_036701028.1\|1001922_1003086_+	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	4.2e-24	32.3

DBSCAN-SWA_76

1014510 : 1016579

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782504.1\|1014510_1015497_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-17	30.5
WP_168782505.1\|1015493_1016579_+	dipeptide ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-17	32.6

DBSCAN-SWA_77

1022165 : 1042922

Paracoccus_phage(30.0%)

tRNA,protease,portal,capsid,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036704735.1\|1022165_1022453_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_168782510.1\|1022449_1023925_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_168782511.1\|1023956_1024562_+	hypothetical protein	NA	NA	NA	NA
WP_168782512.1\|1024558_1025005_+	cupin domain-containing protein	NA	NA	NA	NA
WP_168783811.1\|1025391_1025988_+	DUF952 domain-containing protein	NA	NA	NA	NA
WP_168782513.1\|1025988_1027053_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_168783812.1\|1027049_1027877_-	serine O-acetyltransferase	NA	NA	NA	NA
WP_168782514.1\|1027976_1028702_-	DUF2793 domain-containing protein	A0A0K1Y6G9	Rhodobacter_phage	1.9e-14	31.5
WP_168782515.1\|1028694_1032570_-	host specificity protein	A0A0K1LLC1	Rhodobacter_phage	8.8e-220	38.9
WP_168782516.1\|1032628_1033084_-	peptidase	F4YXU4	Roseobacter_phage	1.0e-26	44.8
WP_168782517.1\|1033080_1033923_-	DUF2163 domain-containing protein	A0A0B5A5B8	Paracoccus_phage	2.2e-38	36.5
WP_168783813.1\|1033919_1034552_-	DUF2460 domain-containing protein	A0A0B5A2K3	Paracoccus_phage	2.8e-54	50.0
WP_168782518.1\|1034551_1035220_-\|tail	phage tail tape measure protein	C0LP53	Escherichia_virus	1.8e-08	30.2
WP_168782519.1\|1035241_1035538_-\|tail	phage tail assembly chaperone	NA	NA	NA	NA
WP_036703895.1\|1035524_1035839_-	gene transfer agent family protein	NA	NA	NA	NA
WP_036703899.1\|1035838_1036255_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_036711801.1\|1036268_1036700_-	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_036703902.1\|1036696_1037035_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_036703904.1\|1037031_1037646_-	hypothetical protein	NA	NA	NA	NA
WP_168782520.1\|1037782_1038958_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	3.1e-59	40.5
WP_168782521.1\|1039173_1039740_-\|head,protease	HK97 family phage prohead protease	A0A0U2BX10	Paracoccus_phage	6.7e-36	52.5
WP_036703910.1\|1039750_1039984_-	hypothetical protein	NA	NA	NA	NA
WP_168783814.1\|1039985_1041290_-\|portal	phage portal protein	W8ECU7	Geobacillus_phage	5.1e-55	37.3
WP_081962789.1\|1041527_1042922_-	DNA-packaging protein	A0A1V0DY66	Dinoroseobacter_phage	2.3e-69	37.2

DBSCAN-SWA_78

1055955 : 1059097

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043133087.1\|1055955_1057677_+\|tRNA	methionine--tRNA ligase	A0A2K9KZR3	Tupanvirus	6.5e-82	35.0
WP_168782528.1\|1057726_1059097_-	phosphomannomutase	A0A127AWJ1	Bacillus_phage	2.9e-24	26.1

DBSCAN-SWA_79

1062902 : 1063814

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782531.1\|1062902_1063814_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.2e-73	53.8

DBSCAN-SWA_80

1080961 : 1081864

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782540.1\|1080961_1081864_-	metal ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	6.6e-09	25.8

DBSCAN-SWA_81

1108712 : 1113884

Enterobacteria_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703183.1\|1108712_1109429_+	response regulator	W8CYM9	Bacillus_phage	9.8e-32	37.3
WP_168782551.1\|1109559_1110441_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.3e-88	55.6
WP_168782552.1\|1110437_1111289_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	6.2e-33	37.0
WP_168782553.1\|1111285_1112248_-	hypothetical protein	NA	NA	NA	NA
WP_168782554.1\|1112247_1113291_-	dTDP-glucose 4,6-dehydratase	K7QJG5	Escherichia_phage	3.6e-91	50.6
WP_168782555.1\|1113287_1113884_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.4e-39	46.9

DBSCAN-SWA_82

1122625 : 1130484

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703190.1\|1122625_1123243_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.6e-25	44.2
WP_168782561.1\|1123379_1124174_-	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_168782562.1\|1124346_1125264_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_168783818.1\|1125344_1126118_+	hypothetical protein	NA	NA	NA	NA
WP_168782563.1\|1126198_1126750_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	9.2e-14	51.3
WP_168782564.1\|1126775_1127951_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
WP_168782565.1\|1128499_1128652_-	hypothetical protein	NA	NA	NA	NA
WP_168782566.1\|1129032_1129449_-	PaaI family thioesterase	NA	NA	NA	NA
WP_168782567.1\|1129455_1130484_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.1e-07	29.2

DBSCAN-SWA_83

1149491 : 1156241

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782585.1\|1149491_1150448_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	1.6e-13	38.8
WP_168782586.1\|1150444_1151200_-	DUF484 family protein	NA	NA	NA	NA
WP_036704902.1\|1151196_1151853_-	fructose-6-phosphate aldolase	A0A0C5AMY8	Cyanophage	8.0e-57	50.0
WP_036704900.1\|1152063_1152591_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	2.1e-15	33.1
WP_168782587.1\|1152630_1153509_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	5.9e-31	39.1
WP_036711467.1\|1153498_1153813_-	chorismate mutase	NA	NA	NA	NA
WP_168782588.1\|1153918_1154146_+	hypothetical protein	B3FJW3	Pseudomonas_phage	1.3e-06	40.0
WP_168782589.1\|1154354_1156241_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	C7U047	Ostreococcus_tauri_virus	1.5e-116	43.4

DBSCAN-SWA_84

1167854 : 1170662

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782594.1\|1167854_1170662_-	type I DNA topoisomerase	A0A0G2Y787	Acanthamoeba_polyphaga_mimivirus	7.6e-104	30.9

DBSCAN-SWA_85

1178780 : 1179617

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783824.1\|1178780_1179617_-	lytic transglycosylase domain-containing protein	E5RV25	Ralstonia_phage	4.1e-13	40.8

DBSCAN-SWA_86

1188050 : 1201677

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782605.1\|1188050_1189703_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-18	35.2
WP_168782606.1\|1189712_1190195_+	hypothetical protein	NA	NA	NA	NA
WP_168782607.1\|1190364_1192149_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	3.6e-19	23.4
WP_168782608.1\|1192410_1193379_-	CoA ester lyase	NA	NA	NA	NA
WP_168782609.1\|1193547_1194408_+	D-amino-acid transaminase	NA	NA	NA	NA
WP_168781936.1\|1194573_1195762_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_156127490.1\|1196021_1196882_-	calcium-binding protein	NA	NA	NA	NA
WP_168783826.1\|1196915_1197665_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-30	39.2
WP_168782610.1\|1197755_1199207_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_036703432.1\|1199208_1200471_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_036703421.1\|1200651_1201677_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	2.6e-78	45.7

DBSCAN-SWA_87

1204770 : 1206150

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782614.1\|1204770_1206150_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.9e-71	38.7

DBSCAN-SWA_88

1210854 : 1211508

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783828.1\|1210854_1211508_-	adenylate kinase	A0A2K9L833	Tupanvirus	5.3e-08	37.0

DBSCAN-SWA_89

1215394 : 1216249

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783830.1\|1215394_1216249_+	manganese/iron ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.2e-13	25.1

DBSCAN-SWA_90

1223022 : 1224549

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036735900.1\|1223022_1224549_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-16	30.6

DBSCAN-SWA_91

1253712 : 1257997

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782644.1\|1253712_1254684_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.1e-17	33.5
WP_168782645.1\|1254680_1255679_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-16	32.0
WP_168782646.1\|1255675_1257997_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	1.2e-54	30.0

DBSCAN-SWA_92

1276953 : 1277802

Helicoverpa_zea_single_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783838.1\|1276953_1277802_-	glycosyl transferase	Q9E236	Helicoverpa_zea_single_nucleopolyhedrovirus	3.6e-09	34.0

DBSCAN-SWA_93

1287632 : 1289538

Stx2-converting_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036705738.1\|1287632_1287980_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.8e-36	60.7
WP_168782658.1\|1288038_1289538_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.1e-114	46.2

DBSCAN-SWA_94

1307206 : 1308799

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782667.1\|1307206_1308799_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.3e-47	29.3

DBSCAN-SWA_95

1319515 : 1320931

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036704005.1\|1319515_1320931_-	adenosylhomocysteinase	S4W1G4	Pandoravirus	1.1e-42	30.9

DBSCAN-SWA_96

1339960 : 1342614

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782684.1\|1339960_1340755_+	3-hydroxybutyrate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-11	26.4
WP_168783842.1\|1340787_1341678_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_168782685.1\|1341776_1342022_+	hypothetical protein	NA	NA	NA	NA
WP_168782686.1\|1342002_1342614_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.4e-17	30.6

DBSCAN-SWA_97

1346784 : 1355142

Ectocarpus_siliculosus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052171743.1\|1346784_1348107_+	hybrid sensor histidine kinase/response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	1.3e-10	29.6
WP_052176442.1\|1348321_1348627_-	excalibur calcium-binding domain-containing protein	NA	NA	NA	NA
WP_168782690.1\|1348708_1351561_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.9e-256	51.4
WP_168782691.1\|1351576_1351924_-	glyoxalase	NA	NA	NA	NA
WP_081969156.1\|1352004_1352364_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_168782692.1\|1352374_1353475_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_036707647.1\|1353757_1353991_-	hypothetical protein	NA	NA	NA	NA
WP_036701715.1\|1354050_1355142_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.3e-29	35.4

DBSCAN-SWA_98

1358780 : 1360686

Stx2-converting_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781947.1\|1358780_1360280_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168782219.1\|1360338_1360686_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7

DBSCAN-SWA_99

1363953 : 1367946

Wolbachia_phage(50.0%)

integrase

attL 1354991:1355007|attR 1375604:1375620

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1354991:1355007	attL	NA	NA	NA	NA
WP_168782698.1\|1363953_1365231_-	AAA family ATPase	A0A1B2LRQ1	Wolbachia_phage	7.1e-33	39.0
WP_168782699.1\|1365227_1366112_-	hypothetical protein	NA	NA	NA	NA
WP_168782700.1\|1366387_1366561_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168782701.1\|1366758_1367946_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1X9HVL9	Ruegeria_phage	8.5e-49	34.9
1375604:1375620	attR	NA	NA	NA	NA

DBSCAN-SWA_100

1374628 : 1376401

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782708.1\|1374628_1376401_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	31.1

DBSCAN-SWA_101

1388160 : 1388931

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782718.1\|1388160_1388931_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.3e-29	35.4

DBSCAN-SWA_102

1392265 : 1395555

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081962799.1\|1392265_1392979_-	4Fe-4S dicluster domain-containing protein	A0A077SL61	Escherichia_phage	2.5e-43	38.8
WP_052176201.1\|1392993_1395555_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	6.7e-99	33.2

DBSCAN-SWA_103

1411459 : 1416832

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782733.1\|1411459_1414219_-	sensor histidine kinase KdpD	W8CYF6	Bacillus_phage	1.2e-13	25.1
WP_168782734.1\|1414229_1414784_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_168782735.1\|1414792_1416832_-	potassium-transporting ATPase subunit KdpB	A0A218MNH6	uncultured_virus	5.3e-22	26.2

DBSCAN-SWA_104

1426929 : 1427220

EBPR_siphovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782738.1\|1426929_1427220_+	peptidoglycan-binding protein	F8TVB6	EBPR_siphovirus	6.3e-06	44.3

DBSCAN-SWA_105

1437029 : 1439657

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782740.1\|1437029_1439657_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	8.6e-118	36.2

DBSCAN-SWA_106

1454319 : 1459972

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036732491.1\|1454319_1455153_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.0e-16	25.9
WP_052171683.1\|1455191_1457186_-	AMP-binding protein	A0A1V0SBX8	Catovirus	1.5e-26	20.6
WP_168782749.1\|1457351_1459265_+	PAS domain-containing protein	NA	NA	NA	NA
WP_036700790.1\|1459261_1459972_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-20	32.2

DBSCAN-SWA_107

1471022 : 1471322

Aphanizomenon_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700771.1\|1471022_1471322_-	HU family DNA-binding protein	A0A2H4PAM3	Aphanizomenon_phage	1.5e-05	40.2

DBSCAN-SWA_108

1482485 : 1485623

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782762.1\|1482485_1483403_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.8e-28	30.3
WP_036707714.1\|1483522_1483801_-	hypothetical protein	NA	NA	NA	NA
WP_036700031.1\|1483812_1484157_-	hypothetical protein	NA	NA	NA	NA
WP_168782763.1\|1484381_1485623_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-09	47.9

DBSCAN-SWA_109

1489819 : 1496907

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783849.1\|1489819_1491457_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.5e-16	27.3
WP_168782767.1\|1491453_1492548_+	ABC transporter permease	NA	NA	NA	NA
WP_036699966.1\|1492547_1493513_+	ABC transporter permease	NA	NA	NA	NA
WP_168782768.1\|1493496_1494294_+	purine-nucleoside phosphorylase	Q5YBA4	Grouper_iridovirus	1.7e-37	40.9
WP_036733922.1\|1494468_1496907_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.4e-114	34.5

DBSCAN-SWA_110

1504481 : 1505879

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782774.1\|1504481_1505879_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1C9C5E2	Heterosigma_akashiwo_virus	3.4e-36	31.2

DBSCAN-SWA_111

1515075 : 1572342

Stx2-converting_phage(30.77%)

tRNA,protease,transposase,portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782783.1\|1515075_1515801_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_168782784.1\|1515797_1516526_-\|tRNA	tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD	NA	NA	NA	NA
WP_168783851.1\|1516556_1517594_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_036699930.1\|1517602_1517923_-	DUF1992 domain-containing protein	NA	NA	NA	NA
WP_168782785.1\|1517922_1520985_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	4.8e-120	32.7
WP_168782786.1\|1521083_1521926_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_168782787.1\|1521922_1522597_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_036699924.1\|1522682_1523477_-	VOC family protein	NA	NA	NA	NA
WP_036699922.1\|1523503_1523935_-	VOC family protein	NA	NA	NA	NA
WP_036699920.1\|1523934_1524663_-	DUF1428 domain-containing protein	NA	NA	NA	NA
WP_168783852.1\|1524895_1525444_+	transcriptional regulator	NA	NA	NA	NA
WP_168782788.1\|1525453_1528084_-	hypothetical protein	NA	NA	NA	NA
WP_168782789.1\|1528080_1529202_-	DNA repair exonuclease	NA	NA	NA	NA
WP_168782790.1\|1529350_1529947_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_168782791.1\|1530000_1530429_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_168782792.1\|1530443_1531478_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
WP_168782793.1\|1531489_1532167_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_168782794.1\|1532216_1533134_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_168782795.1\|1533266_1534556_+	M24 family metallopeptidase	NA	NA	NA	NA
WP_036708340.1\|1534683_1535790_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168782796.1\|1535831_1537697_-	3-hydroxybenzoate 4-monooxygenase	NA	NA	NA	NA
WP_168783853.1\|1537854_1538271_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_168782797.1\|1538274_1539177_-	pca operon transcription factor PcaQ	NA	NA	NA	NA
WP_168782798.1\|1539268_1540438_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_168782799.1\|1540437_1541226_+	3-oxoadipate enol-lactonase	A0A1M7XTX4	Cedratvirus	2.0e-06	29.1
WP_168782800.1\|1541218_1541614_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
WP_036708391.1\|1541613_1542336_+	protocatechuate 3,4-dioxygenase subunit beta	NA	NA	NA	NA
WP_168782801.1\|1542335_1543040_+	protocatechuate 3,4-dioxygenase subunit alpha	NA	NA	NA	NA
WP_168782802.1\|1543032_1543899_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_168782803.1\|1543895_1545167_+	hypothetical protein	NA	NA	NA	NA
WP_168782804.1\|1545191_1546217_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
WP_036734288.1\|1546230_1546752_+	TRAP transporter small permease	NA	NA	NA	NA
WP_168782805.1\|1546748_1548068_+	TRAP transporter large permease	NA	NA	NA	NA
WP_036712921.1\|1548773_1549169_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168782219.1\|1549165_1549513_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
WP_168781947.1\|1549571_1551071_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168781947.1\|1551266_1552766_-\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168782219.1\|1552824_1553172_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
WP_036712921.1\|1553168_1553564_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168781936.1\|1554897_1556087_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168782806.1\|1556992_1557709_+	hypothetical protein	NA	NA	NA	NA
WP_168782807.1\|1557724_1557985_+	hypothetical protein	NA	NA	NA	NA
WP_168782808.1\|1558063_1560526_+	hypothetical protein	A0A1J0MDN5	Mycobacterium_phage	3.6e-17	29.0
WP_168782809.1\|1560865_1561378_+	hypothetical protein	NA	NA	NA	NA
WP_168782810.1\|1561367_1563161_+\|terminase	phage terminase large subunit family protein	K4I3Y9	Acidithiobacillus_phage	1.3e-189	60.5
WP_168782811.1\|1563333_1565520_+	DUF1156 domain-containing protein	NA	NA	NA	NA
WP_168783854.1\|1565503_1566529_+	hypothetical protein	NA	NA	NA	NA
WP_168782812.1\|1566525_1568232_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_168782813.1\|1568534_1569944_+\|portal	phage portal protein	Q75QM9	Wolbachia_phage	1.3e-109	45.6
WP_168783855.1\|1569966_1571784_+	peptidase U35	A0A2I7QSM3	Vibrio_phage	2.6e-73	31.1
WP_168782814.1\|1571785_1571995_+	hypothetical protein	K4HZB1	Acidithiobacillus_phage	2.3e-05	44.1
WP_168782815.1\|1571997_1572342_+	DUF2190 family protein	A0A1B0YZT7	Pseudomonas_phage	8.3e-05	34.0

DBSCAN-SWA_112

1599164 : 1602163

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782824.1\|1599164_1601012_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.1e-30	27.7
WP_168782825.1\|1601011_1602163_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A1B0V011	Roseobacter_phage	5.4e-40	36.8

DBSCAN-SWA_113

1607868 : 1611652

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782827.1\|1607868_1609275_+	inorganic phosphate transporter	V5LQA0	Emiliania_huxleyi_virus	6.2e-14	35.1
WP_168782828.1\|1609285_1611052_-	histidine kinase	NA	NA	NA	NA
WP_036709314.1\|1611058_1611652_-	RNA polymerase sigma factor	A0A076YQ50	Rhizobium_phage	3.0e-10	29.9

DBSCAN-SWA_114

1623247 : 1625791

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782835.1\|1623247_1625791_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	6.8e-152	37.6

DBSCAN-SWA_115

1634171 : 1634822

Rhodobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782839.1\|1634171_1634822_-	HD family hydrolase	A0A0K1Y6I9	Rhodobacter_phage	2.1e-17	39.7

DBSCAN-SWA_116

1646608 : 1649749

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782848.1\|1646608_1649749_+	multidrug efflux RND transporter permease subunit	S5VL66	Leptospira_phage	3.8e-11	19.3

DBSCAN-SWA_117

1654077 : 1671937

Mycoplasma_phage(14.29%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782850.1\|1654077_1655499_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	1.3e-30	36.6
WP_168782851.1\|1655498_1656359_+	C40 family peptidase	NA	NA	NA	NA
WP_036735550.1\|1656430_1657492_+	saccharopine dehydrogenase	A0A2K9L078	Tupanvirus	6.7e-61	37.2
WP_168782852.1\|1657488_1658631_+	saccharopine dehydrogenase	NA	NA	NA	NA
WP_168782853.1\|1658707_1659895_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
WP_036703151.1\|1659991_1660339_-	DUF3775 domain-containing protein	NA	NA	NA	NA
WP_168782854.1\|1660483_1662304_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	5.8e-97	37.7
WP_036703156.1\|1662431_1662617_+	hypothetical protein	NA	NA	NA	NA
WP_168782855.1\|1662687_1663989_-	insulinase family protein	NA	NA	NA	NA
WP_168782856.1\|1663985_1665608_-	insulinase family protein	M1NN74	Moumouvirus	5.3e-17	28.0
WP_036712932.1\|1665749_1666250_-	DUF3035 domain-containing protein	NA	NA	NA	NA
WP_168782857.1\|1666374_1667037_-	signal peptidase II	NA	NA	NA	NA
WP_168782858.1\|1667036_1668623_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	5.5e-67	47.5
WP_168782859.1\|1668784_1670083_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A2H5BJT2	Erwinia_phage	2.0e-38	28.8
WP_036702591.1\|1670161_1670359_+	hypothetical protein	NA	NA	NA	NA
WP_168782860.1\|1670742_1671315_-	SocA family protein	NA	NA	NA	NA
WP_168782861.1\|1671403_1671937_-	lipocalin	A0A1W6JNX6	Morganella_phage	1.4e-30	39.9

DBSCAN-SWA_118

1678375 : 1679089

Bradyrhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782869.1\|1678375_1679089_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.5e-56	50.6

DBSCAN-SWA_119

1686556 : 1688216

Natrialba_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043131416.1\|1686556_1687345_+	ParA family protein	Q8JL10	Natrialba_phage	5.0e-21	36.2
WP_168782876.1\|1687337_1688216_+	ParB/RepB/Spo0J family partition protein	A0A1C9EHW0	Gordonia_phage	1.6e-12	27.9

DBSCAN-SWA_120

1695448 : 1699635

Micromonas_pusilla_virus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783865.1\|1695448_1696864_-	mannitol dehydrogenase family protein	G9E6E2	Micromonas_pusilla_virus	6.2e-38	29.8
WP_036732349.1\|1697085_1697664_+	S-(hydroxymethyl)glutathione synthase	NA	NA	NA	NA
WP_036701093.1\|1697771_1698899_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	28.2
WP_036701096.1\|1698975_1699635_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A248SJ97	Salicola_phage	5.1e-27	36.7

DBSCAN-SWA_121

1703266 : 1703962

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782883.1\|1703266_1703962_+	c-type cytochrome, methanol metabolism-related	A0A218MKF6	uncultured_virus	1.6e-23	47.5

DBSCAN-SWA_122

1710326 : 1715539

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782891.1\|1710326_1711073_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.0e-16	30.2
WP_168782892.1\|1711069_1711870_+	ABC transporter permease	NA	NA	NA	NA
WP_168783867.1\|1711869_1712469_+	hypothetical protein	NA	NA	NA	NA
WP_168781930.1\|1712571_1713444_+	hypothetical protein	NA	NA	NA	NA
WP_168782893.1\|1713628_1715539_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	2.5e-18	29.9

DBSCAN-SWA_123

1732863 : 1734338

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036702871.1\|1732863_1733640_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.5e-09	25.7
WP_036711280.1\|1733636_1734338_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	3.1e-06	24.6

DBSCAN-SWA_124

1741807 : 1749328

Synechococcus_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782909.1\|1741807_1744213_+	ATP-dependent helicase HrpB	A0A2H4UU36	Bodo_saltans_virus	6.4e-27	27.0
WP_168782910.1\|1744325_1744937_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_168782911.1\|1744933_1746130_-	putative C-S lyase	NA	NA	NA	NA
WP_168782912.1\|1746224_1746743_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-21	44.2
WP_168783869.1\|1746753_1747377_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.0e-13	33.9
WP_036702845.1\|1747378_1747879_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.4e-13	36.4
WP_168782913.1\|1747878_1748349_+	hypothetical protein	NA	NA	NA	NA
WP_168782914.1\|1748434_1749328_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	3.9e-06	34.8

DBSCAN-SWA_125

1769748 : 1774653

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782919.1\|1769748_1770648_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-10	28.6
WP_036708589.1\|1770644_1771415_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-23	34.2
WP_036708587.1\|1771418_1772183_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.7e-10	27.2
WP_168782920.1\|1772179_1773001_-	DUF296 domain-containing protein	NA	NA	NA	NA
WP_168782921.1\|1773066_1774653_-	AMP-binding protein	A0A1V0SBX8	Catovirus	1.4e-17	24.8

DBSCAN-SWA_126

1779837 : 1780638

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782925.1\|1779837_1780638_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	5.4e-07	31.1

DBSCAN-SWA_127

1798521 : 1799340

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703632.1\|1798521_1799340_+	CbbQ/NirQ/NorQ/GpvN family protein	A0A2H4N7N3	Lake_Baikal_phage	1.5e-15	29.0

DBSCAN-SWA_128

1805009 : 1806925

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782940.1\|1805009_1805606_+	bifunctional nicotinamidase/pyrazinamidase	A0A1V0SL12	Klosneuvirus	2.2e-13	30.5
WP_081962786.1\|1805602_1806925_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.1e-126	52.8

DBSCAN-SWA_129

1819667 : 1824105

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782949.1\|1819667_1820420_+	amino acid ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.0e-15	30.6
WP_036710361.1\|1820440_1821283_-	hydratase	NA	NA	NA	NA
WP_168782950.1\|1821468_1824105_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	4.3e-16	30.7

DBSCAN-SWA_130

1827546 : 1830025

Pelagibacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011748553.1\|1827546_1827753_+	30S ribosomal protein S21	M1HLV7	Pelagibacter_phage	5.9e-06	54.0
WP_168782954.1\|1827947_1828370_+	META domain-containing protein	NA	NA	NA	NA
WP_036734514.1\|1828366_1830025_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	1.1e-99	37.8

DBSCAN-SWA_131

1836278 : 1837094

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782958.1\|1836278_1837094_+	S49 family peptidase	A0A2I7QTH6	Vibrio_phage	4.5e-09	27.6

DBSCAN-SWA_132

1865251 : 1867666

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782975.1\|1865251_1867666_+	lytic transglycosylase domain-containing protein	K4NWI2	Pseudomonas_phage	2.9e-19	26.5

DBSCAN-SWA_133

1873144 : 1874302

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782980.1\|1873144_1874302_-	type III PLP-dependent enzyme	A0A2K9L0W9	Tupanvirus	1.1e-24	27.8

DBSCAN-SWA_134

1881821 : 1884098

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783881.1\|1881821_1884098_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.2e-77	34.2

DBSCAN-SWA_135

1899515 : 1900337

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168782991.1\|1899515_1900337_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	4.5e-33	33.9

DBSCAN-SWA_136

1921935 : 1922634

Dishui_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036709779.1\|1921935_1922634_+	ribonuclease III	A0A2K9R4Y7	Dishui_lake_phycodnavirus	3.3e-16	33.0

DBSCAN-SWA_137

1929378 : 1930341

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783006.1\|1929378_1930341_+	threonylcarbamoyl-AMP synthase	A0A291ATS8	Pandoravirus	2.2e-34	38.6

DBSCAN-SWA_138

1941500 : 1950004

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783013.1\|1941500_1943828_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.5e-94	40.1
WP_168783014.1\|1943851_1944475_-	cytochrome B	NA	NA	NA	NA
WP_036705484.1\|1944485_1944947_-	cytochrome c	NA	NA	NA	NA
WP_168783015.1\|1945076_1946072_-	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_036703025.1\|1946375_1947551_+	elongation factor Tu	V5L5J1	Insectomime_virus	4.0e-22	29.1
WP_168783016.1\|1947743_1948817_+	hypothetical protein	NA	NA	NA	NA
WP_168783017.1\|1948916_1949339_+	HIT family protein	NA	NA	NA	NA
WP_168783889.1\|1949386_1950004_+	CatB-related O-acetyltransferase	M1I2A5	Paramecium_bursaria_Chlorella_virus	4.2e-07	40.8

DBSCAN-SWA_139

1953015 : 1954908

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783021.1\|1953015_1954908_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.6e-25	27.3

DBSCAN-SWA_140

1961520 : 1969994

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036732065.1\|1961520_1965675_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.0e-27	27.4
WP_168783023.1\|1965770_1969994_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.6e-65	26.6

DBSCAN-SWA_141

1973293 : 1976674

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703026.1\|1973293_1975417_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.5e-59	25.9
WP_036703025.1\|1975498_1976674_+	elongation factor Tu	V5L5J1	Insectomime_virus	4.0e-22	29.1

DBSCAN-SWA_142

1993819 : 1998030

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081973140.1\|1993819_1995532_-	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	4.6e-27	28.0
WP_168783034.1\|1995754_1996606_+	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_168783035.1\|1996971_1998030_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.6e-25	36.3

DBSCAN-SWA_143

2017847 : 2022519

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783042.1\|2017847_2018771_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.9e-64	48.6
WP_036705129.1\|2018945_2019560_+	ribonuclease D	U3REX2	uncultured_virus	5.1e-13	34.6
WP_036705127.1\|2019569_2020529_+	KpsF/GutQ family sugar-phosphate isomerase	NA	NA	NA	NA
WP_168783043.1\|2020530_2021112_+	hypothetical protein	NA	NA	NA	NA
WP_168783044.1\|2021185_2021707_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_168783895.1\|2021754_2022519_+	LPS export ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.9e-18	29.3

DBSCAN-SWA_144

2026462 : 2026918

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783048.1\|2026462_2026918_-	RidA family protein	M1I5B0	Acanthocystis_turfacea_Chlorella_virus	9.3e-20	39.3

DBSCAN-SWA_145

2034420 : 2036202

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083388328.1\|2034420_2036202_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.3e-44	28.5

DBSCAN-SWA_146

2045383 : 2049051

Mycobacterium_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783056.1\|2045383_2046742_+	cytochrome P450	V5UQK0	Mycobacterium_phage	2.1e-22	29.5
WP_139305912.1\|2046791_2047895_+	calcium:proton antiporter	NA	NA	NA	NA
WP_036709871.1\|2047965_2049051_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	2.1e-25	32.4

DBSCAN-SWA_147

2052175 : 2055664

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783059.1\|2052175_2053861_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	9.7e-14	35.6
WP_168783060.1\|2053948_2055664_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	3.1e-15	26.0

DBSCAN-SWA_148

2066346 : 2068446

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783066.1\|2066346_2068059_+	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-09	36.0
WP_036703072.1\|2068125_2068446_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	1.5e-16	43.0

DBSCAN-SWA_149

2078387 : 2081216

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783070.1\|2078387_2079872_+	purine permease	Q9KX94	Enterobacteria_phage	4.2e-29	27.6
WP_168783071.1\|2079905_2081216_-	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	2.3e-31	67.7

DBSCAN-SWA_150

2092467 : 2093376

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783081.1\|2092467_2093376_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	4.4e-13	42.6

DBSCAN-SWA_151

2100885 : 2113161

Staphylococcus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783084.1\|2100885_2101944_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.4e-33	45.9
WP_168783085.1\|2101943_2102483_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_168783086.1\|2102629_2103793_+	nucleotide sugar dehydrogenase	O41091	Paramecium_bursaria_Chlorella_virus	4.4e-106	51.9
WP_036708841.1\|2103895_2105458_+	alkaline phosphatase	NA	NA	NA	NA
WP_168783087.1\|2105590_2107786_-	catalase	A0A2K9L572	Tupanvirus	1.5e-131	45.6
WP_168783088.1\|2107854_2108631_-	DUF2268 domain-containing protein	NA	NA	NA	NA
WP_168783089.1\|2108882_2110478_+	trypsin-like peptidase domain-containing protein	A0A1B1IRD3	uncultured_Mediterranean_phage	1.3e-07	31.9
WP_168783090.1\|2110482_2113161_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	4.6e-82	45.8

DBSCAN-SWA_152

2122982 : 2123585

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783097.1\|2122982_2123585_-	VUT family protein	A0A2I7SAW6	Vibrio_phage	1.5e-17	30.0

DBSCAN-SWA_153

2128267 : 2130307

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783100.1\|2128267_2130307_+	DNA helicase RecQ	F2NZ48	Diadromus_pulchellus_ascovirus	3.1e-75	42.1

DBSCAN-SWA_154

2138963 : 2140737

Loktanella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783106.1\|2138963_2139890_+	FAD-dependent thymidylate synthase	M4QT16	Loktanella_phage	1.2e-98	62.1
WP_088238952.1\|2139950_2140737_+\|transposase	IS5-like element ISPme2 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.7e-17	34.9

DBSCAN-SWA_155

2154304 : 2154919

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074826137.1\|2154304_2154919_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	7.1e-15	35.4

DBSCAN-SWA_156

2159225 : 2159486

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036705877.1\|2159225_2159486_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	8.7e-15	52.7

DBSCAN-SWA_157

2167615 : 2170150

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783125.1\|2167615_2170150_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.5e-18	24.2

DBSCAN-SWA_158

2197682 : 2203424

Emiliania_huxleyi_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783141.1\|2197682_2198345_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.4e-16	35.9
WP_081973129.1\|2198438_2199587_+	site-specific DNA-methyltransferase	A0A249XUJ2	Enterococcus_phage	3.0e-30	31.0
WP_168783142.1\|2199686_2200811_-	alkane 1-monooxygenase	A0A1V0SBK9	Catovirus	5.8e-31	28.7
WP_168783143.1\|2201133_2202594_-	MCE family protein	NA	NA	NA	NA
WP_168783144.1\|2202596_2203424_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	4.2e-10	27.5

DBSCAN-SWA_159

2211305 : 2215370

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783150.1\|2211305_2212232_-	ornithine carbamoyltransferase	M1I6M4	Paramecium_bursaria_Chlorella_virus	2.5e-19	27.3
WP_168783151.1\|2212543_2213239_+	carbonic anhydrase	NA	NA	NA	NA
WP_036711713.1\|2213284_2214217_-	arginase	A0A1V0SJM8	Klosneuvirus	4.5e-21	34.6
WP_168783152.1\|2214389_2214644_+	hypothetical protein	NA	NA	NA	NA
WP_036733183.1\|2214695_2215370_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.4e-08	27.9

DBSCAN-SWA_160

2223404 : 2283147

Stx2-converting_phage(28.57%)

transposase,tRNA,integrase

attL 2230983:2231001|attR 2288711:2288729

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783156.1\|2223404_2224727_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_168783157.1\|2224850_2225543_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_168783158.1\|2226194_2227028_-	EAL domain-containing protein	NA	NA	NA	NA
WP_168783159.1\|2227122_2227716_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_036735208.1\|2227817_2228363_-	TlpA family protein disulfide reductase	NA	NA	NA	NA
WP_168783160.1\|2228393_2229821_+	argininosuccinate lyase	NA	NA	NA	NA
WP_168783161.1\|2229817_2229979_+	argininosuccinate lyase	NA	NA	NA	NA
WP_139305904.1\|2230095_2230320_+	hypothetical protein	NA	NA	NA	NA
WP_168783162.1\|2230775_2232041_+	diaminopimelate decarboxylase	NA	NA	NA	NA
2230983:2231001	attL	NA	NA	NA	NA
WP_168783908.1\|2232109_2234719_+	DUF4175 domain-containing protein	NA	NA	NA	NA
WP_168783163.1\|2234919_2235462_-	hypothetical protein	NA	NA	NA	NA
WP_036733044.1\|2236591_2237266_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-16	29.6
WP_036733074.1\|2237385_2238282_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_168783164.1\|2238281_2239121_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_168783165.1\|2239117_2239993_-	PQQ-binding-like beta-propeller repeat protein	NA	NA	NA	NA
WP_168783166.1\|2240185_2241007_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168783167.1\|2241036_2242125_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.7e-19	32.0
WP_168783168.1\|2242121_2242883_+	ABC transporter permease	NA	NA	NA	NA
WP_168783909.1\|2243559_2244240_+	Hint domain-containing protein	NA	NA	NA	NA
WP_168783169.1\|2244236_2244851_-	hypothetical protein	NA	NA	NA	NA
WP_168783170.1\|2245450_2245939_-	VOC family protein	NA	NA	NA	NA
WP_168783171.1\|2246068_2247484_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_168783172.1\|2247575_2248442_+	sulfotransferase	NA	NA	NA	NA
WP_168783173.1\|2248447_2249383_+	hypothetical protein	NA	NA	NA	NA
WP_168783174.1\|2249448_2250675_+	homoserine O-acetyltransferase	NA	NA	NA	NA
WP_168783175.1\|2250796_2252452_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	6.8e-44	29.0
WP_168783176.1\|2252456_2253713_+	DUF2254 domain-containing protein	NA	NA	NA	NA
WP_168783910.1\|2253764_2254523_-	hypothetical protein	NA	NA	NA	NA
WP_168783177.1\|2255007_2255655_+	DsbA family protein	NA	NA	NA	NA
WP_168783178.1\|2255651_2256386_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.8e-12	29.4
WP_168783179.1\|2256382_2257369_-	iron ABC transporter permease	NA	NA	NA	NA
WP_168783911.1\|2257365_2258223_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_168783180.1\|2258318_2260238_-	TonB-dependent receptor	NA	NA	NA	NA
WP_168783181.1\|2260746_2262627_-	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	3.7e-22	26.1
WP_168783912.1\|2262896_2263421_+	CAP domain-containing protein	NA	NA	NA	NA
WP_168783182.1\|2263768_2264947_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A088F800	Sulfitobacter_phage	4.3e-77	44.6
WP_168781936.1\|2265226_2266416_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168783183.1\|2266471_2266615_+	hypothetical protein	NA	NA	NA	NA
WP_168783184.1\|2266623_2267466_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_036712921.1\|2267742_2268138_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_036705738.1\|2268134_2268482_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	1.8e-36	60.7
WP_168783185.1\|2268540_2270040_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.3e-113	46.0
WP_139306057.1\|2270276_2271502_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.3e-71	51.2
WP_168783186.1\|2272813_2273146_+	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_168783187.1\|2273183_2273681_+	DUF305 domain-containing protein	NA	NA	NA	NA
WP_168783913.1\|2273994_2276406_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.1e-87	36.7
WP_168783188.1\|2277174_2278698_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	4.4e-13	42.5
WP_036722580.1\|2278826_2279246_+	cytochrome c	NA	NA	NA	NA
WP_168783189.1\|2279357_2279765_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_168783914.1\|2279761_2280217_-	cytochrome c	NA	NA	NA	NA
WP_168783190.1\|2280337_2280538_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_036712921.1\|2280849_2281245_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_168782219.1\|2281241_2281589_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
WP_168781947.1\|2281647_2283147_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
2288711:2288729	attR	NA	NA	NA	NA

DBSCAN-SWA_161

2290413 : 2295576

Moraxella_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783194.1\|2290413_2291508_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.5e-63	43.1
WP_168783195.1\|2291504_2292443_+	NAD(P)-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_168783196.1\|2292442_2292712_+	YciI family protein	NA	NA	NA	NA
WP_168783197.1\|2292711_2293218_+	EVE domain-containing protein	NA	NA	NA	NA
WP_036704301.1\|2293222_2293615_+	DUF1761 domain-containing protein	NA	NA	NA	NA
WP_168783198.1\|2293794_2295576_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	9.8e-57	31.3

DBSCAN-SWA_162

2328197 : 2330592

Caulobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783222.1\|2328197_2328938_-	serine/threonine protein phosphatase	A0A1V0EF12	Caulobacter_phage	5.2e-28	36.4
WP_168783223.1\|2329002_2330592_-	phosphoglycerate dehydrogenase	A0A2R8FDS8	Brazilian_cedratvirus	5.7e-48	39.1

DBSCAN-SWA_163

2336452 : 2337896

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783227.1\|2336452_2337175_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.0e-09	25.8
WP_168783228.1\|2337167_2337896_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.9e-06	28.6

DBSCAN-SWA_164

2341370 : 2344807

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036712784.1\|2341370_2342663_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.8e-83	42.1
WP_168783232.1\|2342743_2343187_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168783917.1\|2343183_2343471_-	SoxS protein	NA	NA	NA	NA
WP_168783233.1\|2343742_2344807_-	bifunctional transcriptional activator/DNA repair protein Ada	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	2.9e-16	47.6

DBSCAN-SWA_165

2349877 : 2357342

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783237.1\|2349877_2352310_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.8e-69	31.3
WP_036701528.1\|2352306_2353008_-	NAD-dependent deacylase	A0A2I7S9Y2	Vibrio_phage	6.4e-20	37.2
WP_036701579.1\|2353059_2353362_-	hypothetical protein	NA	NA	NA	NA
WP_036733088.1\|2353619_2354312_+	HAD family hydrolase	NA	NA	NA	NA
WP_168783238.1\|2354327_2354516_-	copper chaperone	NA	NA	NA	NA
WP_168783239.1\|2354570_2355503_+	DMT family transporter	NA	NA	NA	NA
WP_043133647.1\|2355542_2357342_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.9e-23	26.1

DBSCAN-SWA_166

2363326 : 2363833

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074826078.1\|2363326_2363833_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	A0A0P0IVM8	Acinetobacter_phage	7.1e-21	35.4

DBSCAN-SWA_167

2372926 : 2373949

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783251.1\|2372926_2373949_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.2e-20	30.6

DBSCAN-SWA_168

2380316 : 2382716

Aeromonas_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783254.1\|2380316_2382716_-	UDP-galactopyranose mutase	Q19CD9	Aeromonas_virus	1.8e-58	38.2

DBSCAN-SWA_169

2388200 : 2389265

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783258.1\|2388200_2389265_-	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	4.4e-36	34.8

DBSCAN-SWA_170

2392726 : 2394226

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783261.1\|2392726_2394226_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-15	27.4

DBSCAN-SWA_171

2401485 : 2405545

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783268.1\|2401485_2402388_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-16	33.2
WP_168783269.1\|2402384_2403371_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.2e-17	30.2
WP_168783270.1\|2403372_2404851_-	ABC transporter permease	NA	NA	NA	NA
WP_168783271.1\|2404840_2405545_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.5e-10	28.8

DBSCAN-SWA_172

2409615 : 2410530

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783274.1\|2409615_2410530_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.2e-23	33.5

DBSCAN-SWA_173

2416685 : 2417621

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036701851.1\|2416685_2417621_+	DnaJ domain-containing protein	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	1.4e-06	24.7

DBSCAN-SWA_174

2456555 : 2465674

uncultured_Mediterranean_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700486.1\|2456555_2457053_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.2e-34	46.9
WP_168783926.1\|2457227_2458151_+	DUF2189 domain-containing protein	NA	NA	NA	NA
WP_036700485.1\|2458224_2458737_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_168783301.1\|2458726_2459998_-	peptidoglycan DD-metalloendopeptidase family protein	A0A7K9	Microcystis_virus	1.2e-24	51.9
WP_036700483.1\|2460220_2461618_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_168783302.1\|2461734_2462934_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	2.0e-21	27.8
WP_168783303.1\|2462920_2463277_-	DMT family protein	NA	NA	NA	NA
WP_036700476.1\|2463267_2464758_-	replicative DNA helicase	I6S783	Marinomonas_phage	1.3e-75	38.3
WP_168783304.1\|2465002_2465674_-	orotate phosphoribosyltransferase	S4VS55	Pandoravirus	6.4e-17	29.9

DBSCAN-SWA_175

2470599 : 2471928

Gordonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783309.1\|2470599_2471928_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.3e-17	27.4

DBSCAN-SWA_176

2496081 : 2501394

Mycoplasma_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783322.1\|2496081_2497749_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.1e-41	36.3
WP_168783323.1\|2497753_2498200_+	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_036710207.1\|2498663_2499239_-\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_036705225.1\|2499509_2499848_+	sec-independent translocation protein mttA/Hcf106	NA	NA	NA	NA
WP_168783324.1\|2499897_2500539_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_168783325.1\|2500542_2501394_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	7.3e-34	34.3

DBSCAN-SWA_177

2513622 : 2522318

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783334.1\|2513622_2514888_+	insulinase family protein	A0A2K9LA15	Tupanvirus	3.3e-30	25.0
WP_168783335.1\|2514887_2515472_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_168783336.1\|2515524_2516922_+	FAD-binding oxidoreductase	NA	NA	NA	NA
WP_168783931.1\|2517067_2517505_+	PACE efflux transporter	NA	NA	NA	NA
WP_036703864.1\|2517501_2518050_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.7e-29	45.9
WP_168783337.1\|2518046_2518643_-	flavin reductase family protein	NA	NA	NA	NA
WP_168783338.1\|2519194_2519809_+	N-acetyltransferase	NA	NA	NA	NA
WP_052172179.1\|2519849_2520674_+	EcsC family protein	NA	NA	NA	NA
WP_168783339.1\|2520746_2522318_-	AAA family ATPase	B2ZYA4	Ralstonia_phage	7.4e-08	26.4

DBSCAN-SWA_178

2535929 : 2536706

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036702781.1\|2535929_2536706_+	P-loop NTPase	A0A142F1W4	Mycobacterium_phage	1.5e-06	28.7

DBSCAN-SWA_179

2556137 : 2558423

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783363.1\|2556137_2557985_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	5.7e-76	33.1
WP_036700160.1\|2558216_2558423_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.6e-11	50.8

DBSCAN-SWA_180

2563252 : 2563489

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700146.1\|2563252_2563489_+	acyl carrier protein	A0A2I7RIC8	Vibrio_phage	9.7e-05	39.7

DBSCAN-SWA_181

2567350 : 2572523

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783369.1\|2567350_2568931_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-16	27.9
WP_168783370.1\|2569046_2572523_+	DNA polymerase III subunit alpha	A0A291AVS4	Streptomyces_phage	1.8e-163	35.1

DBSCAN-SWA_182

2581035 : 2581620

Virus_Rctr197k(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700180.1\|2581035_2581620_+	HNH endonuclease	A0A1P8DIY8	Virus_Rctr197k	4.2e-25	40.5

DBSCAN-SWA_183

2601283 : 2609901

Fowlpox_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783392.1\|2601283_2602864_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase	Q9J5A8	Fowlpox_virus	6.1e-18	32.6
WP_168783393.1\|2602860_2603907_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X6WFP1	Pacmanvirus	5.1e-05	24.6
WP_036700169.1\|2603927_2605454_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
WP_043130836.1\|2605476_2606238_+	Fe-S cluster assembly ATPase SufC	A0A285PWH2	Cedratvirus	5.2e-07	25.6
WP_168783394.1\|2606230_2607598_+	SufD family Fe-S cluster assembly protein	NA	NA	NA	NA
WP_168783937.1\|2607629_2608118_+	hypothetical protein	NA	NA	NA	NA
WP_168783395.1\|2608114_2608693_+	YIP1 family protein	NA	NA	NA	NA
WP_168783396.1\|2608689_2609901_+	cysteine desulfurase	Q2XUY6	environmental_halophage	3.9e-89	41.6

DBSCAN-SWA_184

2617391 : 2624157

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036711437.1\|2617391_2618465_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.3e-117	64.1
WP_168783401.1\|2618815_2621476_+\|tRNA	alanine--tRNA ligase	A0A2K9L3D8	Tupanvirus	2.7e-74	38.7
WP_036700055.1\|2621472_2621778_+	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_168783402.1\|2621848_2622643_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_043130855.1\|2622718_2623060_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_168783403.1\|2623056_2624157_-	chorismate synthase	A0A291AU41	Pandoravirus	1.3e-70	40.8

DBSCAN-SWA_185

2630343 : 2631569

Pseudomonas_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783407.1\|2630343_2631569_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	1.4e-70	50.9

DBSCAN-SWA_186

2639098 : 2642498

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783415.1\|2639098_2640628_-	2-polyprenylphenol 6-hydroxylase	A0A2P0VMP1	Tetraselmis_virus	1.8e-14	23.4
WP_168783416.1\|2640761_2641574_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_168783417.1\|2641652_2642498_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.5e-23	28.3

DBSCAN-SWA_187

2645837 : 2646956

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036700858.1\|2645837_2646956_+	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	2.5e-66	45.1

DBSCAN-SWA_188

2664283 : 2668920

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783433.1\|2664283_2665075_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.1e-31	30.7
WP_168783434.1\|2665067_2665721_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.5e-34	43.8
WP_036700897.1\|2665731_2665953_+	hypothetical protein	NA	NA	NA	NA
WP_168783435.1\|2666026_2667094_-	2'-deoxycytidine 5'-triphosphate deaminase	NA	NA	NA	NA
WP_168783436.1\|2667363_2668038_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_036700904.1\|2668167_2668467_-	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	7.4e-10	33.0
WP_036700906.1\|2668650_2668920_+	DksA/TraR family C4-type zinc finger protein	E5E4B1	Acinetobacter_phage	8.7e-10	45.5

DBSCAN-SWA_189

2676523 : 2678287

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036704544.1\|2676523_2678287_-	acetolactate synthase 3 large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-54	30.1

DBSCAN-SWA_190

2685043 : 2689998

Klebsiella_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783442.1\|2685043_2685745_-	DUF1190 domain-containing protein	A0A0S1S3A5	Klebsiella_phage	2.4e-06	26.4
WP_168783443.1\|2685750_2686968_-	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	4.6e-82	41.4
WP_036735434.1\|2687201_2687705_+	diacylglyceryl transferase	NA	NA	NA	NA
WP_168783444.1\|2687843_2688653_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	4.5e-17	33.2
WP_168783445.1\|2688649_2689015_+\|tRNA	tRNA-binding protein	NA	NA	NA	NA
WP_168783446.1\|2689014_2689998_+	D-glycerate dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	4.6e-16	31.6

DBSCAN-SWA_191

2694461 : 2695178

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783452.1\|2694461_2695178_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.9e-23	38.1

DBSCAN-SWA_192

2704942 : 2709503

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783461.1\|2704942_2705725_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	3.0e-18	29.8
WP_168783462.1\|2705721_2708052_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	1.7e-189	48.7
WP_168783463.1\|2708048_2709503_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.0e-87	42.3

DBSCAN-SWA_193

2728838 : 2735617

Brazilian_cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036710335.1\|2728838_2729510_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.2e-12	31.5
WP_074825996.1\|2729580_2730021_+	c-type cytochrome	NA	NA	NA	NA
WP_168783473.1\|2730042_2730759_+	hypothetical protein	NA	NA	NA	NA
WP_168783474.1\|2730914_2732879_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	9.6e-114	39.1
WP_168783475.1\|2733020_2733401_-	type II toxin-antitoxin system death-on-curing family toxin	NA	NA	NA	NA
WP_036702382.1\|2733400_2733646_-	hypothetical protein	NA	NA	NA	NA
WP_168783476.1\|2733727_2734390_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_168783477.1\|2734579_2735617_+	phosphonate ABC transporter substrate-binding protein	A0A1B1IWY0	uncultured_Mediterranean_phage	1.0e-61	38.9

DBSCAN-SWA_194

2740418 : 2741108

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036710320.1\|2740418_2741108_+	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	1.7e-36	35.4

DBSCAN-SWA_195

2748675 : 2749041

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703542.1\|2748675_2749041_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.0e-08	32.8

DBSCAN-SWA_196

2758637 : 2767196

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783493.1\|2758637_2759765_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.4e-101	50.7
WP_036703532.1\|2759883_2760519_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_036709231.1\|2760526_2760976_-	ribonuclease HI	J9Q745	Salmonella_phage	2.2e-37	56.2
WP_168783945.1\|2760968_2761577_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_168783494.1\|2761587_2762565_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_168783495.1\|2762701_2763340_+	guanylate kinase	A0A1C9KCK9	Volepox_virus	3.7e-22	35.3
WP_168783496.1\|2763336_2763858_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_036709242.1\|2763863_2764934_+	PAS domain-containing protein	A0A1V0SGX0	Hokovirus	4.6e-17	27.5
WP_168783946.1\|2765015_2767196_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.6e-138	40.4

DBSCAN-SWA_197

2774459 : 2775071

Emiliania_huxleyi_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783499.1\|2774459_2775071_+	peptidoglycan-binding protein	G8DH66	Emiliania_huxleyi_virus	6.8e-58	58.1

DBSCAN-SWA_198

2779708 : 2785641

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783503.1\|2779708_2780986_-	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	1.2e-144	60.5
WP_036702969.1\|2781047_2781758_-	endonuclease	NA	NA	NA	NA
WP_168783504.1\|2781859_2783281_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	2.1e-46	43.4
WP_036702974.1\|2783467_2784496_+	GTPase ObgE	NA	NA	NA	NA
WP_168783948.1\|2784525_2785641_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.9e-50	38.5

DBSCAN-SWA_199

2791140 : 2792280

Faustovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783509.1\|2791140_2792280_+	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	4.5e-23	27.3

DBSCAN-SWA_200

2812808 : 2813603

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783525.1\|2812808_2813603_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.7e-27	32.8

DBSCAN-SWA_201

2845254 : 2848895

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783552.1\|2845254_2847660_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.0e-202	49.7
WP_043132144.1\|2848112_2848895_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-15	29.0

DBSCAN-SWA_202

2855807 : 2857361

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783951.1\|2855807_2857361_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	1.8e-70	39.1

DBSCAN-SWA_203

2862833 : 2868809

Acinetobacter_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783562.1\|2862833_2863559_-	transcriptional repressor LexA	E5DV74	Deep-sea_thermophilic_phage	2.1e-13	37.4
WP_168783952.1\|2863659_2864841_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_168783563.1\|2864843_2865338_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_036736117.1\|2865334_2866126_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.7e-59	51.0
WP_168783564.1\|2866167_2866812_-	uracil-DNA glycosylase	G0ZLG1	Human_herpesvirus	3.8e-35	49.5
WP_168783565.1\|2866814_2867156_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_168783566.1\|2867160_2868195_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.8e-42	33.8
WP_168783567.1\|2868191_2868809_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.8e-51	53.2

DBSCAN-SWA_204

2876160 : 2876694

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036736387.1\|2876160_2876694_-	xanthine phosphoribosyltransferase	M4T1R9	Cellulophaga_phage	1.4e-06	31.6

DBSCAN-SWA_205

2882304 : 2882808

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043133978.1\|2882304_2882808_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	5.1e-11	36.5

DBSCAN-SWA_206

2896520 : 2901131

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783585.1\|2896520_2897279_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	5.5e-25	31.5
WP_168783586.1\|2897418_2898957_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_036710264.1\|2898953_2900024_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.4e-12	30.7
WP_168783587.1\|2900039_2901131_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.7e-14	27.8

DBSCAN-SWA_207

2908091 : 2908751

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783591.1\|2908091_2908751_-	response regulator transcription factor	W8CYM9	Bacillus_phage	6.9e-24	29.7

DBSCAN-SWA_208

2916757 : 2920057

Rhodococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783595.1\|2916757_2920057_-	error-prone DNA polymerase	M9MUV5	Rhodococcus_phage	8.7e-59	25.1

DBSCAN-SWA_209

2923860 : 2931212

Stx2-converting_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168781936.1\|2923860_2925049_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168783599.1\|2925089_2925368_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_168782219.1\|2925364_2925712_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	6.4e-37	61.7
WP_168781947.1\|2925770_2927270_+\|transposase	IS66 family transposase	A0A0P0ZBS5	Stx2-converting_phage	1.9e-114	46.2
WP_168783600.1\|2927629_2928298_+	thermonuclease family protein	NA	NA	NA	NA
WP_168783601.1\|2928389_2931212_+	DNA polymerase I	A0A142F1Q9	Bacillus_phage	1.2e-72	32.0

DBSCAN-SWA_210

2937473 : 2939366

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783607.1\|2937473_2939366_-	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	7.7e-60	31.6

DBSCAN-SWA_211

2942661 : 2943945

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043133788.1\|2942661_2943945_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.3e-58	39.2

DBSCAN-SWA_212

2950605 : 2951058

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783613.1\|2950605_2951058_+	hypothetical protein	A0A291AUP1	Sinorhizobium_phage	1.2e-27	46.4

DBSCAN-SWA_213

2957623 : 2958907

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783619.1\|2957623_2958907_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.2e-94	49.9

DBSCAN-SWA_214

2964968 : 2965991

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783625.1\|2964968_2965991_-	NAD(P)/FAD-dependent oxidoreductase	A0A2I2L5E1	Orpheovirus	3.6e-11	25.3

DBSCAN-SWA_215

2973378 : 2976614

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036705309.1\|2973378_2974827_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	4.2e-90	40.2
WP_168783633.1\|2975009_2976614_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.9e-09	26.2

DBSCAN-SWA_216

2989217 : 2991903

Pneumococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783961.1\|2989217_2989679_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	7.4e-25	53.3
WP_168783642.1\|2989816_2990224_+	group III truncated hemoglobin	NA	NA	NA	NA
WP_168783643.1\|2990295_2990523_+	hypothetical protein	NA	NA	NA	NA
WP_168783644.1\|2990532_2991903_-	cytochrome P450	V5UQK0	Mycobacterium_phage	6.5e-16	28.0

DBSCAN-SWA_217

2997222 : 3002265

Catovirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783649.1\|2997222_2998701_+\|tRNA	histidine--tRNA ligase	A0A1V0S921	Catovirus	5.0e-22	26.7
WP_168783650.1\|2998708_2999815_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
WP_168783651.1\|2999808_3000534_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
WP_036712510.1\|3000604_3000883_+	DUF2171 domain-containing protein	NA	NA	NA	NA
WP_168783652.1\|3001122_3002265_-	signal recognition particle-docking protein FtsY	D6PHS7	uncultured_phage	8.6e-14	37.0

DBSCAN-SWA_218

3005369 : 3006459

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036702441.1\|3005369_3005870_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	1.6e-44	60.0
WP_036702440.1\|3005862_3006459_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	5.8e-38	55.3

DBSCAN-SWA_219

3013455 : 3037446

Caulobacter_phage(11.11%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783657.1\|3013455_3013827_+	helix-turn-helix transcriptional regulator	K4K6E9	Caulobacter_phage	5.4e-18	44.7
WP_168783658.1\|3013924_3014746_+	inositol monophosphatase family protein	NA	NA	NA	NA
WP_168783963.1\|3015067_3017770_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.4e-91	36.4
WP_036732016.1\|3018057_3018903_-	membrane protein	A0A1I9SA48	Rhodococcus_phage	5.5e-34	34.6
WP_036709614.1\|3019101_3019698_+	DedA family protein	NA	NA	NA	NA
WP_036732013.1\|3019724_3020213_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_036732010.1\|3020313_3021309_-	DUF808 domain-containing protein	NA	NA	NA	NA
WP_036709607.1\|3021507_3022485_+	cobaltochelatase subunit CobS	L7TKP0	Rhizobium_phage	2.1e-32	30.5
WP_168783659.1\|3022601_3023384_+	transglutaminase family protein	NA	NA	NA	NA
WP_168783660.1\|3023373_3023913_-	hypothetical protein	NA	NA	NA	NA
WP_168783661.1\|3024075_3025938_+	cobaltochelatase subunit CobT	J9Q7G6	Salmonella_phage	2.8e-14	27.3
WP_168783662.1\|3025976_3027170_+	patatin family protein	NA	NA	NA	NA
WP_168783663.1\|3027180_3028989_+	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	5.6e-84	35.8
WP_168783664.1\|3029139_3030519_+	FAD-binding protein	NA	NA	NA	NA
WP_168783665.1\|3030649_3031477_+	glycoside hydrolase family 25 protein	D0R7H8	Paenibacillus_phage	2.9e-19	34.3
WP_168783666.1\|3031481_3032117_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_168783667.1\|3032239_3034018_+\|tRNA	aspartate--tRNA ligase	A0A2K9KZX5	Tupanvirus	6.7e-05	50.0
WP_168783668.1\|3034157_3035525_+	DUF1800 domain-containing protein	NA	NA	NA	NA
WP_168783669.1\|3035537_3036719_+	DUF1501 domain-containing protein	NA	NA	NA	NA
WP_036701313.1\|3036804_3037446_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	6.1e-17	33.6

DBSCAN-SWA_220

3044135 : 3046454

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036712479.1\|3044135_3046454_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	7.0e-172	45.3

DBSCAN-SWA_221

3055499 : 3064181

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783677.1\|3055499_3056519_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	1.5e-46	35.7
WP_168783678.1\|3056583_3057846_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_168783965.1\|3058280_3060224_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	8.2e-33	33.6
WP_168783679.1\|3060310_3062368_-	glycosyltransferase	NA	NA	NA	NA
WP_168783680.1\|3062452_3063601_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.4e-40	34.4
WP_036704844.1\|3063719_3064181_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	6.3e-16	40.6

DBSCAN-SWA_222

3079056 : 3085526

Brevibacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783689.1\|3079056_3080142_-	tyrosine recombinase	A0A0K2CP59	Brevibacillus_phage	4.2e-26	26.7
WP_168783690.1\|3080149_3081931_-	hypothetical protein	NA	NA	NA	NA
WP_036734582.1\|3082439_3082976_+	shikimate kinase	NA	NA	NA	NA
WP_168783691.1\|3082972_3084073_+	3-dehydroquinate synthase	A9YVT7	Ostreococcus_tauri_virus	6.3e-22	30.7
WP_168783692.1\|3084163_3084706_+	single-stranded DNA-binding protein	A0A0U2C0X4	Paracoccus_phage	8.7e-49	81.0
WP_036703643.1\|3084866_3085526_+	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	5.3e-24	46.0

DBSCAN-SWA_223

3092050 : 3093709

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036703637.1\|3092050_3093709_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.2e-146	49.3

DBSCAN-SWA_224

3107842 : 3109333

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783705.1\|3107842_3109333_+	acyl--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	2.7e-23	28.7

DBSCAN-SWA_225

3130133 : 3131243

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783721.1\|3130133_3131243_+	PhoH family protein	H6X2N1	Pseudomonas_phage	1.6e-44	44.7

DBSCAN-SWA_226

3135883 : 3137443

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036732517.1\|3135883_3137443_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.4e-12	29.2

DBSCAN-SWA_227

3146933 : 3176139

Acidithiobacillus_phage(43.75%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036713111.1\|3146933_3148079_+	alanine--glyoxylate aminotransferase family protein	A0A0N9QIZ2	Chrysochromulina_ericina_virus	1.2e-63	37.1
WP_168781936.1\|3148463_3149653_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168783728.1\|3149774_3150491_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_168783729.1\|3150487_3153712_-	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	3.2e-66	27.5
WP_168783730.1\|3153708_3154548_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_168783731.1\|3154544_3155822_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_168783732.1\|3155814_3157332_-	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	6.3e-81	37.5
WP_168783733.1\|3157331_3157922_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_041375641.1\|3158004_3158391_-	bacteriophage-like protein	K4HZX2	Acidithiobacillus_phage	4.6e-12	36.0
WP_168781936.1\|3158599_3159789_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.7e-49	43.7
WP_168783734.1\|3160987_3161443_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	1.3e-21	45.0
WP_168783735.1\|3161766_3162498_-	hypothetical protein	NA	NA	NA	NA
WP_168783736.1\|3162499_3163177_-	helix-turn-helix domain-containing protein	A0A291AUK0	Sinorhizobium_phage	3.3e-13	38.4
WP_168781932.1\|3163293_3163977_+	hypothetical protein	NA	NA	NA	NA
WP_168783737.1\|3164179_3164476_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_168783738.1\|3164469_3164823_+	hypothetical protein	NA	NA	NA	NA
WP_168783739.1\|3164858_3165341_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	4.7e-22	40.3
WP_168783740.1\|3165445_3166303_+	ATP-binding protein	K4HZX9	Acidithiobacillus_phage	6.4e-62	46.7
WP_168783741.1\|3166325_3167090_+	hypothetical protein	K4ICM8	Acidithiobacillus_phage	1.3e-21	39.3
WP_168783742.1\|3167169_3167400_+	hypothetical protein	NA	NA	NA	NA
WP_168783774.1\|3167357_3167768_+	hypothetical protein	NA	NA	NA	NA
WP_168782151.1\|3167780_3168203_+	HNH endonuclease	A0A0B4N249	Escherichia_phage	1.5e-24	44.0
WP_168782150.1\|3168199_3168415_+	hypothetical protein	NA	NA	NA	NA
WP_168783743.1\|3168411_3169209_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	2.3e-66	54.8
WP_168782148.1\|3169205_3169955_+	hypothetical protein	NA	NA	NA	NA
WP_168782147.1\|3169951_3171271_+	AAA family ATPase	A0A0F6SJ43	Sinorhizobium_phage	1.0e-63	37.3
WP_168783744.1\|3171279_3173871_+	P-loop ATPase	A0A2D1GN57	Marinobacter_phage	6.0e-79	42.3
WP_168782145.1\|3173902_3174967_-	hypothetical protein	NA	NA	NA	NA
WP_168783974.1\|3175617_3176139_+	crossover junction endodeoxyribonuclease RuvC	K4ICN3	Acidithiobacillus_phage	1.5e-50	65.1

DBSCAN-SWA_228

3181489 : 3184228

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_036707940.1\|3181489_3184228_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	1.6e-21	29.0

DBSCAN-SWA_229

3193529 : 3195892

Paenibacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_165456312.1\|3193529_3193745_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	9.1e-10	42.9
WP_081962565.1\|3193753_3194542_+	IS66 family insertion sequence element accessory protein TnpB	A0A1W6JT88	Pseudomonas_phage	3.4e-38	44.1
WP_036707950.1\|3194616_3194952_+	DUF2190 family protein	NA	NA	NA	NA
WP_036707952.1\|3194951_3195263_+	hypothetical protein	NA	NA	NA	NA
WP_036707954.1\|3195259_3195892_+	hypothetical protein	G8DH49	Emiliania_huxleyi_virus	9.8e-52	52.9

DBSCAN-SWA_230

3200151 : 3204561

Dinoroseobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_168783748.1\|3200151_3200586_+	peptidase	A0A1V0DYB6	Dinoroseobacter_phage	1.6e-29	45.9
WP_168783749.1\|3200595_3204561_+	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	1.3e-263	43.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP051543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP051542

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection