CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP051625	Pseudomonas sp. gcc21 chromosome, complete genome	2 crisprs	DinG,DEDDh,WYL,cas3,csa3	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051625_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051625_1

675831-675973

Orphan

Consensus_repeat	Method
CTATAGTTATCGCCTGCGGCCGGGTGCTTGCCGCCGAACTTACAGATCCGTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051625_1

>merge|NZ_CP051625|1|675831-675973|CRISPRCasFinder
CTATAGTTATCGCCTGCGGCCGGGTGCTTGCCGCCGAACTTACAGATCCGTTTGGCACTTTGAGGGGGAACTGGTCTGCGCTGCTGCGGACTATAGTTATCGCCTGCGGCCGGGTGCTTGCCGCCGAACTTCAGATCCGTTTA

>NZ_CP051625|1|1|675831-675973|CRISPRCasFinder
CTATAGTTATCGCCTGCGGCCGGGTGCTTGCCGCCGAACTTACAGATCCGTTT	GGCACTTTGAGGGGGAACTGGTCTGCGCTGCTGCGGA
CTATAGTTATCGCCTGCGGCCGGGTGCTTGCCGCCGAACTTCAGATCCGTTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051625.1\|WP_169406310.1\|681136_681316_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051625.1\|WP_169406302.1\|674474_674879_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319965
NZ_CP051625.1\|WP_169406297.1\|667947_668679_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP051625.1\|WP_169406298.1\|668691_669771_-\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|132849
NZ_CP051625.1\|WP_169406305.1\|677654_677918_+\|glutaredoxin-family-protein	unknown	unknown	gnl\|CDD\|368604
NZ_CP051625.1\|WP_169406309.1\|680696_680915_-\|DUF2061-domain-containing-protein	unknown	unknown	gnl\|CDD\|225746
NZ_CP051625.1\|WP_169406307.1\|678505_679273_-\|VacJ-family-lipoprotein	unknown	unknown	gnl\|CDD\|377309
NZ_CP051625.1\|WP_169406295.1\|666793_667282_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|223862
NZ_CP051625.1\|WP_169408995.1\|666059_666731_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|225374
NZ_CP051625.1\|WP_169406301.1\|673157_674375_+\|argininosuccinate-synthase	unknown	unknown	gnl\|CDD\|234785
NZ_CP051625.1\|WP_169406312.1\|682061_682775_-\|electron-transport-complex-subunit-E	unknown	unknown	gnl\|CDD\|237091
NZ_CP051625.1\|WP_169406308.1\|679265_680564_-\|serine/threonine-protein-kinase	unknown	unknown	unknown
NZ_CP051625.1\|WP_169406299.1\|670044_671277_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP051625.1\|WP_169406311.1\|681424_682060_-\|endonuclease-III	unknown	unknown	gnl\|CDD\|182661
NZ_CP051625.1\|WP_169406303.1\|674898_675789_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051625.1\|WP_169406313.1\|682767_683421_-\|electron-transport-complex-subunit-RsxG	unknown	unknown	gnl\|CDD\|179350
NZ_CP051625.1\|WP_169406306.1\|677920_678373_+\|YcgN-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|235356
NZ_CP051625.1\|WP_169406304.1\|676199_677528_-\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|234897
NZ_CP051625.1\|WP_169406300.1\|671630_672950_+\|TRAP-transporter-large-permease-subunit	unknown	unknown	gnl\|CDD\|224967
NZ_CP051625.1\|WP_169406296.1\|667300_667951_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616

Protein	Function_ID	Function_description	E-value
NZ_CP051625.1\|WP_169406302.1\|674474_674879_+\|lactoylglutathione-lyase	gnl\|CDD\|319965	cd16358, GlxI_Ni, Glyoxalase I that uses Ni(++) as cofactor. This family includes Escherichia coil and other prokaryotic glyoxalase I that uses nickel as cofactor. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic glyoxalase I uses nickel. However, eukaryotic Trypanosomatid parasites also use nickel as a cofactor, which could possibly be explained by acquiring their GLOI gene by horizontal gene transfer. Human glyoxalase I is a two-domain enzyme and it has the structure of a domain-swapped dimer with two active sites located at the dimer interface. In yeast, in various plants, insects and Plasmodia, glyoxalase I is four-domain, possibly the result of a further gene duplication and an additional gene fusing event.	5.21363e-76
NZ_CP051625.1\|WP_169406297.1\|667947_668679_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	6.50262e-16
NZ_CP051625.1\|WP_169406298.1\|668691_669771_-\|patatin-like-phospholipase-family-protein	gnl\|CDD\|132849	cd07210, Pat_hypo_W_succinogenes_WS1459_like, Hypothetical patatin similar to WS1459 of Wolinella succinogenes. Patatin-like phospholipase. This family predominantly consists of bacterial patatin glycoproteins. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates.	0.00638004
NZ_CP051625.1\|WP_169406305.1\|677654_677918_+\|glutaredoxin-family-protein	gnl\|CDD\|368604	pfam05768, DUF836, Glutaredoxin-like domain (DUF836). These proteins are related to the pfam00462 family.	2.94834e-17
NZ_CP051625.1\|WP_169406309.1\|680696_680915_-\|DUF2061-domain-containing-protein	gnl\|CDD\|225746	COG3205, COG3205, Predicted membrane protein [Function unknown].	7.46693e-24
NZ_CP051625.1\|WP_169406307.1\|678505_679273_-\|VacJ-family-lipoprotein	gnl\|CDD\|377309	pfam04333, MlaA, MlaA lipoprotein. MlaA is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. MlaA is required for the intercellular spreading of Shigella flexneri. It is attached to the outer membrane by a lipid anchor.	3.63552e-84
NZ_CP051625.1\|WP_169406295.1\|666793_667282_+\|C40-family-peptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	1.45765e-34
NZ_CP051625.1\|WP_169408995.1\|666059_666731_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|225374	COG2818, Tag, 3-methyladenine DNA glycosylase [DNA replication, recombination, and repair].	5.43133e-48
NZ_CP051625.1\|WP_169406301.1\|673157_674375_+\|argininosuccinate-synthase	gnl\|CDD\|234785	PRK00509, PRK00509, argininosuccinate synthase; Provisional.	0
NZ_CP051625.1\|WP_169406312.1\|682061_682775_-\|electron-transport-complex-subunit-E	gnl\|CDD\|237091	PRK12405, PRK12405, electron transport complex RsxE subunit; Provisional.	1.23895e-119
NZ_CP051625.1\|WP_169406299.1\|670044_671277_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	8.21363e-152
NZ_CP051625.1\|WP_169406311.1\|681424_682060_-\|endonuclease-III	gnl\|CDD\|182661	PRK10702, PRK10702, endonuclease III; Provisional.	8.41066e-126
NZ_CP051625.1\|WP_169406296.1\|667300_667951_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.02178e-19
NZ_CP051625.1\|WP_169406313.1\|682767_683421_-\|electron-transport-complex-subunit-RsxG	gnl\|CDD\|179350	PRK01908, PRK01908, electron transport complex protein RnfG; Validated.	3.58387e-84
NZ_CP051625.1\|WP_169406306.1\|677920_678373_+\|YcgN-family-cysteine-cluster-protein	gnl\|CDD\|235356	PRK05170, PRK05170, YcgN family cysteine cluster protein.	4.70826e-82
NZ_CP051625.1\|WP_169406304.1\|676199_677528_-\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|234897	PRK01096, PRK01096, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
NZ_CP051625.1\|WP_169406300.1\|671630_672950_+\|TRAP-transporter-large-permease-subunit	gnl\|CDD\|224967	COG2056, COG2056, Predicted permease [General function prediction only].	0

>NZ_CP051625.1|WP_169406303.1|674898_675789_+|hypothetical-protein
MVLGTVALALLILLTASLLLHSRRKRMHERGQACVRELERIACLRQLLELVQQHRGLSFGEMSGEGSWQARRWAVHQEVSGQLVRCQAHEGSLQWYPGWHQALARWAQIESAQQQEVSAETSLRLHNRMLALLLEVIRDIADRHDLECLGGLATQPVGCWLQLLEHTELLGQARAIGSGILVRRADDSTLRTELEALRMRIAEQAYLPLAQLHADPSLRQHMTTKVQEAEDCLDRLLELIDQLLAAEGGNRLRAATFFQTATHAITAHLVLVDQLLQRLTMANRGEVREPRKPESP
>NZ_CP051625.1|WP_169406302.1|674474_674879_+|lactoylglutathione-lyase
MRLLHIMLRVGNLDKSVAFYTEVLGMTLLRRKDYPEGRFTLAFVGYGNEAENAVLELTHNWDTDHYVLGTGYGHIAIEVHDVYKACEQIREAGGKVVREPGPMKHGTSVLAFVEDPDGYRIELLSDRSEQPDAS
>NZ_CP051625.1|WP_169406301.1|673157_674375_+|argininosuccinate-synthase
MTDVKKVVLAYSGGLDTSVILKWLQDTHNCEVVTFTADLGQGEEVEPARAKAQAMGVKEIYIDDLREEFVRDFVFPMFRANTVYEGEYLLGTSIARPLIAKRLIEIANETGADAISHGATGKGNDQVRFELGAYALKPGVKVIAPWREWDLLSREKLMDYAAKHGIPIERHGKKKSPYSMDANLLHISYEGGVLEDTWAEHEEDMWRWTKSPEAAPDTPTYIELTYSKGDIVAIDGKQMSPAEVLTYLNKVGGENGIGRLDIVENRFVGMKSRGCYETPGGTIMLKGHRAIESICLDREVAHLKDSLMPKYAELIYNGFWWSPERVMMQQMIDASQLDVNGVVRLKLYKGNVIVTGRKSDDSLFDAAIATFEDDAGAYDQADAAGFIKLNALRMRIAASKGRKLL
>NZ_CP051625.1|WP_169406300.1|671630_672950_+|TRAP-transporter-large-permease-subunit
MNAVVIAVAVMLVLSLCRVHVVVALILGAVTGGLVGGLGLEATLEAFQNGLGKGANVALSYALLGAFAVAIAKSGLAHALADRALGMISQRNEAGHGLLKIMLLGVILAVALSSQNILPIHIAFIPLLIPPLLMVMAKLNLDRRLVACVLTFGLITPYMFLPVGFGGIFLNDILLANLTESGADVSEVNVMQAMGLPALGMLCGLLVAIFISYRRPRSYDVSRIEQTGGESVSYNPLSLVVALLAVAAAFVVQLLLDSMIIGALTGFVIFSVSGVVRWREADDVFTEGMKMMAMIGFIMIAAAGFAEVMRATGSIETLVASSAEMIGDSKGLATLLMLLVGLLITLGIGSSFSTIPIIAAIYVPLALQLGFSPLAIVALVGTAAALGDAGSPASDSTLGPTAGLNVDGQHNHIWDTVVPTFLHYNLPLIAFGWLAVMVL
>NZ_CP051625.1|WP_169406299.1|670044_671277_-|OprD-family-porin
MKKLGKPSALAAAVALSLTLPSSPGALASPFVDDASGSLQLRNYYFNRDFRDTGARPQAEEWAQGFIFRGKSGYSHGDQGLGLDVHAALGLKLASDDDHAGTALLPNALGDEGPDSYSHITFTAKAKISETELKVGGLTPSVPVLQASDIRLLPQTYTGAALTMNEISGLALQAAQLREFNQLNSTNREDMIANIGGTSDRFNYFGGAYTFPAQSSDSTTLGLWRGDLDGVYDQNMINLLHNMTLGDWKVGANLAYFDSDIEAGSTDNKMKSVMLSAGTGAHTFRLGYQHSDGDSAFPYIALSNPYVANYIQILDFGRPDEKSWQARYDLDFATLGVPGLKGLVRYVSGDNIDIAVADKEWERDIDFTYTVQNGPLKNVSIQWRNAMVRSDVAGDIDENRLILNYTIALR
>NZ_CP051625.1|WP_169406298.1|668691_669771_-|patatin-like-phospholipase-family-protein
MVAIHVPSPALTLRAGHSAIEHIRQNGLQPTDVHMIPGAAGGPKALGIQGLDLALFGDWLPRADQPRSLIGASIGSWRFAAACLPDAVAGIKRLGELYTTQRFPRGISVAEISLRCGVMLDDLLGNEFEQLLRNPLYYLNVVVVRSLGLLQHDSRSRLALGLGGVMGANLLGRRFLKRHFERVILHDPRLQPPLAALVDFNSTHVHLSPANMRQALLASGSIPMVMEAVRDIPGMATGAYRDGGLLDYHLDLPYQAPGVVLYPHFIDRIVPGWFDKTLPWRRGNLQQLKDVLLMAPSREYLASLPYGKLPDRKDFTRFMDDDLSRERYWRTAMAESARLGDEFLELAESGQLIDRIQPL
>NZ_CP051625.1|WP_169406297.1|667947_668679_-|CPBP-family-intramembrane-metalloprotease
MALPRPSRSALDDGLILMRLAVLYSALGLISHYFAAWTMRQVGQQFHIDSQFLMLDALFAASVMLGSLLIAWLLQPAAPLRWLFGAHISLRGVLLAVLGATVMVYAAEPLAGWFDLRLPDSVLLPEDQARPQAVTPLLDLTGSRLFAALLIAVLWVPAAEELIFRGWLFKALAQTRPGVLVALPASTLIFALLHGFYSPGGVLVIGLLGLFLGWLRWRYDQLWLCVLAHAVYNGLTLLMVAIQ
>NZ_CP051625.1|WP_169406296.1|667300_667951_-|class-I-SAM-dependent-methyltransferase
MKPVAYSCPLCSAPTSPYCTDRRRAYYHCAVCGLVHVPADWHLDTQAERAIYDLHENDTDEPGYRRFLSRVTEPLLARLQPGSEGLDFGCGPAPALAAMLSEQSHRVALHDIYYHPAPEALERAWDFITATEVVEHLARPACELDRLWRCLKPGGWLAIMTKRVRDQQAFQTWHYKNDLTHISFFSNQTFEWLAERWEAELEIVGADVVMLRKRAQ
>NZ_CP051625.1|WP_169406295.1|666793_667282_+|C40-family-peptidase
MRLPGFMMLAATLVIAGCSSAPTTHAPQVSAAPPAPSGQAYDDVIFHAFSLLGTPYRYGGMSPDTGFDCSGLINYVYRESAGVSLPRTTSGLSALPARRSDSLQPGDLVLFSMQGRKVNHAGIYVGDGRFLHAPSTGGHVRVDNLHASHWQRWFSGSRRVLD
>NZ_CP051625.1|WP_169408995.1|666059_666731_+|DNA-3-methyladenine-glycosylase-I
MRTYSWLEEYCLNRFGSRAALEARLPVPATDDQLRRLSNDRYLSTLALRVFRAGLKHSLVDAKWPAFEQAFFGFDPEKVVLMGAEHIERMMQDTRLIRHLGKLRSVPRNAQMILDISAEHGSMGNFIADWPVTDITGLWRLIARRGNQMGGLSAPRYLRMLGKDTFVPSNDVVAALKAQGVVDKVPSSQRDLAATQAAFNQWHAESGRPMSQLSVMLGHTVNH
>NZ_CP051625.1|WP_169406304.1|676199_677528_-|deoxyguanosinetriphosphate-triphosphohydrolase
MDWETLLCRERLGKPAASSDELGRTPFHKDHDRVIFSGAFRRLGKKTQVHPVSSNDHIHTRLTHSLEVGCVGRSLGMRVAEMLRGELPEWCEPADIGVIVQAACLAHDIGNPPYGHSGEDAIRHWFHQAENQGWLDPLTDAQKLDFLNFEGNAQGFRVLTQLEYHQFEGGMRLTYATLGAYLKYPWTSRYADSPGYKKHKFGCYQGEFALLEQIAAKLGLPAQDEHSWARHPLVYLVEAADDICYALIDLEDGLEMELLAYSEVEGLLLDLVGDDLPETYRQLGPMDSTRRKLAILRGKAIEHLVNAAAEAFVEQQPALLAGKLPGDLVEHMPARARHCVLEAKSIARKKIFQDKRKTLHEIGAYSTLETLLDAFCGAVNELHTGSHLSFKHERILDLMGNNAPRQDWDLYSSYMRVIDFIAGMTDLYAADIAARIRGINPG
>NZ_CP051625.1|WP_169406305.1|677654_677918_+|glutaredoxin-family-protein
MSSALTITLYGTTACHLCEAAAALLQPFVGNGVRVNEVDITEDPALMERYQLRIPVLKREDTGDELDWPVSFEQLILWLSDVIGEEA
>NZ_CP051625.1|WP_169406306.1|677920_678373_+|YcgN-family-cysteine-cluster-protein
MAERVRDFWKRKTLAEMDQQEWESLCDGCGLCCLQKLEDEDDPAAIYYTRVACKLLDRDSCQCSDYQNRRKQVPDCIQLTPKDAKDFGWLPPTCAYRLVAEGDDLPPWHHLVCGNRQAVHQVGVSQAGRMLAEGAVDEDDWEDHIIFRVG
>NZ_CP051625.1|WP_169406307.1|678505_679273_-|VacJ-family-lipoprotein
MNKLAAATAFALLASTSVQAQTANAPQYRDPLETLEINREATEYQFERSSLRALKVHDPIEGFNRRVYRFNARFDEYVYLPVVRGYVWATPRFLRTGVSNVFSNLGDVSNLANSLAQGRIQKSARTTSRLLLNTTLGVLGIFDVARAMGLPQESEDFGQTLGTYGVPPGPYLVIPFLGPSSLRDGTGRLGDWAIQDEVDFLNNREHKNEHKWSYGLQAVDLRYRTPFRYGALDSPFEYDQVRYLYTKLRELQISQ
>NZ_CP051625.1|WP_169406308.1|679265_680564_-|serine/threonine-protein-kinase
MKRIIATATLSIALFGHCAAQAEDFSYSEENAFMATIASTPPQQAAPVPAEVDVQQDNLSVRVLPDRALPPVLSGFDELDFRLAWQDEPAPLMFLIAGTGSGFDTARMDYLKRVFWQAGMHVIVLSSPTNHDFIAAASRSGLPGLGRRDARDLHTAMSMAVEKARETKGIEITEYHMAGFSLGALNAAFVGELDQQLGQFDFSKIVLLNPPVDLYTSVTRLDALPYTRVEGVDGTDNFYEHIFDKLSRYYAKRGTIDVQAGLFAEIQASDEALTDAELAMLIGAVFRFAAADLSFMSDVINRGGLYVPVDEKLKVSTSLTPYLRQALFCNFRCYMETQLYPDWQTRNADQSIEDMSQESSLRSIEDYLRDNRDIAMVTNADDFILTRENYQYLAELFGERAFIYPRGGHGGNLQHKDVVARILSFVEATDNE
>NZ_CP051625.1|WP_169406309.1|680696_680915_-|DUF2061-domain-containing-protein
MVKTATFALMHFSIAFCVVYAMTGSWLLGGAVALVEPAVNTVAYYFHERLWQRIEYRKLLRRERTSQPMMHA
>NZ_CP051625.1|WP_169406310.1|681136_681316_-|hypothetical-protein
MAKAKVELELDDDDFVEEDDAPEADSAPNSKASLTKRRLIDNYLEERRLQKQLTDYDFE
>NZ_CP051625.1|WP_169406311.1|681424_682060_-|endonuclease-III
MNKAKRYEIFRRLREDNPNPTTELNFSTPFELLVAVTLSAQATDVGVNKATAKLFPVANTPEAIYALGVDGLSEYIKTIGLYNTKARNVIAACKMLIDLHGGQVPEDRAALEALPGVGRKTANVVLNTAFGHPEMAVDTHIFRVSNRTRIAPGKNVVEVEKQLLKHVPKEFLVDAHHWLILHGRYVCKARKPLCGSCLIEDLCEYKAKTED
>NZ_CP051625.1|WP_169406312.1|682061_682775_-|electron-transport-complex-subunit-E
MASTRFSDITADGLWHNNPGLVQLLGLCPLLGVSSTAVNALGLGLATILVLTGSNLAVSIIRSAVTDAVRLPAFVMIIAALTTCVELLMQAFTYELYQILGIFIPLIVTNCAILGRADAYAAKHPVLPSLLDGFMMGLGFALVLLVLGSLRELVGYGTLFSGMDLLLGPFAADWRVVVFPNYKEVLFVILPPGAFVFMGLLIALKNVIDARVAERAAAQAAQPTAGGKRVRVTGTIS
>NZ_CP051625.1|WP_169406313.1|682767_683421_-|electron-transport-complex-subunit-RsxG
MENPATAGHSVLRNSIILGIFAMVTVGLIAVTQQSTADRIAEEIRRAQMSALTEILPAEQHDNDMLNDTFMVDDREFLNLRGPAEAYRGRQDGQVVAVILPVIAPDGYSGRIDLLVGIRADGELAGVRVLNHRETPGLGDKVEVAKSPWILNFDGKSLSMPAPENWGVRKDGGAFDQFTGATITPRAVVQAVYRALQYFDENRDSLLELSNQEPANG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051625_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051625_2

1512054-1512144

Unclear

Consensus_repeat	Method
GCATCGCCCCGGGTCGGGCCTCCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051625_2

>merge|NZ_CP051625|2|1512054-1512144|CRISPRCasFinder
GCATCGCCCCGGGTCGGGCCTCCCACGGGTTGGTACCGTGTTTGGTTTGATGGTCGGAGTTTCCTGCATCGCCCCGAGTCGGGCCTCCCAC

>NZ_CP051625|2|2|1512054-1512144|CRISPRCasFinder
GCATCGCCCCGGGTCGGGCCTCCCAC	GGGTTGGTACCGTGTTTGGTTTGATGGTCGGAGTTTCCT
GCATCGCCCCGAGTCGGGCCTCCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051625.1\|WP_169407002.1\|1512758_1513031_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|377579
NZ_CP051625.1\|WP_169407005.1\|1516296_1516734_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
NZ_CP051625.1\|WP_169407001.1\|1512478_1512769_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP051625.1\|WP_169407007.1\|1519507_1520617_+\|capsular-biosynthesis-protein	unknown	unknown	gnl\|CDD\|237903
NZ_CP051625.1\|WP_169407004.1\|1514147_1515554_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|224157
NZ_CP051625.1\|WP_169406995.1\|1504028_1505021_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340825
NZ_CP051625.1\|WP_169406997.1\|1506176_1507523_-\|O-antigen-ligase-family-protein	unknown	unknown	gnl\|CDD\|377422
NZ_CP051625.1\|WP_169407000.1\|1510057_1511887_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_CP051625.1\|WP_169406994.1\|1503134_1504022_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340836
NZ_CP051625.1\|WP_169407008.1\|1520629_1521289_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378557
NZ_CP051625.1\|WP_169406993.1\|1501623_1502928_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224458
NZ_CP051625.1\|WP_169406991.1\|1499266_1500403_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	unknown	unknown	gnl\|CDD\|223458
NZ_CP051625.1\|WP_169407009.1\|1521285_1522071_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368817
NZ_CP051625.1\|WP_169406996.1\|1505169_1506174_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340838
NZ_CP051625.1\|WP_169407006.1\|1516763_1518971_+\|polysaccharide-biosynthesis-tyrosine-autokinase	unknown	unknown	gnl\|CDD\|183173
NZ_CP051625.1\|WP_169407003.1\|1513419_1513926_-\|transcription/translation-regulatory-transformer-protein-RfaH	unknown	unknown	gnl\|CDD\|131010
NZ_CP051625.1\|WP_169409039.1\|1519083_1519428_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051625.1\|WP_169406999.1\|1508794_1510030_-\|oligosaccharide-flippase-family-protein	unknown	unknown	gnl\|CDD\|225153
NZ_CP051625.1\|WP_169406992.1\|1500402_1501620_-\|UDP-N-acetyl-D-mannosamine-dehydrogenase	unknown	unknown	gnl\|CDD\|182940
NZ_CP051625.1\|WP_169406998.1\|1507655_1508798_-\|polysaccharide-pyruvyl-transferase-family-protein	unknown	unknown	gnl\|CDD\|377253

Protein	Function_ID	Function_description	E-value
NZ_CP051625.1\|WP_169407002.1\|1512758_1513031_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|377579	pfam05973, Gp49, Phage derived protein Gp49-like (DUF891). This family consists of hypothetical bacterial proteins of unknown function as well as phage Gp49 proteins.	2.204e-23
NZ_CP051625.1\|WP_169407005.1\|1516296_1516734_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	4.40353e-61
NZ_CP051625.1\|WP_169407001.1\|1512478_1512769_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.73057e-13
NZ_CP051625.1\|WP_169407007.1\|1519507_1520617_+\|capsular-biosynthesis-protein	gnl\|CDD\|237903	PRK15078, PRK15078, polysaccharide export protein Wza; Provisional.	1.09814e-91
NZ_CP051625.1\|WP_169407004.1\|1514147_1515554_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|224157	COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis].	2.22456e-90
NZ_CP051625.1\|WP_169406995.1\|1504028_1505021_-\|hypothetical-protein	gnl\|CDD\|340825	cd03794, GT4_WbuB-like, Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.	1.91943e-11
NZ_CP051625.1\|WP_169406997.1\|1506176_1507523_-\|O-antigen-ligase-family-protein	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	5.09265e-06
NZ_CP051625.1\|WP_169407000.1\|1510057_1511887_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_CP051625.1\|WP_169406994.1\|1503134_1504022_-\|hypothetical-protein	gnl\|CDD\|340836	cd03807, GT4_WbnK-like, Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.	0.000198804
NZ_CP051625.1\|WP_169407008.1\|1520629_1521289_+\|hypothetical-protein	gnl\|CDD\|378557	pfam11102, YjbF, Group 4 capsule polysaccharide lipoprotein gfcB, YjbF. This family includes lipoprotein GfcB (YmcC), involved in group 4 capsule polysaccharide formation. YjbF is a family of Gram-negative bacterial outer-membrane lipoproteins, predicted to be a beta-barrel and possibly a porin that is one of four gene-products expressed from an operon, yjbEFGH, which is regulated by the Rcs phosphorelay in a RcsA-dependent manner, similar to that of other exopolysaccharide biosynthetic pathways. It is highly possible that the yjbEFGH operon encodes a system involved in EPS secretion since none of the products is predicted to have enzymic activity, the products are all secreted and YbjF and H are predicted to be beta-barrel lipoproteins similar to porins. It may be that the operon products play some role in biofilm formation and/or matrix production.	1.5684e-29
NZ_CP051625.1\|WP_169406993.1\|1501623_1502928_-\|hypothetical-protein	gnl\|CDD\|224458	COG1541, PaaK, Coenzyme F390 synthetase [Coenzyme metabolism].	2.01651e-09
NZ_CP051625.1\|WP_169406991.1\|1499266_1500403_-\|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)	gnl\|CDD\|223458	COG0381, WecB, UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane].	0
NZ_CP051625.1\|WP_169407009.1\|1521285_1522071_+\|hypothetical-protein	gnl\|CDD\|368817	pfam06251, Caps_synth_GfcC, Capsule biosynthesis GfcC. Many bacteria are covered in a layer of surface-associated polysaccharide called the capsule. These capsules can be divided into four groups depending upon the organisation of genes responsible for capsule assembly, the assembly pathway and regulation. This family plays a role in group 4 capsule biosynthesis. These proteins have a beta-grasp fold. Two beta-grasp domains, D2 and D3, are arranged in tandem. There is a C-terminal amphipathic helix which packs against D3. A helical hairpin insert in D2 binds to D3 and constrains its position, a conserved arginine residue at the end of this hairpin is essential for structural integrity.	7.65762e-25
NZ_CP051625.1\|WP_169406996.1\|1505169_1506174_-\|glycosyltransferase	gnl\|CDD\|340838	cd03809, GT4_MtfB-like, glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.	1.16706e-21
NZ_CP051625.1\|WP_169407006.1\|1516763_1518971_+\|polysaccharide-biosynthesis-tyrosine-autokinase	gnl\|CDD\|183173	PRK11519, PRK11519, tyrosine-protein kinase Wzc.	0
NZ_CP051625.1\|WP_169407003.1\|1513419_1513926_-\|transcription/translation-regulatory-transformer-protein-RfaH	gnl\|CDD\|131010	TIGR01955, Transcriptional_activator_rfaH., transcription elongation factor/antiterminator RfaH. This model represents the transcription elongation factor/antiterminator, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes. [Transcription, Transcription factors].	1.93803e-53
NZ_CP051625.1\|WP_169406999.1\|1508794_1510030_-\|oligosaccharide-flippase-family-protein	gnl\|CDD\|225153	COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only].	2.5237e-08
NZ_CP051625.1\|WP_169406992.1\|1500402_1501620_-\|UDP-N-acetyl-D-mannosamine-dehydrogenase	gnl\|CDD\|182940	PRK11064, wecC, UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional.	0
NZ_CP051625.1\|WP_169406998.1\|1507655_1508798_-\|polysaccharide-pyruvyl-transferase-family-protein	gnl\|CDD\|377253	pfam04230, PS_pyruv_trans, Polysaccharide pyruvyl transferase. Pyruvyl-transferases involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora.	9.13025e-17

>NZ_CP051625.1|WP_169407000.1|1510057_1511887_-|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGAVAKRNITPILLEGLHRLEYRGYDSAGLAVLAEGNGLLRVRANGKVAELEAALQATPAIGHLGIAHTRWATHGKPAERNAHPHLSDRLAIVHNGIIENHAQLRKELIEAGYTFTSDTDTEVVAHLVAFHYSRKPDLLCAFRATLNQLHGAYALGLIHEDEPDTLYCARMGSPLVIGEGSEEHFIASDPLALLQVTDQFIYLEEGDYARLTLTSRDVWNRQNQPRNYPITRYEHAAHSMDKGEYRHYMLKEMYEQPAAIADTLSGILGENSVLTAGLGPDAETRFKDVQAIHIVACGTSYHAGLVARYWIEEQAGLPCQVEVASEFRYRRVSVPTNTLLITISQSGETADTLAALRYAKQQGYLASLAICNVAGSSLVREADWRLLTHAGPEIGVASTKAFTTQLVALLWLTTALAQANNRAPEMISANVRALRGLPALIQQTLALDSEIETLAATFANKHHALFLGRGTHYPIAMEGALKLKEISYIHAEAYAAGELKHGPLALVDEDMPVVSVAPSDSLLEKLKSNLQEVRARGGQLINFACERADLDDGEGITHIKMPWVYESVSPIVYTIPLQLLSYHVALVKGTDVDKPRNLAKSVTVE
>NZ_CP051625.1|WP_169406999.1|1508794_1510030_-|oligosaccharide-flippase-family-protein
MTLIRKAVANGLLPGVKIIVAFYLTRLILNSIGPVNFNVLKEVMALLSMTWVLQLGLNSYLTRRLPSLFKNGDERGQREIVSTVAFFYKSLAVLILLFGTVCVLFYVDDQNYKYAYFVCVVAYFFSTALSHQKAVLSSRQDFELIAKLEISSYLIFAAAMYVVCSYYDDYRYVFAISVVPIILPQLFMLVTLRKEAPVSMKLFSLSILKDSIKYSYANVLFTGAVLLITQMSFVFIVRILDTNQATGYVLAYQLITVYSSVVVLMLATLKPEYSKVYDSREILDNTIKKNVTIALLVLSLTYYSLLFAFIDDVILLWIGSDKYSVGRAELALLMIYNILYVMVYSEYIYLSSVDRHRHFGLGFFVLSVAASAFILLFVKDAKHILILVDIVAFSALMGARVVIKNSKKVVA
>NZ_CP051625.1|WP_169406998.1|1507655_1508798_-|polysaccharide-pyruvyl-transferase-family-protein
MNISIVGSFMTPNFGDELLLEVMVRRVREFYGEGSRIFVPYCFDDIKKMENVKYGGGDEDLLESDLAIFGGGGYLGENPAYQETPKNSRWWFDRNDDLFIFKVLRINRYIGKGIPKRQSIRSFYRYHNIVEKCKRNHIPYVIFGAGCGPLDSYINRIFVRSISKAARQVFLRDCESVKAFNSVSKKNDANQTCDIVLSELIEHIPTKQKVETVAFHIGQISSEAQLRAISEIIDFVSQKNVNIKLICDSFSIHQVIPSKELSAEKALLLSEYKGDTQSFVDEIKSADLLITTKLHAAIVAYSVGTIPISIPSHGKTRRFFKQIGMVDYCAPEYSVDPSQVKRVIDMVIRNPNSSIVKMQGSRVALKTLVLTQISDCFRGV
>NZ_CP051625.1|WP_169406997.1|1506176_1507523_-|O-antigen-ligase-family-protein
MINKMKLGDFLFLCWWGVVVLNSITDLGYLYALCWLVLVIGLLFIDYKYGLILIGSTFYLPSTPSTLTSPFLLLHILTLLAVVGSGTPRSISMFATKKIVPFGLFLVFSVVYSVLFFDSALAGGVGHYMSATLFLIVCFFLFEKIQNLDQIDFILKRVLVVAASSIAVALIHNYLGAESNLYQKILSTGDSEQFQMKLHTTSDKSVSRLIWPGVDPNFFASNLFVVLALSLYYSHKNRAFLLVAALIGMSVIGSYSRSAFITMVLMSFLLFLKGDNKKLVMVLVAALSVLAGIFAVDYVERILSISDNLANSGGSGRFERIGYGVAVVADNILGVGIGNVSQALWTGVMSEGWTTHNTYLQVLVESGILLFLLFICSLYHLLSTGCVIKSEPLIAYMKVGLLATLFFYVTIPVMDWRFFIFYVFIYVYAFRLSEEQPPVMVGPTINKV
>NZ_CP051625.1|WP_169406996.1|1505169_1506174_-|glycosyltransferase
MKVLFVSYPHVGLGKGGMARQINFTKQSLERIGHQVFVHNFLMDEFDSYDVCHVFGSHSSSKKVADHFRILDKPVVVSSVINMFGERTIKGRMKNALANKVPGFLTETKLSKLMLKSADCLIALNKQESALLVDFFDIPQENIRIIPNGIDINLSGGQSNTPKEQLVLCVGEVCERKNQLSLIKAFKNIDYDLALVGPMKDESYKLRCSVAAEGLPNIKFYGELAYGSEQMRTLYERAAVFCLPSISEVQPLTLIEAASFDCNLAVSNQFPLQPFLEQGTTKFHPMDTADITKAIAKAMGQSSYSRSSLIEQPTWEGVACELESIYKKLLEVPH
>NZ_CP051625.1|WP_169406995.1|1504028_1505021_-|hypothetical-protein
MGKLLVVVPNGLSDGVVSSQVFDKFEGVEDVIFFMRKAHQDSSALDLKSIALVSTFFEFVKELRASDIVYTRSVFDYLYVYFLVRCLLMKAKITIDVRGLVAEESRTRGRGNLRYLVLDSLQTFSVRSANIVETVSENMKKHLESRYPISVSRVTPCLVSKRKVRRKIIDEGNGALDVSRFIYVGSMSEWQRFDMVCKILSNFDSEYSLTVVTRQAVKATTILERFGLQANVVGGDWEVVREELDNADFGFICRDNNLVNVTASPIKFLEYAARGVIPIMTKWVGDYSDIFHDCAVVMEDGAFVNSSDLKKVYTQETLDLIHRKVSQYVW
>NZ_CP051625.1|WP_169406994.1|1503134_1504022_-|hypothetical-protein
MIRVVSTGGLPPPVGGVTVFLKYFSQAIRSKKHANHEFIKLRKLFLYHDSILHINCSNEVKRLVYVLIGKLFFDKVFIVKHGGEFELTSLLVKCSLFLVDGVFCLNQKVRDQLIGLGVKTFMHSTIFRENQFPGKVDSTRPTGREVLLYINNSSEKDRKSVYGADFILDCLDDIVAVCNLTIIDLSRSYRQKFEGRPGVSYIDEPQDFMRMVREFDLYIRPTRSDGMSVALLEAGLCGVKCLASDVVDRPGFVFTYELDNKDSFLGMLNYVLDYEGCPNVTGLSSIQDVLDVMRG
>NZ_CP051625.1|WP_169406993.1|1501623_1502928_-|hypothetical-protein
MLSILKKIYDGTPKKFLGFLKFTPDAILFGKKYRPTLDNITTKDYVAGRYLAETLNYARKYTQYGKDNIPRDVNEHNALAVLENLPLVSADELSQNLDYYASSEYGSLNSFITTTGGTGRRPTTIRIANELFGIEWAYVHSIWGVTGYSRKKHTKLTLRGKSLSDEKVVEYSPVYNEVVVDTFKLSFSNAHQLVSAFSRFNIKYIHGYPSLVLECIQYFRFLKFSPTLKGVFLVSEAADVHLKRRIKEFFSCPVVSFYGQSERALIAADFDASGHYKVFTSYGWPRVVGGELVVTSFVNRALPLINYKVGDGAQIVFRDDAVFLTDVTSRWGKDFVYLSKDKKISSAALNLHSAMQSEVLYYQIHQYEYGAIELRILPRHDTKLPFDEIRREIHDEFSRNLKDFRVSSRIVSDDEVEKSSRGKMMYLVQHLDVR
>NZ_CP051625.1|WP_169406992.1|1500402_1501620_-|UDP-N-acetyl-D-mannosamine-dehydrogenase
MNYEAKVCTLGLGYIGLPTSALIASNNIPVHGVDISQKVVDIINAGKIHIVEPDLDAAVGSAVSAGFLRADTKAVAADVYLVVVPTPFKGGSHEPDVSYIQAATESILPLLKEGDLYIIESTSPVGTTERMGDFIYARRPELKDKLYVAYCPERVLPGNVMYELVHNDRVIGGVDEASTQKACAFYQQFVKGELHRTNARTAEMCKLTENASRDVQIAFANELSLICDKAGIDVWELIHLANRHPRVTILQPGSGVGGHCIAVDPYFITSEFPMESQIIGKAREINNYKAFWCAEKVRHAIRDFAVQQGKAPSVALLGLAFKPNIDDLRQSPAVYIAQKVLQEAGDEAYFIVEPNIHEHAYYKITEVNQAVEHADIVVFLVAHKEFKQLEIPGDKVVLDFCGVTK
>NZ_CP051625.1|WP_169406991.1|1499266_1500403_-|UDP-N-acetylglucosamine-2-epimerase-(non-hydrolyzing)
MKVLSIFGTRPEAIKMAPLVKALAEDSYFDAKVCVTAQHREMLDQVLELFEITPDFDLDLMKGGQDLYDITSGVLLGLRDVLKDFQPDMVLVHGDTATTFATTLAAFYQQIPVGHVEAGLRTGNLYSPWPEEANRVLTGRLAAVHFAPTKRNQDALLHEHIAADTITVTGNTVIDALQWVVKKIEQSTELQANIQSALQDAGLKTDVLSNRYVLVTGHRRENFGEGFENICKALSQLAVANPETHFIYPVHLNPNVQEPVKRLLAGSSNVHLIQPLGYEPFVYLMKGAYLVLTDSGGVQEEAPGLGKPVLVMRDTTERPEAVEAGTVKLVGTNAEVIISAVQELIDDADQYERMSAAHNPYGDGKASQRILEFLKNLP
>NZ_CP051625.1|WP_169407001.1|1512478_1512769_-|helix-turn-helix-transcriptional-regulator
MSLNALKHEAFKNEAVRAEYDNLADEFELIDQLTSMRSKAGLTQEQLAKRIGTAKSNISRLERGRGNPSWETLKKYAHACGFRVKLEAVEDTGKIA
>NZ_CP051625.1|WP_169407002.1|1512758_1513031_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MSSSISTKTSQQHGPSPRGPCLTAHTKAMGNGLFELRAKAKEGIGRGFFCYMEGERIMVLHAFVKKDQKTPKKELELAKARLQEVKKHES
>NZ_CP051625.1|WP_169407003.1|1513419_1513926_-|transcription/translation-regulatory-transformer-protein-RfaH
MPTSITNPQWYVVQCKARQEARAEDNLRNQHIPCYRPVRTVEAIRHGKRVLIEEALFPGYVFVHLCRLTDSWHTIRSTRGVLRLVAFADTPVPVAPGLIDQIKQRLADTTDQPLFEPGSPVTLTEGPFKDLDAIFSKADGEERVIILLNVLQRQQALSVPLKTIRPAD
>NZ_CP051625.1|WP_169407004.1|1514147_1515554_-|MBL-fold-metallo-hydrolase
MPTEYPYIQHHGAVKGVTGSCHQLWLSPTASLLIDCGLFQGAETSGNGADANNLNVEFSLDSVKALIATHVHIDHIGRLPWLIAAGYKGPIHCTEPSALLMPTVLEDAFMVGIKRDANLADRFVSLVEQRLQGHPYKTWVPLIEEPELTCRIRFQRAGHILGSAYIECDIHYPATGRKRRIVFSGDLGAPHAPMLPAPKPPHRADVVVLESTYGNRNHENRRTRQARLKQVLEQALSDGGTVLVPAFSIGRTQELLYELEDILSTGTWRKLPIILDAPLATKFTALYRELKPYWNDEALKRVSQGRRPLTFDQLLTTESHAQHLAMVNRLAHTFQPAIVITGSGMCNAGRIINYLKAMLGDPRHNVLFVGYQAKGTPGHAIQQYGPTGGYVDLDGEVFDIKAGVHSIGGYSAHADQAGLVQFITGMRHGPEEVRLVHGDSQAKQILAAKLTEQSQTKGRQVKIVIPSQ
>NZ_CP051625.1|WP_169407005.1|1516296_1516734_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MFDSILIVCVGNICRSPTAEALLKNRLEGRNIKVSSAGLGALVGKPVEPNAAAVMAEAGLSLPMHRARQISARMIREADLILVMENRHIQSVYKLAPEARGKTFLFGRWLNNCEAPDPYRQARPAFVHVYKILEKAADAWLPYLK
>NZ_CP051625.1|WP_169407006.1|1516763_1518971_+|polysaccharide-biosynthesis-tyrosine-autokinase
MQNAVASPERNNGEIDLLALLGALLDHKWIIAACTGLFAVIGIAYALLTTPVYVATAVIQIEEKQAGISSLLGESDLLSTASPAVTEIELLKSRTVIGQAVDNLKLTVVAEPKLFPVIGPFVHRRFSPSADAPVADALLGFDSYAWGGEQLDVFQLEVPAAYVGKALTLRAETDNGYTLLDGEGSPLLTGAVGEAVVTDGFKVQIAELVARPGTEFLVSKKNRLSTVLAYQRAIGASEKGRDSGILSLSLESTKPEHAMRTLDEVSRLYVRQNVERKSAEAQQSLEFLQDQLPQVRRDLERAEEALNAYQASAGSVDISIETQSYLSQVVELETAISELRLRQEELQRRFTADHPSYQALMSQIAQQEERRDRILSRIGELPDTQQELLRLARDVQVSTEIYTQMLNKSQELDVMRAGTVGNVRIIDDAAVDTTQPVKPKKPLIVVLATLLGGMLGVAIALLKHALNRGIENPDLIEQLGLPVYASIPLSKDQEVLERSGTSKGGRRHHALLAKTNPADLAIESLRSLRTSLHFAMLESKNNVLMISGPSPQVGKSFVSANLAAVVAQAGQKVLLIDADMRKGYIHRLLGADPNIGLSGLLAKTHTLKQVVHETEVEGLHVISRGLIPPNPSELLMHANFEALIKYLSAHYDMVIVDTPPILAVTDAALVGRFCGTSLIVTRFGMSPAKEIQLTLQRFRNNGIEIKGAIFNAIEKKASAYGNYGYYQYEYKSETN
>NZ_CP051625.1|WP_169409039.1|1519083_1519428_+|hypothetical-protein
MATGLLLASSMSFAQTEEAAAAEAGGTTGTATGTTATGTATGTTTATGTAATGAAAGTGAAAVGGATIGGLSLTTVAVGAAAAGAAAAAASSGGGGSSSGTTGTTGTTGTTGTN
>NZ_CP051625.1|WP_169407007.1|1519507_1520617_+|capsular-biosynthesis-protein
MTLIPRAALGASILLLQACVFSPGMHMDKNDLMSQDSAESSMVELVEITPKLLAQDQTAARRLTIPQELLNFQPENYRIGANDALFITVWDHPELTVPGGNQQTDAANARIVRDDGTLFYPFIGNVQVAGLTLEELREIIASRLARFIEQPQVDVNVMEYNSQKIIVSGAFQNPGYLPVNAQQLTLLQAVGLAGIDPERADLSSLKLTREGRTYELDYDRLTSMPSEIGNVYMRAGDKLHLGLNDNRKIFVMGEVKTPRALPYRTSRMSLSEVLATVGGPSPETSSGREVYVIRGVENIETEKATVFQLDAKSPASFILAERFEMQPQDVVFVGAAGITRWNRFISQLFPSANIFRTTLEIDEDMTNRN
>NZ_CP051625.1|WP_169407008.1|1520629_1521289_+|hypothetical-protein
MKVLLLAGMSAAAALLMSGCTSVASSSYETLRLAISGPESIITADYVNSLDRPALSARLKQSEALLVLAARNDGVAEWHGRSQALVTQNGRLIQTAGLPDEADIIAPLAVADPFLQDLRALPEDVEVTRLVDFPGRYLTSVPQHARYRKGPVETLEIMGEQRALQRMDEIIRMPSISFRATNHYWFDPDTGNVLVSAQHLAPGFPPVHLVELTQSVGQP
>NZ_CP051625.1|WP_169407009.1|1521285_1522071_+|hypothetical-protein
MRRLAKPLVFLLGLGASLNCLAQSASPTVEISGVVLAPGTYSLSEGARLHDASSSAQVRSDAWPLGAALLRQSAVEPQVRLKAGVLFDLRINHVHAVADENPALEALVDRLIQAIEPLPVTGRVNAQLNPLQQLIPANDSLLEAGDRILYPHRPNHVTVIGAVEQDCKLAFVPAHQPVDYLKQCASSPVADRDTVYVIQPDGTLHSKGVAHWNAEPANVAVGAMIYVPIRTNQLSAQTSDLNQELAEFMATQYQLGGRFGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

866605 : 893494

Pseudomonas_phage(54.17%)

terminase,integrase,portal,protease,lysis

attL 862632:862650|attR 896117:896135

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
862632:862650	attL	NA	NA	NA	NA
WP_169406466.1\|866605_867745_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J1K3	uncultured_Caudovirales_phage	1.6e-129	64.7
WP_169406467.1\|867744_867978_-	hypothetical protein	A0A2H4JA17	uncultured_Caudovirales_phage	4.3e-29	79.2
WP_169406468.1\|867995_868250_-	hypothetical protein	NA	NA	NA	NA
WP_169406469.1\|868545_868875_-	restriction alleviation protein, Lar family	B4UTV4	Rhizobium_phage	5.7e-11	53.7
WP_169406470.1\|868871_869204_-	hypothetical protein	NA	NA	NA	NA
WP_169406471.1\|869230_869545_-	hypothetical protein	NA	NA	NA	NA
WP_169406472.1\|869519_870194_-	HNH endonuclease	NA	NA	NA	NA
WP_169406473.1\|870202_871036_-	N-6 DNA methylase	A0A2K9V411	Faecalibacterium_phage	4.0e-29	34.5
WP_169406474.1\|871056_871248_-	hypothetical protein	NA	NA	NA	NA
WP_169406475.1\|871280_871532_-	hypothetical protein	NA	NA	NA	NA
WP_169406476.1\|871528_872002_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_169406477.1\|872018_872453_-	DUF4406 domain-containing protein	S4TW22	Salmonella_phage	5.2e-20	47.8
WP_169406478.1\|872431_872671_-	hypothetical protein	NA	NA	NA	NA
WP_169406479.1\|872654_872840_-	hypothetical protein	NA	NA	NA	NA
WP_169406480.1\|872876_873062_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	3.5e-10	56.9
WP_169406481.1\|873072_873231_-	hypothetical protein	NA	NA	NA	NA
WP_169406482.1\|873382_873727_+	hypothetical protein	NA	NA	NA	NA
WP_169406483.1\|873910_874150_-	hypothetical protein	NA	NA	NA	NA
WP_169406484.1\|874236_874620_-	helix-turn-helix transcriptional regulator	A0A1W6JTA9	Pseudomonas_phage	1.1e-10	41.1
WP_169406485.1\|875538_876651_-	hypothetical protein	NA	NA	NA	NA
WP_169406486.1\|876758_877865_-	nucleoid-associated protein	NA	NA	NA	NA
WP_169406487.1\|877965_878739_-	S24 family peptidase	A0A0S2SYF7	Pseudomonas_phage	2.1e-35	38.9
WP_169406488.1\|878821_879052_+	hypothetical protein	A0A1W6JTD1	Pseudomonas_phage	1.8e-16	56.6
WP_169406489.1\|879264_879978_+	DNA-binding protein	A0A0U4J8Z7	Pseudomonas_phage	5.0e-44	48.4
WP_169406490.1\|879977_880727_+	hypothetical protein	A0A2I7RQ47	Vibrio_phage	1.9e-14	38.2
WP_169406491.1\|880729_881416_+	Replication protein P	A0A2H4J1T4	uncultured_Caudovirales_phage	1.5e-21	37.6
WP_169406492.1\|881537_882767_+\|integrase	site-specific integrase	A0A2D1GND4	Pseudomonas_phage	1.5e-109	50.1
WP_169406493.1\|882828_883173_+	hypothetical protein	A0A1X9SFK1	Acinetobacter_phage	9.5e-17	59.7
WP_169406494.1\|883372_883729_+	endodeoxyribonuclease RusA	A0A088F6Y8	Sulfitobacter_phage	8.6e-13	43.9
WP_169406495.1\|883725_884025_+	hypothetical protein	NA	NA	NA	NA
WP_169406496.1\|884027_884387_+	antitermination protein Q	B5WZY8	Pseudomonas_phage	3.4e-33	60.4
WP_169406497.1\|884770_884977_+	hypothetical protein	NA	NA	NA	NA
WP_169406498.1\|884973_885510_+	lysozyme	A0A0U4JP67	Pseudomonas_phage	1.3e-36	59.9
WP_169406499.1\|885430_885892_+\|lysis	lysis protein	I6WLR5	Burkholderia_virus	1.0e-13	39.4
WP_169406500.1\|885888_886623_+	hypothetical protein	NA	NA	NA	NA
WP_169406501.1\|886755_887298_+	DNA-packaging protein	A0A1B0Z033	Pseudomonas_phage	1.3e-49	59.1
WP_169406502.1\|887269_889240_+\|terminase	phage terminase large subunit family protein	A0A1B0Z2K0	Pseudomonas_phage	8.4e-243	60.0
WP_169406503.1\|889230_889449_+	primosomal replication protein PriB/PriC domain protein	A0A1B0YZU1	Pseudomonas_phage	6.2e-14	62.0
WP_169406504.1\|889445_891074_+\|portal	phage portal protein	A0A1W6JTB6	Pseudomonas_phage	1.3e-228	72.1
WP_169409002.1\|891090_893109_+\|protease	Clp protease ClpP	A0A1B0YZU0	Pseudomonas_phage	2.6e-223	65.4
WP_169406505.1\|893179_893494_+	DUF2190 family protein	A0A1W6JT93	Pseudomonas_phage	3.5e-18	55.9
896117:896135	attR	NA	NA	NA	NA

DBSCAN-SWA_2

3032009 : 3098336

uncultured_Caudovirales_phage(25.0%)

integrase,transposase

attL 3074630:3074645|attR 3103265:3103280

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169408234.1\|3032009_3033247_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.2e-107	70.7
WP_169408235.1\|3033258_3033699_-	hypothetical protein	NA	NA	NA	NA
WP_169408236.1\|3033780_3034644_+	sel1 repeat family protein	NA	NA	NA	NA
WP_169408237.1\|3034844_3035438_+	hypothetical protein	NA	NA	NA	NA
WP_169408238.1\|3035577_3036384_-	hypothetical protein	NA	NA	NA	NA
WP_169408239.1\|3039788_3045836_+	ATP-binding protein	NA	NA	NA	NA
WP_169408240.1\|3046335_3046932_-	hypothetical protein	NA	NA	NA	NA
WP_169408241.1\|3047367_3049317_+	NTPase KAP	NA	NA	NA	NA
WP_169408242.1\|3049748_3050168_+	hypothetical protein	NA	NA	NA	NA
WP_169408243.1\|3050164_3051541_+	hypothetical protein	NA	NA	NA	NA
WP_169408244.1\|3051537_3052305_+	TatD family hydrolase	NA	NA	NA	NA
WP_169408245.1\|3052574_3052886_+	DUF4113 domain-containing protein	NA	NA	NA	NA
WP_169408246.1\|3052996_3053464_-	RES family NAD+ phosphorylase	NA	NA	NA	NA
WP_169409148.1\|3053463_3053895_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_169408247.1\|3054403_3054739_+\|transposase	transposase	U5P429	Shigella_phage	4.3e-22	49.5
WP_008958322.1\|3055078_3056380_-\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	1.4e-84	39.4
WP_169408248.1\|3056681_3057950_+	ferredoxin reductase family protein	NA	NA	NA	NA
WP_008958323.1\|3058056_3059292_-	organoarsenical effux MFS transporter ArsJ	NA	NA	NA	NA
WP_169408249.1\|3060361_3060787_-	arsenate reductase ArsC	A0A2H4J437	uncultured_Caudovirales_phage	4.6e-21	43.9
WP_169408250.1\|3060918_3061269_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_092850563.1\|3061275_3061689_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.1e-41	67.7
WP_092850574.1\|3061700_3062414_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	6.9e-86	66.7
WP_169408251.1\|3062427_3063495_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_169408252.1\|3064034_3065570_+	hypothetical protein	NA	NA	NA	NA
WP_169408253.1\|3065611_3069346_+	hypothetical protein	NA	NA	NA	NA
WP_169408254.1\|3069417_3070233_-	hypothetical protein	NA	NA	NA	NA
WP_169408255.1\|3071146_3071545_-	hypothetical protein	NA	NA	NA	NA
WP_169408256.1\|3071731_3072511_-	HD domain-containing protein	NA	NA	NA	NA
WP_169408257.1\|3072657_3072906_-	hypothetical protein	NA	NA	NA	NA
WP_169409149.1\|3072898_3074101_-\|integrase	site-specific integrase	A0A1W6JTA0	Pseudomonas_phage	1.5e-40	31.6
WP_169408258.1\|3074093_3074330_-	hypothetical protein	NA	NA	NA	NA
WP_169408259.1\|3074464_3074713_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
3074630:3074645	attL	NA	NA	NA	NA
WP_169408260.1\|3074840_3076334_+	SAM-dependent DNA methyltransferase	A0A220A2U4	Liberibacter_phage	8.6e-147	55.9
WP_169408261.1\|3076330_3077857_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	9.1e-136	57.2
WP_169408262.1\|3077849_3079748_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
WP_169408263.1\|3080854_3083845_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	1.0e-199	40.1
WP_169408264.1\|3083857_3086080_+	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	4.5e-27	31.6
WP_169408265.1\|3086079_3087219_+	5-methylcytosine-specific restriction endonuclease system specificity protein McrC	NA	NA	NA	NA
WP_169408266.1\|3087237_3087540_+	hypothetical protein	NA	NA	NA	NA
WP_169409150.1\|3087960_3088356_+	c-type cytochrome	NA	NA	NA	NA
WP_169408267.1\|3088417_3090424_-	DNA helicase Rep	A7KV33	Bacillus_phage	5.4e-112	37.3
WP_169408268.1\|3090602_3092285_+	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_169409151.1\|3092293_3092860_-	ATP-binding protein	NA	NA	NA	NA
WP_169408269.1\|3093039_3094146_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_169408270.1\|3094149_3096360_+	hypothetical protein	NA	NA	NA	NA
WP_169408271.1\|3096356_3098336_+\|integrase	site-specific integrase	NA	NA	NA	NA
3103265:3103280	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3106797 : 3156182

Salmonella_phage(13.33%)

integrase,transposase

attL 3136881:3136906|attR 3156299:3156324

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169409154.1\|3106797_3106983_-\|transposase	transposase	NA	NA	NA	NA
WP_136869546.1\|3107079_3108317_-\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	2.1e-114	74.4
WP_169408279.1\|3108320_3108725_-	hypothetical protein	A0A2H4J5W2	uncultured_Caudovirales_phage	7.7e-26	49.2
WP_169408280.1\|3108811_3109249_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1B1ITQ0	uncultured_Mediterranean_phage	6.0e-08	34.0
WP_169408281.1\|3109241_3109583_+	RulB protein	A0A218MNF2	uncultured_virus	1.9e-33	66.3
WP_034039555.1\|3109632_3110922_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_034039553.1\|3110914_3112645_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_049306259.1\|3113460_3114681_+	hypothetical protein	NA	NA	NA	NA
WP_023443007.1\|3114661_3115126_+	hypothetical protein	NA	NA	NA	NA
WP_058131653.1\|3115193_3117884_-	AAA family ATPase	NA	NA	NA	NA
WP_065285146.1\|3118433_3119804_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_088813950.1\|3119930_3120488_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_065285147.1\|3120667_3121831_+	MexC family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_034065037.1\|3121846_3124981_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.8e-56	23.3
WP_003152694.1\|3124985_3126419_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_169409155.1\|3126869_3127814_+	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	2.2e-68	44.6
WP_169408282.1\|3128257_3129355_+	DUF262 domain-containing protein	A0A0R6PJX3	Moraxella_phage	4.5e-44	34.8
WP_169408283.1\|3129354_3130065_+	hypothetical protein	NA	NA	NA	NA
WP_169408284.1\|3130064_3131144_+	DNA cytosine methyltransferase	A0A0R6PG08	Moraxella_phage	4.5e-89	51.3
WP_169408285.1\|3131409_3132414_-	DUF4935 domain-containing protein	NA	NA	NA	NA
WP_169408286.1\|3132572_3133193_-\|integrase	tyrosine-type recombinase/integrase	A0A142F2H8	Mycobacterium_phage	9.4e-07	31.1
WP_169408287.1\|3133316_3134306_-	hypothetical protein	NA	NA	NA	NA
WP_169408288.1\|3134314_3135469_-	hypothetical protein	NA	NA	NA	NA
WP_169408289.1\|3135927_3136476_-	hypothetical protein	NA	NA	NA	NA
3136881:3136906	attL	NA	NA	NA	NA
WP_106761484.1\|3138329_3139271_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_169408290.1\|3139299_3140514_-	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	4.5e-21	28.8
WP_099593669.1\|3141641_3142256_+	recombinase family protein	E5FFF9	Burkholderia_phage	3.5e-38	49.2
WP_025464697.1\|3142321_3143125_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	2.2e-24	34.6
WP_000480959.1\|3143124_3143961_+	APH(6)-I family aminoglycoside O-phosphotransferase	NA	NA	NA	NA
WP_002075255.1\|3144221_3145235_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
WP_032495607.1\|3145606_3146263_+	quinolone resistance pentapeptide repeat protein QnrVC6	NA	NA	NA	NA
WP_052484405.1\|3146510_3146843_+	quaternary ammonium compound efflux SMR transporter QacK	NA	NA	NA	NA
WP_000777555.1\|3146985_3147459_+	trimethoprim-resistant dihydrofolate reductase DfrA1	A0A140HLG8	Bacillus_phage	3.7e-19	33.8
WP_169408291.1\|3147567_3148122_+	AacA4 family aminoglycoside N(6')-acetyltransferase	NA	NA	NA	NA
WP_063857839.1\|3148679_3149546_+	PSE family carbenicillin-hydrolyzing class A beta-lactamase CARB-12	A0A077SL40	Escherichia_phage	1.2e-55	44.5
WP_001206316.1\|3149663_3150455_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
WP_000679427.1\|3150618_3150966_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|3150959_3151799_+	sulfonamide-resistant dihydropteroate synthase Sul1	NA	NA	NA	NA
WP_000376623.1\|3151926_3152427_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_012414174.1\|3152723_3153011_-	H-NS histone family protein	NA	NA	NA	NA
WP_021740570.1\|3153164_3156182_-\|transposase	Tn3-like element IS3000 family transposase	NA	NA	NA	NA
3156299:3156324	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3661220 : 3668933

Thermobifida_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169408714.1\|3661220_3662075_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	5.8e-07	28.3
WP_169408715.1\|3662081_3662540_-	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_150302816.1\|3662561_3662870_-	ribosome-associated translation inhibitor RaiA	A0A0M7QCF2	Escherichia_phage	4.2e-08	36.4
WP_169408716.1\|3662946_3664449_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_169408717.1\|3664539_3665265_-	LPS export ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-23	31.9
WP_169408718.1\|3665257_3665797_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_169408719.1\|3665783_3666365_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_169409189.1\|3666361_3666880_-	HAD family hydrolase	A0A140XBD6	Dickeya_phage	1.1e-27	49.6
WP_169408720.1\|3666894_3667866_-	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	3.6e-37	32.1
WP_169408721.1\|3668117_3668933_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.0e-21	31.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP051625

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection