CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP051686	Duganella sp. GN2-R2 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	1
NZ_CP051685	Duganella sp. GN2-R2 chromosome, complete genome	6 crisprs	DEDDh,WYL,csa3,cas3,DinG,RT	1	4	6
NZ_CP051687	Duganella sp. GN2-R2 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2904 : 85113

uncultured_virus(11.76%)

transposase,integrase

attL 56410:56424|attR 86853:86867

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170205774.1\|2904_4155_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.3e-42	44.4
WP_170205722.1\|5622_6261_-	hypothetical protein	NA	NA	NA	NA
WP_170205723.1\|6421_6862_-	hypothetical protein	NA	NA	NA	NA
WP_170205724.1\|8395_9424_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_170205725.1\|9635_12485_-	insulinase family protein	NA	NA	NA	NA
WP_170205726.1\|13104_14874_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_170205727.1\|15696_16029_-	H-NS histone family protein	NA	NA	NA	NA
WP_170205728.1\|16468_17407_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	4.1e-62	42.9
WP_170203843.1\|17500_18877_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	7.1e-39	31.9
WP_170205729.1\|19516_19831_-\|transposase	transposase	NA	NA	NA	NA
WP_170205730.1\|19889_20873_-	DUF4158 domain-containing protein	A0A1B0V7H9	Salmonella_phage	4.2e-126	67.0
WP_170205731.1\|20962_21562_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	5.3e-23	38.8
WP_170205732.1\|22315_23770_+	beta-lactamase family protein	A0A059VK80	Mycobacterium_phage	1.2e-12	35.6
WP_170205775.1\|24078_25278_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	6.2e-39	31.9
WP_170205733.1\|26510_26819_+	hypothetical protein	NA	NA	NA	NA
WP_170205776.1\|27439_28828_-	MFS transporter	NA	NA	NA	NA
WP_170205777.1\|29425_30673_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.7e-42	44.9
WP_170205734.1\|34100_35138_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-12	31.7
WP_170205735.1\|35080_36058_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-18	33.5
WP_170205736.1\|36065_36995_-	ABC transporter permease	NA	NA	NA	NA
WP_170205737.1\|36991_37969_-	ABC transporter permease	NA	NA	NA	NA
WP_170205738.1\|37994_39584_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_170205739.1\|39593_40214_-	glutathione S-transferase	NA	NA	NA	NA
WP_170205740.1\|40388_41135_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_170205741.1\|42246_43521_-	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_170205742.1\|43580_44660_-	HlyD family secretion protein	NA	NA	NA	NA
WP_170205743.1\|44819_46280_-	MFS transporter	NA	NA	NA	NA
WP_170205744.1\|46267_46777_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_170205745.1\|46769_50894_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	5.3e-98	27.2
WP_170205746.1\|50890_52801_-	non-ribosomal peptide synthetase	NA	NA	NA	NA
WP_170205747.1\|52863_54054_-	hypothetical protein	NA	NA	NA	NA
WP_170205778.1\|54105_55275_-	hypothetical protein	NA	NA	NA	NA
WP_170205748.1\|55421_56249_-	hypothetical protein	NA	NA	NA	NA
WP_170205749.1\|56265_56982_-	2OG-Fe(II) oxygenase	NA	NA	NA	NA
56410:56424	attL	NA	NA	NA	NA
WP_170205779.1\|57574_60019_+	penicillin acylase family protein	NA	NA	NA	NA
WP_170205750.1\|60099_61293_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_170205751.1\|61374_62349_+	sterol desaturase family protein	NA	NA	NA	NA
WP_170205752.1\|62391_63807_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.6e-20	24.5
WP_170205753.1\|68056_69250_-	HAMP domain-containing histidine kinase	A0A1B0VMK3	Pseudomonas_phage	9.6e-16	24.8
WP_170205754.1\|69540_69921_+	response regulator	NA	NA	NA	NA
WP_170205755.1\|70055_71204_-	HAMP domain-containing histidine kinase	A0A1B0VMK3	Pseudomonas_phage	8.6e-22	26.1
WP_170202515.1\|71291_72378_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.6e-44	37.1
WP_170205756.1\|74342_74714_-	hypothetical protein	NA	NA	NA	NA
WP_170205757.1\|74726_76442_-	hypothetical protein	NA	NA	NA	NA
WP_170205758.1\|78063_78396_+	hypothetical protein	NA	NA	NA	NA
WP_001166628.1\|78402_78858_-	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001294660.1\|78929_79280_+	mercuric transport protein MerT	NA	NA	NA	NA
WP_000732276.1\|79295_79571_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_000522993.1\|79598_80006_+	organomercurial transporter MerC	NA	NA	NA	NA
WP_003055149.1\|80044_81727_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.5e-38	27.8
WP_001277463.1\|81744_82110_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_001087807.1\|82106_82343_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_001446012.1\|82326_82446_-	hypothetical protein	NA	NA	NA	NA
WP_000993245.1\|82408_82621_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_170205759.1\|82752_83328_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.2e-48	84.3
WP_170205760.1\|84093_85113_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
86853:86867	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP051685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP051685_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_1

2648249-2648589

Orphan

Consensus_repeat	Method
AGAAGAAGATCGCCGACGCCAAC	CRISPRCasFinder

5 spacers

The CRISPR arrays of NZ_CP051685_1

>merge|NZ_CP051685|1|2648249-2648589|CRISPRCasFinder
ACAAGGACATCGCCAAGGCCGACCAGAAAGAAGCCAAGGCGATGGCCGACCAGAACGAGAAGATCAACAAGGCCAGCGCCAAGGCCAGCGAGAAGAAAGCCAAGGCACAAGCCAAGGCCGACAAGAAGATCGCTGACGCCCAGGAAAAAGTCGCCAAGGCCGATCCGGAAGACCAGGCCAAGGCCTCCGCCAAGGCCGAGAAGAAGATCGCCGACGCCAACTACGACGCCCAGAAGACCATGATCAAGGCCGATGAAAAGGCCCAGAAGAAGATCGTCGACGCCAACGCCGACAAGGCCAAGGCCCATGCCAAGGCCAACGACAAGCGCGCCGACGCCATG

>NZ_CP051685|1|1|2648249-2648589|CRISPRCasFinder
ACAAGGACATCGCCAAGGCCGAC	CAGAAAGAAGCCAAGGCGATGGCCGACCAGA
ACGAGAAGATCAACAAGGCCAGC	GCCAAGGCCAGCGAGAAGAAAGCCAAGGCACAAGCCAAGGCCG
ACAAGAAGATCGCTGACGCCCAG	GAAAAAGTCGCCAAGGCCGATCCGGAAGACCAGGCCAAGGCCTCCGCCAAGGCCG
AGAAGAAGATCGCCGACGCCAAC	TACGACGCCCAGAAGACCATGATCAAGGCCGATGAAAAGGCCC
AGAAGAAGATCGTCGACGCCAAC	GCCGACAAGGCCAAGGCCCATGCCAAGGCCA
ACGACAAGCGCGCCGACGCCATG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170202590.1\|2656276_2657509_-\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|366411
NZ_CP051685.1\|WP_170202589.1\|2655123_2656287_-\|glutamate--cysteine-ligase	unknown	unknown	gnl\|CDD\|237407
NZ_CP051685.1\|WP_170202594.1\|2660024_2660879_-\|MoxR-family-ATPase	unknown	unknown	gnl\|CDD\|223786
NZ_CP051685.1\|WP_170205391.1\|2644548_2645742_+\|cyanophycinase	unknown	unknown	gnl\|CDD\|153239
NZ_CP051685.1\|WP_170202577.1\|2637351_2637945_+\|phenylacetic-acid-degradation-protein-PaaY	unknown	unknown	gnl\|CDD\|131340
NZ_CP051685.1\|WP_170202580.1\|2640728_2641268_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|226357
NZ_CP051685.1\|WP_170202593.1\|2659434_2660028_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP051685.1\|WP_170202591.1\|2657673_2658264_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP051685.1\|WP_170202579.1\|2640245_2640629_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170202582.1\|2642283_2643681_-\|argininosuccinate-lyase	unknown	unknown	gnl\|CDD\|179143
NZ_CP051685.1\|WP_170202581.1\|2641327_2642062_-\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319829
NZ_CP051685.1\|WP_170202588.1\|2653568_2654552_+\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153216
NZ_CP051685.1\|WP_170202583.1\|2643865_2644306_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP051685.1\|WP_170202587.1\|2651226_2653227_-\|type-IIA-DNA-topoisomerase-subunit-B	unknown	unknown	gnl\|CDD\|235501
NZ_CP051685.1\|WP_170202595.1\|2661096_2661456_+\|c-type-cytochrome	unknown	unknown	gnl\|CDD\|225418
NZ_CP051685.1\|WP_170202578.1\|2638108_2640160_+\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	unknown	unknown	gnl\|CDD\|236931
NZ_CP051685.1\|WP_170202584.1\|2647437_2647977_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170202592.1\|2658271_2659441_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226346
NZ_CP051685.1\|WP_170202586.1\|2648707_2651047_-\|DNA-topoisomerase-IV-subunit-A	unknown	unknown	gnl\|CDD\|235503
NZ_CP051685.1\|WP_170205392.1\|2645880_2647305_+\|peptidase-M64	unknown	unknown	gnl\|CDD\|370517

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170202590.1\|2656276_2657509_-\|sodium:proton-antiporter	gnl\|CDD\|366411	pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family. Na/H antiporters are key transporters in maintaining the pH of actively metabolising cells. The molecular mechanisms of antiport are unclear. These antiporters contain 10-12 transmembrane regions (M) at the amino-terminus and a large cytoplasmic region at the carboxyl terminus. The transmembrane regions M3-M12 share identity with other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the region that is involved in the transport of sodium and hydrogen ions. The cytoplasmic region has little similarity throughout the family.	2.99624e-14
NZ_CP051685.1\|WP_170202589.1\|2655123_2656287_-\|glutamate--cysteine-ligase	gnl\|CDD\|237407	PRK13516, PRK13516, gamma-glutamyl:cysteine ligase; Provisional.	0
NZ_CP051685.1\|WP_170202594.1\|2660024_2660879_-\|MoxR-family-ATPase	gnl\|CDD\|223786	COG0714, COG0714, MoxR-like ATPases [General function prediction only].	9.42713e-47
NZ_CP051685.1\|WP_170205391.1\|2644548_2645742_+\|cyanophycinase	gnl\|CDD\|153239	cd03145, GAT1_cyanophycinase, Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase. This group contains proteins similar to the extracellular cyanophycinases from Pseudomonas anguilliseptica BI (CphE) and Synechocystis sp. PCC 6803 CphB. Cyanophycinases are intracellular exopeptidases which hydrolyze the polymer cyanophycin (multi L-arginyl-poly-L-aspartic acid) to the dipeptide beta-Asp-Arg. Cyanophycinase is believed to be a serine-type exopeptidase having a Ser-His-Glu catalytic triad which differs from the Cys-His-Glu catalytic triad typical of GATase1 domains by having a Ser in place of the reactive Cys at the nucleophile elbow.	9.83585e-51
NZ_CP051685.1\|WP_170202577.1\|2637351_2637945_+\|phenylacetic-acid-degradation-protein-PaaY	gnl\|CDD\|131340	TIGR02287, Phenylacetic_acid_degradation_protein_PaaY, phenylacetic acid degradation protein PaaY. Members of this family are located next to other genes organized into apparent operons for phenylacetic acid degradation. PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator. [Energy metabolism, Other].	1.0136e-103
NZ_CP051685.1\|WP_170202580.1\|2640728_2641268_+\|cupin-domain-containing-protein	gnl\|CDD\|226357	COG3837, COG3837, Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown].	7.96447e-56
NZ_CP051685.1\|WP_170202591.1\|2657673_2658264_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	5.3839e-05
NZ_CP051685.1\|WP_170202592.1\|2658271_2659441_-\|VWA-domain-containing-protein	gnl\|CDD\|226346	COG3825, COG3825, Uncharacterized protein conserved in bacteria [Function unknown].	0
NZ_CP051685.1\|WP_170202582.1\|2642283_2643681_-\|argininosuccinate-lyase	gnl\|CDD\|179143	PRK00855, PRK00855, argininosuccinate lyase; Provisional.	0
NZ_CP051685.1\|WP_170202581.1\|2641327_2642062_-\|HAD-IA-family-hydrolase	gnl\|CDD\|319829	cd07527, HAD_ScGPP-like, subfamily of beta-phosphoglucomutase-like family, similar to Saccharomyces cerevisiae DL-glycerol-3-phosphate phosphatase (GPP1p/ Rhr2p and GPP2p/HOR2p) and 2-deoxyglucose-6-phosphate phosphatase (DOG1p and DOG2p). This subfamily includes Saccharomyces cerevisiae DL-glycerol-3-phosphate phosphatase (GPP1p/ Rhr2p and GPP2p/HOR2p) and 2-deoxyglucose-6-phosphate phosphatase (DOG1p and DOG2p). GPP1p and GPP2p are involved in glycerol biosynthesis, GPP1 is induced in response to both anaerobic and hyperosmotic stress, GPP2 is induced in response to hyperosmotic or oxidative stress, and during diauxic shift; overexpression of DOG1 or DOG2 confers 2-deoxyglucose resistance. These belong to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), and Escherichia coli 6-phosphogluconate phosphatase YieH. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.4418e-58
NZ_CP051685.1\|WP_170202588.1\|2653568_2654552_+\|type-1-glutamine-amidotransferase	gnl\|CDD\|153216	cd01745, GATase1_2, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	2.58348e-61
NZ_CP051685.1\|WP_170202583.1\|2643865_2644306_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.1013e-14
NZ_CP051685.1\|WP_170202587.1\|2651226_2653227_-\|type-IIA-DNA-topoisomerase-subunit-B	gnl\|CDD\|235501	PRK05559, PRK05559, DNA topoisomerase IV subunit B; Reviewed.	0
NZ_CP051685.1\|WP_170202595.1\|2661096_2661456_+\|c-type-cytochrome	gnl\|CDD\|225418	COG2863, COG2863, Cytochrome c553 [Energy production and conversion].	1.28032e-17
NZ_CP051685.1\|WP_170202578.1\|2638108_2640160_+\|phenylacetic-acid-degradation-bifunctional-protein-PaaZ	gnl\|CDD\|236931	PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional.	0
NZ_CP051685.1\|WP_170202593.1\|2659434_2660028_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.81141e-23
NZ_CP051685.1\|WP_170202586.1\|2648707_2651047_-\|DNA-topoisomerase-IV-subunit-A	gnl\|CDD\|235503	PRK05561, PRK05561, DNA topoisomerase 4 subunit A.	0
NZ_CP051685.1\|WP_170205392.1\|2645880_2647305_+\|peptidase-M64	gnl\|CDD\|370517	pfam09471, Peptidase_M64, IgA Peptidase M64. This is a family of highly selective metallo-endopeptidases. The primary structure of the Clostridium ramosum IgA proteinase shows no significant overall similarity to any other known metallo-endopeptidase.	9.77494e-117

>NZ_CP051685.1|WP_170202584.1|2647437_2647977_+|hypothetical-protein
MNKLLFTLIAGLVVVSAQAQTSANSPAIGQAVSGQNTTAAGVSGTGLRTDGTANTGSRHTKTGMEAAGVNSSGKVVGKSTAVVGVAPGKSDNVNALATNTTAPNSKEADATATGGRGKAGTKAEKEVMKANARAVKEPVGARNKTAASAEAGIEKRQEVKEKTDRKAADRAAGGNGENR
>NZ_CP051685.1|WP_170205392.1|2645880_2647305_+|peptidase-M64
MAAALALVCSAGVTATAAPQPSIAQPPATVRLDYTHSGNALGEQYAIERVLIEPLPWPGDMAQPFDATDRGNNRVEVVDAKTGDLLYSRGFSTVFGEWKTTEEASKISRGFHESVRFPKPDRPVRVRILRRDERNAFSVAWSVEVDTDAQDVVRRQGPAPARPFAVRNSGPSPRKVDLLILGDGYTQADMKKFEADARRLSDHLFAVSPFKERADDFNVWAMAVPTQESGISRPSTGVHHASALGTRYDIFGSERYVLTLDNRALRDIAQYAPYEFIEILVNNDTYGGGGIFGQFSTAAAGNDWADYLFVHEFGHHFAGLADEYYTSPVAYQASSTRMEPWEPNVTALRDPARLKWKRHVQAGTPLPTPWPKAEYEAESRAYQQRRAALRAANRPESEMSELFKEDLARSNALFAKAAYRNAIGAFEGANYEASGYYRPAMQCIMFDRSEQFCPVCRDGITDIIDLYARPTGVK
>NZ_CP051685.1|WP_170205391.1|2644548_2645742_+|cyanophycinase
MARPAAGAPLLKAAPAKAAPAKGSLVIIGGNLRPANGAVWERIVKLAGGKGAGIAVFASASGNPERSGKSLVELLNSYGAKAFFVPVAVKLAGSDYQAAADDPQLAQAVRNAGGAFFSGGDQSRITRALRHEDGSNTRVLDAVWDMYRRGGVIAGSSAGAAIMSSTMFNRPRTVLATLKLGVADGQEITEGLGFVGNDVFVDQHLLVRGRFARMLPAMLAKGYKLGLGIDEDSAMVVSASREVEIIGYKGALVLDLAGASVHEGAFNIDNVRVSYLDNGDRFNIATHAFTPAADKADGKLDPSRPYYREPLFSADILGNATVVDLMSKLIDSDQPEAIGITLGSPNGVQPDLGFEFRFTRTADSVGYQSAYNDAYSIYNVRLDIRPILIRRPLYQYK
>NZ_CP051685.1|WP_170202583.1|2643865_2644306_+|GNAT-family-N-acetyltransferase
MLTTNDSSFRVSTDRTRLDVPMIYRFLSESSSWAVGISRDMVERSIDNSLCFGGYLDGRQIAFARVITDYATTAHLADVFVIPEFRGHGYAKQMIRVVVEHPSLQNLRRFMLNTDDAHSLFERFGFAAPKRPDTVMERFLPKIYLS
>NZ_CP051685.1|WP_170202582.1|2642283_2643681_-|argininosuccinate-lyase
MTAQLSKKGEAWSARFSEPVSDLVKRYTASVFFDKRLALFDIQGSLAHAEMLAAQGIISAQDRAEIERGMAQIKGEIEAGQFEWLLDLEDVHLNIEKRLTELVGDAGKRLHTGRSRNDQVATDIRLYMRAAIDDVLGLLAGLRGALVDLAERHHDTIMPGFTHLQVAQPVTFGHHLLAYVEMFGRDAERMQDTRRRVNRLPLGAAALAGTTFPIDRLRVAKTLGFEDVCHNSLDAVSDRDFAIEFTAAASVLMMHISRMSEELVTWMSPRIGFIDIADRFCTGSSIMPQKKNPDVPELARGKTGRVYGHLMGLLTLMKGQPLAYNKDNQEDKEPLFDTVDTLLDTLRIFTDMAGGITVKAGNMRAAALQGYATATDLADYLVKKGLPFRDAHEAVAHAVRACDDAGCDLSEMSLERLQAFSPLIGEDVFAVLTLEGSVAARDHVGGTAPAQVRKAIERVRGQLAE
>NZ_CP051685.1|WP_170202581.1|2641327_2642062_-|HAD-IA-family-hydrolase
MRGPDIHTHRTRHVTSNDPPSTSPRALPARAYAAFLFDMDGTILTSIKAAERVWSAWAAGHGLDVAAFVPTIHGKRGVDTIRNLNLPGVDPAAEVLRIMLAGIEDVADIEGIRGAAAFLASLPAGRWAIVTSAPRRLAEARIAAAGMPLPAVLVAAEDVARGKPAPDPFLLGAQKLGVASADCLVFEDTLAGLQSAAAAGMDSVVVTTTHAHPLATDVAAVLDYEDLRTEVAPDGGLRLARRGA
>NZ_CP051685.1|WP_170202580.1|2640728_2641268_+|cupin-domain-containing-protein
MSRLDLSIIPVLTGTDYPEAFAEAVNGRSRQALGEAGGLSQFGVNLVELKPGAASSQRHWHSKEDEFVMVVSGELTLVTDEGETIMRAGDCAAFPAGRPNGHQLVNRSWGSALMLAVGPNVPGDRATYPDIDMVYDEDSDRYTHRDGTPYPKSTAQPDQPAADLPVDAETLAPRVYRHE
>NZ_CP051685.1|WP_170202579.1|2640245_2640629_-|hypothetical-protein
MDAIVSAGDYRLADRIRPQPETQIREEAAFLASQVLRIKRKPFTRAPVRWASVRGYADVVRRHLAIASGIGDPAQAARLQALAVRLIDNPSLRAAVRADIARRADSPRLDLYRRGWNKHGRRRRNPR
>NZ_CP051685.1|WP_170202578.1|2638108_2640160_+|phenylacetic-acid-degradation-bifunctional-protein-PaaZ
MHTPTTLQSHIAGRWHGQQAHQPLHSALDNGLIYHTHAEPIDFAEALHYARKTGIRSLMQLDFQQRAQRLKALALYLMERKEELYEISHLTGATRPDSWVDVEGGIGTLFAYASMGGRELPSSNVLHEGPAMALGKRGGFAGTHILVPRGGVAVHINAFNFPIWGLLEKFAPSFLAAMPCIAKPATATSYLTHTVVKMMMDSSLLPEGALQLVIGGTGDLLDRLTGFDAVTFTGSADTAVKLRSNANLLREGVPFTAEADSLNAAILAPDVTPDDPEFDLFVKEVAREMTGKAGQKCTAIRRVIVPRQHVEAVGQRLRERLAKIVVGNPKMDGVRMGALASMDQHRDVSERVERLARGNEILFGARDGFNPVGAGGGGGAYFSPTLLLCRDAMRNDAVHDIEAFGPVSTLMPYDGIDEALELAARGRGSLVTTLVTRDPAIAAHAVPVAAASHGRVHILEREAAVDSTGHGSPLPQLKHGGPGRAGGGEELGGIRAVKHFLQRAAVQGSPTMLAAVTGEYVRGGAVKESDIHPFRRHFEDLQVGHSLLTHRRTVSEADIVNFGGVSGDYFYMHFDEIAAKDTQFGKRIAHGYFVLSAAAGLFVSPAPGPVLANYGLDNLRFVAPVAIGDTIRARLTCKRKVDRNRTDEAGRGQGVVAWDVQVTNQHEELVASYDILTLVLKHA
>NZ_CP051685.1|WP_170202577.1|2637351_2637945_+|phenylacetic-acid-degradation-protein-PaaY
MVKVYEIDGLRPVVHPSAYVHPSAVLIGDVIVGPRCYVGPLASLRGDFGRLVLEEGANLQDTCVMHGFPEDDTVVEVDGHVGHGAVLHGCRVGRNAMVGMNAVVMDKAVVGAESIVGAAAFVKAGMAIPPRSLVLGAPARVVRAVTDEEIAWKSHGTRQYHDLAVRSMQGMREVEAFTEMEADRRRMVFEAPHRPKN
>NZ_CP051685.1|WP_170202586.1|2648707_2651047_-|DNA-topoisomerase-IV-subunit-A
MTQASLFEQASEQPSAPADDAETLTLSTFAERAYLDYAVSVVKGRALPDVADGQKPVQRRILYSMNELGLGPTAKPRKSATVVGDVLGKLHPHGDQSVYDALVRMAQDFSLRYPLIDGQGNFGSRDGDGAAAMRYTEARLTPVSRLLLDEIDMGTVDFQPNYDGSSEEPRSLPARLPMLLLNGASGIAVGMATEIPSHNLREVASGAVAMIRNPKITHAELMTFMPGPDYPGGGQIITPAGNIADMYAVGRGSMKVRARWKIEELARGQWQAVVNELPPGVSSQRVLEEIEELTNPKIKLGKKTLSPEQLALKQTVLGALDTVRDESGREAPVRLVFEPKSKNQDQAEFMLMLLAHTSLESSAPINLVMIGGDGRPRQKGLSEILQEWIDYRFVTVRRRTEFKLGKVNDRIHILEGRETVLLNIDEVIAIIRNADDPKAALIERFRLSERQAEDILEIRLRQLARLEAIKIQQELAELRGEKEKLEDILNNPSSMKRLIVREIESDAKQYGDARRTLIEEAQKAVAEQRIVDEPVTVIVSEKGWVRARTGIGHDPAQFTFKAGDSLYRAFECRTVDTLLCIGDNGKAYSVPVNALPGARGDGVPITTLVDLSGGIRILHYFVGPADTRLLLATSTGFGFIAKAGDMVSRLKGGKSFITLDEGAVPLPPRVVADQAGAIACLSERGRVLVFGIDEMKVLTNGGRGVTLMELEPKETLLAAQPISQKGVKVIGTWAGDKPRTVELFASGLEPHFGKRAKKGKPLSAKLKARDLAMRQTDAN
>NZ_CP051685.1|WP_170202587.1|2651226_2653227_-|type-IIA-DNA-topoisomerase-subunit-B
MATKKNATDYSESSIRVLKGLEPVKQRPGMYTRTENPLHIIQEVIDNASDEALGGHCKNIAVTMNADGSITVEDDGRGIPVGIHPEEGVSTVEIVFTRLHAGGKFDKGSGGAYAFSGGLHGVGVSVTNALSKRLEITVWRKDEGGNGIHKLVFADGDVIEPLTSAPPERGGKKNGTRVTAWPDGKYFDSPNIPLAELQRLLRSKAVLLPGVTVTLTNGKTGDVQTWRYDEGLRGYLTEALAQTATNGQTVIPLFEGAQYAAAGDEGFAEGEGAAWVVAWTEEGAVVRESYVNLIPTVSGGTHESGLRDGLFGAVKSFVEMHSLLPKGVKLLPEDVFARVSFVLSAKVLDPQFQGQTKERLNSRDAVKLVSTFTRPPLELWLNQHVEYGRKLAELVIKQAQSRLRSLQKVEKKKSSGVAVLPGKLTDCESSDIARNELFLVEGDSAGGSAKMGRDKEFQAILPLRGKVLNTWETDRDRLFANNEIHDIAVAIGVDPHGQDDTPDLSNLRYGKICILSDADVDGSHIQVLLLTLFFKHFPALFRNGNICIARPPLYRVDVPARGKKPIQKVYALDAGELIAIEDKLKKEGLKEGVWSISRFKGLGEMNAEQLWETTMNPDTRRLLPVAYGDFGVAESSARFNMLMGKGEASARRAWLEEHGNETEADI
>NZ_CP051685.1|WP_170202588.1|2653568_2654552_+|type-1-glutamine-amidotransferase
MAEDIDKPQGAPDPEAPSGPGGPARVPDRRARGGAARYLRSSDTPWNLAGRVLQSRWRALTDRFQRDFMRRTLRIGVSARIYHPEPGATGLRSKNLQYLEESIAQWVMSRDVLVFMVPTVNTNGLLHPSNITLRHYARHLDGLVLQGGADVSPMTYSETPTRPEWNGDRARDLYELELLHEFVDAGKPVLGICRGCQLINVAFGGTLYQDVATNLPGSRPHVHDLYDAHRHDIVFPPGSSLAGMFPRNQRAVVNSIHHQAVKDLGRDIHVEAMSDPDGVVEAIRYQRAPFVMGLQWHPEFHRAGGGELLDCTPVLDEFLRAARETRL
>NZ_CP051685.1|WP_170202589.1|2655123_2656287_-|glutamate--cysteine-ligase
MPLEPFTSSEPLTFGVELELQLASLSDFDLTPASTDLLHLLKRKPFPGNVTLEITESMIEINSSVQTRHGPLLAELGAIRDTLVAASDMLNIGICGGGTHPFQHWSEQRISSKARFQELSSLYGYLAKQFTVFGQHVHIGCANGDDALYLLHALSRYIPHFIALSASSPFVQGQDSGFDSARLNSVYAFPMSGRAPFTLRWDDFAGVYFAKMERTGIVRSMKDFYWDLRPKPEYGTIELRVCDTPLSVERAAALAAYLQAICRHLLLRRAAAAPSDDAPSEDAPSEDDYLVYNYNRFQASRFGLDGVVTHPKTYASVPLRDDILATLGLLEPHARALDSLDALRDLADAVTHGSDASWLREQYRRQGSAEGMVNAAIGRFRGEWRTR
>NZ_CP051685.1|WP_170202590.1|2656276_2657509_-|sodium:proton-antiporter
MAQLQGILASLAWPFAITVAWLAGEFGQRWSGLPRISFYGLAGFALAAGQLGVLPPAGVGNALLLADVGFALVLFELGYRINLRWLRTNPWIGIAGLAEAGLTGIAVFLIARAFGVAGIHALMLASLSMATSPATVVRVINEQKSSGQVTERALHLCALDCVLAVFAFNASVGLWIFRTFEDVGDALWNSLAMLGVSAFAGTVFGIAVPAVLRLLGKMTQDATAAFALAVILLVSMAYALGLSPVVAALAFGLTARHRRVAFSQAQRNFGALGELLTVVLFVYVASTLDWRRVAAGGALALALVLILARLLTKTAGVTAFAHLSGISWRKGVLTGVALAPLSVFAILMLEHARHAGVQVVEELRAMAAVTMLLEVFGPVILQRALAWAREIPATGPETPPDARPENRHAA
>NZ_CP051685.1|WP_170202591.1|2657673_2658264_+|CPBP-family-intramembrane-metalloprotease
MPPRLYVPSSTRPPIGLAAQLLASLAAGVLALVIIHVSGTPLRALFAGPVRPAYQMLIGQGLALVGGALVYGLWRVDAHYALAAMQRRYRRLDLRGHNPLLIALAAAFGEELLLRAALQPLLGIWIVSLLFVLAHVPLDQLRRLERAALVQAAGVFAAGVALGFVFARVGLLAAMVVHWWAAIVSLVLARSSVEQG
>NZ_CP051685.1|WP_170202592.1|2658271_2659441_-|VWA-domain-containing-protein
MLIDFFYALRDARVPVTIQEFLTLLEALQRQVIPPSLDDFYHLARLALVKDEAHFDKFDRAFGSYFKGIESVFEDRQSVPLDWLVKRLARELTPQQKAQLQKFGYDKLLERLQQLLDEQKERHEGGSKWIGTGGTSPFGNGGVNPEGIRIGGAGGRRSAVKVWEQREYRDYDGERELGTRNLKVALRRLRRFARQGAADELALDDTIRATANNAGWLDVRMRPERRNRIKVLMLLDVGGSMDDHVERTEELFSAAQSEFKHLDFFYFHNCVYEHLWKHNGRRHSERMPTRDVLRTYPPDTRLLFVGDATMSPYEILAPGGSVEYHNDEAGAEWLARLCNAFPKFAWLNPEPEHLWQYRQSIAIVRQIVGERMFPVTIDGLERAMRLLGK
>NZ_CP051685.1|WP_170202593.1|2659434_2660028_-|GNAT-family-N-acetyltransferase
MIRVDPVTLAFNGVRLEPLAPHHADGLRAAAADGELWTLRVTSVPAPQETGQYIRTALETSNRCAFAVIDAASGTVIGSTSYHDILPAVDRVEIGYTWYAGSRQRSHVNTSCKLMLLAHAFDTLGCAVVGLRTDNLNLASQAAIERLGAGKDGVIRHSALRRDGSVRDTVMYSILRSEWPAIRTRLHARLNAYGPAC
>NZ_CP051685.1|WP_170202594.1|2660024_2660879_-|MoxR-family-ATPase
MTAPRRFDGSDSYVATDDLKLAVNAALTLGRPLLIKGEPGTGKTMLAEEVAAALGMPLLQWHIKSTTKAQQGLYEYDAVSRLRDSQLGDERVRDIHNYIVKGVLWQAFTAPEPVVLLIDEIDKADIEFPNDLLRELDRMEFHVYETRETVTATHRPLVIITSNNEKELPDAFLRRCFFHYIRFPDRDTMAAIVDVHYPQLKQELLAAALHSFYELREVAGLKKKPSTSELLDWLKLLLAEDIPPEALQAQDGKAAVPPLHGALLKNEQDVHLFERLVAMARRNR
>NZ_CP051685.1|WP_170202595.1|2661096_2661456_+|c-type-cytochrome
MKKPLAVAVRTAVLATALASLAGAAGAADIVANPKAAPNKIEQCIGCHGIPGYKAAFPEVFQVPMIGGQSARYIEAALQAYKKGDRKNLSMRGIAASLSDQDIADIAAYYAQQAPADGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051685_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_2

2954294-2954398

Orphan

Consensus_repeat	Method
TGCCTGAAACGACTCCCTGCGCAGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051685_2

>merge|NZ_CP051685|2|2954294-2954398|CRISPRCasFinder
TGCCTGAAACGACTCCCTGCGCAGGCGCACTACTGTCCAAGCTAATATTGCCGGCCTAAAGACCGTCGTTTCAGGCACTGCCTGAAACGACTCCCCGCGCAGGCG

>NZ_CP051685|2|2|2954294-2954398|CRISPRCasFinder
TGCCTGAAACGACTCCCTGCGCAGGCG	CACTACTGTCCAAGCTAATATTGCCGGCCTAAAGACCGTCGTTTCAGGCAC
TGCCTGAAACGACTCCCCGCGCAGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170202808.1\|2966745_2968083_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340871
NZ_CP051685.1\|WP_170202801.1\|2950635_2951919_+\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|181039
NZ_CP051685.1\|WP_170202810.1\|2969836_2971555_+\|alpha-amylase	unknown	unknown	gnl\|CDD\|236543
NZ_CP051685.1\|WP_170202800.1\|2949109_2950276_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378164
NZ_CP051685.1\|WP_170202812.1\|2974851_2975967_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP051685.1\|WP_170205417.1\|2971685_2972705_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP051685.1\|WP_170202804.1\|2957608_2959534_-\|glycoside-hydrolase-family-13-protein	unknown	unknown	gnl\|CDD\|200479
NZ_CP051685.1\|WP_170202806.1\|2962967_2964479_+\|tryptophan-7-halogenase	unknown	unknown	gnl\|CDD\|368139
NZ_CP051685.1\|WP_170202795.1\|2938667_2939282_-\|DUF3304-domain-containing-protein	unknown	unknown	gnl\|CDD\|371700
NZ_CP051685.1\|WP_170202802.1\|2951929_2952439_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP051685.1\|WP_170202798.1\|2945348_2947181_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182733
NZ_CP051685.1\|WP_170202799.1\|2947170_2948937_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|182732
NZ_CP051685.1\|WP_170202807.1\|2964593_2966426_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|236941
NZ_CP051685.1\|WP_170202809.1\|2968176_2969808_+\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	unknown	unknown	gnl\|CDD\|100087
NZ_CP051685.1\|WP_170205416.1\|2943018_2944722_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP051685.1\|WP_170202811.1\|2972987_2974850_+\|glucokinase	unknown	unknown	gnl\|CDD\|184507
NZ_CP051685.1\|WP_170202797.1\|2940177_2942856_-\|type-VI-secretion-system-tip-protein-VgrG	unknown	unknown	gnl\|CDD\|226032
NZ_CP051685.1\|WP_170202805.1\|2960089_2962861_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|273804
NZ_CP051685.1\|WP_170202803.1\|2952618_2954268_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP051685.1\|WP_170202796.1\|2939356_2940181_-\|DUF4123-domain-containing-protein	unknown	unknown	gnl\|CDD\|379225

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170202808.1\|2966745_2968083_+\|MFS-transporter	gnl\|CDD\|340871	cd17313, MFS_SLC45_SUC, Solute carrier family 45 and similar sugar transporters of the Major Facilitator Superfamily of transporters. This group includes the solute carrier 45 (SLC45) family as well as plant sucrose transporters (SUCs or SUTs) and similar proteins such as Schizosaccharomyces pombe general alpha-glucoside permease. the SLC45 family is composed of four (A1-A4) vertebrate proteins as well as related insect proteins such as Drosophila sucrose transporter SCRT or Slc45-1. Members of this group transport sucrose and other sugars like maltose into the cell, with the concomitant uptake of protons (symport system). Plant sucrose transporters are crucial to carbon partitioning, playing a key role in phloem loading/unloading. They play a key role in loading and unloading of sucrose into the phloem and as a result, they control sucrose distribution throughout the whole plant and drive the osmotic flow system in the phloem. They also play a role in the exchange of sucrose between beneficial symbionts (mycorrhiza and Rhizobium) as well as pathogens such as nematodes and parasitic fungi. There are nine sucrose transporter genes in Arabidopsis and five in rice. Vertebrate SLC45 family proteins have been implicated in the regulation of glucose homoeostasis in the brain (SLC45A1), with skin and hair pigmentation (SLC45A2), and with prostate cancer and myelination (SLC45A3). Mutations in SLC45A2, also called MATP (membrane-associated transporter protein) or melanoma antigen AIM1, cause oculocutaneous albinism type 4 (OCA4), an autosomal recessive disorder of melanin biosynthesis that results in congenital hypopigmentation of ocular and cutaneous tissues. The SLC45 family and related sugar transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.54539e-73
NZ_CP051685.1\|WP_170202801.1\|2950635_2951919_+\|amidohydrolase-family-protein	gnl\|CDD\|181039	PRK07572, PRK07572, cytosine deaminase; Validated.	0
NZ_CP051685.1\|WP_170202810.1\|2969836_2971555_+\|alpha-amylase	gnl\|CDD\|236543	PRK09505, malS, alpha-amylase; Reviewed.	4.87231e-135
NZ_CP051685.1\|WP_170202800.1\|2949109_2950276_-\|hypothetical-protein	gnl\|CDD\|378164	pfam09361, Phasin_2, Phasin protein. This entry describes a group of small proteins found associated with inclusions in bacterial cells. Most associate with polyhydroxyalkanoate (PHA) inclusions, the most common of which consist of polyhydroxybutyrate (PHB). These are designated granule-associate proteins or phasins.	5.64643e-07
NZ_CP051685.1\|WP_170202812.1\|2974851_2975967_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	1.20365e-34
NZ_CP051685.1\|WP_170205417.1\|2971685_2972705_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	5.60099e-27
NZ_CP051685.1\|WP_170202804.1\|2957608_2959534_-\|glycoside-hydrolase-family-13-protein	gnl\|CDD\|200479	cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). This group of CMDs is bacterial. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP051685.1\|WP_170202806.1\|2962967_2964479_+\|tryptophan-7-halogenase	gnl\|CDD\|368139	pfam04820, Trp_halogenase, Tryptophan halogenase. Tryptophan halogenase catalyzes the chlorination of tryptophan to form 7-chlorotryptophan. This is the first step in the biosynthesis of pyrrolnitrin, an antibiotic with broad-spectrum anti-fungal activity. Tryptophan halogenase is NADH-dependent.	0
NZ_CP051685.1\|WP_170202795.1\|2938667_2939282_-\|DUF3304-domain-containing-protein	gnl\|CDD\|371700	pfam11745, DUF3304, Protein of unknown function (DUF3304). This is a family of bacterial proteins of unknown function.	1.567e-21
NZ_CP051685.1\|WP_170202802.1\|2951929_2952439_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	2.46548e-25
NZ_CP051685.1\|WP_170202798.1\|2945348_2947181_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182733	PRK10790, PRK10790, SmdB family multidrug efflux ABC transporter permease/ATP-binding protein.	7.01322e-162
NZ_CP051685.1\|WP_170202799.1\|2947170_2948937_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|182732	PRK10789, PRK10789, SmdA family multidrug ABC transporter permease/ATP-binding protein.	0
NZ_CP051685.1\|WP_170202807.1\|2964593_2966426_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|236941	PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional.	0
NZ_CP051685.1\|WP_170202809.1\|2968176_2969808_+\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	gnl\|CDD\|100087	cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes. In one direction, G-1-P produced from sucrose catabolism is converted to G-6-P, the first intermediate in glycolysis. In the other direction, conversion of G-6-P to G-1-P generates a substrate for synthesis of UDP-glucose which is required for synthesis of a variety of cellular constituents including cell wall polymers and glycoproteins. The PGM1 family also includes a non-enzymatic PGM-related protein (PGM-RP) thought to play a structural role in eukaryotes, as well as pp63/parafusin, a phosphoglycoprotein that plays an important role in calcium-regulated exocytosis in ciliated protozoans. PGM1 belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP051685.1\|WP_170205416.1\|2943018_2944722_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.61527e-47
NZ_CP051685.1\|WP_170202811.1\|2972987_2974850_+\|glucokinase	gnl\|CDD\|184507	PRK14101, PRK14101, bifunctional transcriptional regulator/glucokinase.	0
NZ_CP051685.1\|WP_170202797.1\|2940177_2942856_-\|type-VI-secretion-system-tip-protein-VgrG	gnl\|CDD\|226032	COG3501, VgrG, Uncharacterized protein conserved in bacteria [Function unknown].	5.14856e-105
NZ_CP051685.1\|WP_170202805.1\|2960089_2962861_+\|TonB-dependent-receptor	gnl\|CDD\|273804	TIGR01782, TonB-dependent_receptor, TonB-dependent receptor. This model represents a family of TonB-dependent outer-membrane receptors which are found mainly in Xanthomonas and Caulobacter. These appear to represent the expansion of a paralogous family in that the 22 X. axonopodis (21 in X. campestris) and 18 C. crescentus sequences are more closely related to each other than any of the many TonB-dependent receptors found in other species. In fact, the Crescentus and Xanthomonas sequences are inseparable on a phylogenetic tree using a PAM-weighted neighbor-joining method, indicating that one of the two genuses may have acquired this set of receptors from the other. The mechanism by which this family is shared between Xanthomonas, a gamma proteobacterial plant pathogen and Caulobacter, an alpha proteobacterial aquatic organism is unclear. [Transport and binding proteins, Porins].	4.65999e-161
NZ_CP051685.1\|WP_170202803.1\|2952618_2954268_+\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	2.35973e-92
NZ_CP051685.1\|WP_170202796.1\|2939356_2940181_-\|DUF4123-domain-containing-protein	gnl\|CDD\|379225	pfam13503, DUF4123, Domain of unknown function (DUF4123). This presumed domain is functionally uncharacterized. It is about 120 amino acids in length and contains several conserved motifs that may be functionally important. This domain is sometimes associated with the FHA domain.	2.81399e-11

>NZ_CP051685.1|WP_170202803.1|2952618_2954268_+|HAMP-domain-containing-protein
MKLVNLKISARLGLLGGLFLAAMLVLSFNAWQSLAQANARAGAALGRIDALARAADTARNAQVEFKVQVQEWKNILVRGGDPAELEKYTQAFKASGAATLADLDRLRDQMVAAGVPAASVAQAQSSLRALGERYLAALKLHDPAAPDAYKLLDREVKGLDRAPTAQIDAIVALIQQHAQASIAAMQQERAASEQAERVRAIATLLGVLAVAGPLTVWLARSITRPIGQAVAIAGTVAAGDLSHPIAVDRADEVGMLLASLKNMQDSLAGIVARVRSGTDTIAVATGEIAQGNQDLAARTEEQASSVEETAASMEELTSMVRRSRDSAEQARRMADEASGAAARGGDAVAQVVSTMGEIDASSRRIVDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAAAAREIKGLIGDSVERVQAGTRLVGEAGSTMQDVVASVQRVAATIGEISGTTVQQSEGIIQINDTMSQMDTVVQQNSALVEQAAAAADALQQQAMELADAVGVFRLADDAGASAGAAAAEARHAVRSVPRALLA
>NZ_CP051685.1|WP_170202802.1|2951929_2952439_+|GNAT-family-N-acetyltransferase
MQILASARLTLRTADPGDGAFYLALLNDPAFIDNIGDRGVRTLEQAHQALLAGPIAMQEARGHSLYVVELAGSGVPIGMCGLIKRDSLDGVDLGYAFLPAWRAQGYAFEAGKAVLEYAPGLGLRRVLAITSPNNIASNCLLRKLGMRFERFLHLPPDFAGANLYSIHVG
>NZ_CP051685.1|WP_170202801.1|2950635_2951919_+|amidohydrolase-family-protein
MDVVIRNASLADGRRVDIAIAGERIAEVGPGLPLHAGQEIDAGGDLVSAPFVDAHFHMDATLSYGLPRVNASGTLLEGIALWGELKPQLAQEALIGRAMQYCDWAVARGLLAIRTHVDICDARLLAVEALLEVKRRVAPYLDLQLVAFPQDGLLRSAGAFDNLKRAIALGVDVVGGIPHFERTMAQGAESVRLLCEFAAERGLMVDMHCDESDDPLSRHIETLAAETLRLGLQGRVAGSHLTSMHSMDNYYVSKLLPLIAESGVAAIANPLINITLQGRHDTYPKRRGMTRVPELLAAGVPVAFGHDCVMDPWYGLGSGDMLEVAHMGLHVAQMTGQDAMRACFRAITETPARILGLQGYGIAPGCHADLVLLDAGDPVEAIRLRAARRLVMRRGRVVSEAPPARARLRLPGRPDGVDFRLGRANQA
>NZ_CP051685.1|WP_170202800.1|2949109_2950276_-|hypothetical-protein
MTSLSEQFSAVRQSQLETQLDVFHKLTSRAIDSAEQLIALNLKTSRASVEQAAGTMQQLLHASDPRDLFAIGARVQGPWQHLFAYSRELMSIATGVRTVAWHTVSTPAMPAPLLQMPAPFANLMEQVAIATADSATVHGEIAAAAADTGAALAESALDASVQAVPDASLRAAAQAADDAVEGAAQTSADAATQQGAATELGVETAGEAAAAAVPEAHVQPDVQPDAQPDLQPDAQPDSRPVEPQPDVTPGADESNVETPGEATIDAPQETVAQPGGDAVVEQPGGDAVELPLDPAGAIGAAGTPLVQAAAVIDAVAEVPTAKAKPLAKAVSKAVAKSLGAEHPLASAVPLQADGHVELPIVTPSDVAPPVQQSQGPAPEERRRSSRKK
>NZ_CP051685.1|WP_170202799.1|2947170_2948937_-|ATP-binding-cassette-domain-containing-protein
MGLARLIGGFVRRNWRAYGPSAVMLFGVALCSVLVPRKVGAMIDGLAAHRLAGHDLTIQLLELLGLGLAIYVLRVAWRLRLYSAAYRLGVELRTRLYARLSAQGPAFYQRQRTGDLMALATNDIDAIEQAAGEAILAGFDGSLTLVMVLGVMFLGVDWRLTTIALLPFPLMALAFWRISSHIHTASHDSLQRFSALNDHVQESLSGVRTLRALGLEGRSSAQFSALAARAADASLRAQKWEAAYEPAVGLTLTAATGLTLGLGGYLVWQGQLTIGSLTSFTMYLGQLIWPMFAAGWVLSLIERGRAALARLQPLLEAPLTVDDHGRVEQLQRGALVLQDVGFAYGGEDGAPVAHRALDGVSLRLEPGQTLGLVGATGAGKSTLLRVLLRQATPQQGSVAWGGHALDRYTLATLRGAISWVPQESFLFSASIAENIALARPGASRAEIEQAARMAAIHDDILRFPQGYDTPVGEKGITLSGGQRQRVAIARSLLADSSLLLLDDALSAVDTGTETRILEHLDELRRTRPELSAIIASHRLSAVVKADLIVVLRDGRIVERGTHEALLARDGWYASQWRYQQLEASLDAI
>NZ_CP051685.1|WP_170202798.1|2945348_2947181_-|ATP-binding-cassette-domain-containing-protein
MPSDPTIKTTKTPTSDRTQVRQALGLLRRAAEPDRAHLGWATLWLVLAAGLEVLGPLLGKKLIDEHLLPHRLDWPRMALLLGGVLAFGWAASWLRFLQLVRLSGLAMRSVQRLREWVYDHVLRLPMAFFDRAITGQLVSRVTNDTEAVKTLYIQVLFVILDSSIVLVGTSIAMAWLDWRLMLIVLALVPAVVGIVWLYQRLSAPAVTRARALRSDINGQMAESIGGMSVLQANNAQQRFGARFAGTNEQHYTARVAELRANAFLLRPALDFLNVVLLAVVIFSFGQRSMNAVEVGVLYAFISYIARVVEPLIQITMQFSGLQQAVVATARVSSLLDEIGAPEHGRRKVDDTAGGGRPADGPANIVPGAPAVRVRDLSFAYVEGQTVLHHLSLEIPQGAFFGIVGHTGSGKSTLLSLLLRYYPAAHGSIEIHGEPLAAIGNERFRSEVGLVPQDPFLLAASARENIDMGRGLPPAAIEAAARAAHAHDFISTLEQGYDTPLGEGGSRLSSGQKQLIAIARALAGRPRILLLDEATSRIDSQTEQIVQQALTELRGKVTIIAIAHRLSTIRDADRIVVLNHGRISEAGDHEALMRIEGGLYQRLYLLQQMTA
>NZ_CP051685.1|WP_170205416.1|2943018_2944722_-|diguanylate-cyclase
MNEMARAHKLVWEAEKLAASSQDLGLRVRVLISSGESFAEEGNFPNAVARMQAAATLARQSGSPLQAVIALNSLAYLYNQMRDHAKAYEVLDEAYVAAARLDSPSRMAILKTTEYGVAVDSGQLQRALAAMQATLALARRIDAGPLTAATLLNLSDCYLKLHDYRNALPYAQQALEQAQRLRNDKLLAGARINVGQVYLAMGRLGEGKRRMEEGVAWYEKSGHKPDLQAILAEYGDALERAGDDTAALAAYHRERALSNELFEKRRQKAMMELQEQYEADKRQRQIQSLRQENQVKSAELDNRRLQQRIWWLLALVFALAAAIVTILYRKVRHTNAQLEEKNLELEQQSARDPLTGLYNRRHFQQFMRGYTPAERRGNGAEDMVGALFLLDVDHFKHINDTWGHCAGDAVLRTIADALREILRETDMIVRWGGEEFLAFLPAVPRASLDEVARRLLAGIPARRVDYQGVPLSVNVSIGFAPFPLAPDGKDMSWERAVNIVDMALYLAKGHGRNRAYGVRGLKDGGGAALDGIEQDIERAWRSGQVELSIVQGACRSYEPCPDRIPSL
>NZ_CP051685.1|WP_170202797.1|2940177_2942856_-|type-VI-secretion-system-tip-protein-VgrG
MQSDNELGSFMLSEKYLNAKNRPIQLTLFHQRQQTDNILLPQLVVGTESVCGGLNYQVNCIATSPNLPLKEFIGLPATLKFVNDRGQLRNISGLITEANSGECDGGIASYRIVIRDAMAIMEQRVNTRIFRRMSWPQVVASVLKEWVQINTALAGIFDYEFVPGFRWEKYPEREQTIQFNESDTAFVRRLLARSGIASFIRPGRNRVWSREPRDTEAMAAHTLVMFEDQRALAQNAAGIVRYHRDDATEQRDSITRWGAERKLQAGSTSIFSWDYKQPGSIPRMSVDVPSKSNQGETGNQLASGLQEFIVESPHVAADNQELYRLGVVRVQRKEFDTKCFTGEGTIRDFCAGQYFTITDHPEIDRHPPAERDFVIMSVAVKARNNLPKSLEERAQRLFAWNGWHGSRFSIADLADDATSTPFQMRFEAIRRTIPIVPAFDPRTDLHDPGLQIAVVVGNENDVVHCDELGRVKIRFPATRLADYQHTGGAGASDTGSDSAWVRVATTWAGSGASDCGTLTLPRVGTEVLVAFLGGDSDKPIIICQLFNANALPPPLSKRAGLPLTRFLSGIRSEEIQGSRANMLLFDDTPREISAQLASDDGFSQLNLGWLTHPRGERRQPRGEGVELRSDKSVAIRGGKGILITANGSDKAEGNQLDRSELIGLVEGLHDIADQLAKLAETHAHDAADDSQLKQLVEKLRHLDAGTNTAEANGSSGGAPIVAVSGPAGIIVASNENLALGAEKNADLITAADTHLVAGGKTSIRAAQGISVFSNDSGMKHIAARGNIQTEAQDGTIEILAKKVMELISTTDWINIKARKGICFYGGGSELRISADGIVGKTAGKNHFYAADHQTFAKQAAQTQFPDELPHHDICIPCMLAAARAHSPLVEAE
>NZ_CP051685.1|WP_170202796.1|2939356_2940181_-|DUF4123-domain-containing-protein
MNNPRSDVSVYLLIDNGLLQEVAKSYAETHLQCRPVWLEPIYPETAMSVSPFLIDIETAYETGGLDTVMGYLNAVTPALHVSLIETRLDLQHIAQHLRRFICILDPEGKQFTLRYADCAVLEALASVLDSTQWATMHGPITRWHVHDRIGNLVQLPPVACVADGPTPLCLAHDQLTALDEESEPDHCIAKVKMMRHGGVLPGNAAEQHIWAKTAYQVWRAAENSNALILMFLTEAALLTKGMILQKNEIKKFFEMNEVGEFRKKLQPFIADHTH
>NZ_CP051685.1|WP_170202795.1|2938667_2939282_-|DUF3304-domain-containing-protein
MKIIIPNFLRWYPILSLTLTIAFLGICTILYEYFKVEDNTVVSLSAIHHLGEEYRVNNFYIDKRISGEIMEGGEGGGLICCITIPKIWTPNLMVEIRWEVNRIIQTSDFIKKAEMEGIYRARVPIESYTEADHLWVHFFPHGRVRVVVSRFGPHAELHPIEWDDMQATRKATTGSISKELFTPEEIAEFRHEDSLNRKKYGDWR
>NZ_CP051685.1|WP_170202804.1|2957608_2959534_-|glycoside-hydrolase-family-13-protein
MNKTIASLLVGSAFLAAGAHAGVPTGAAQDRTPSQPTAAKAPAANAAIRHMDPPFWWTGMEHKGLQLMVNGPAIAGLAPAIDYPGVRIAAVTRVASQNYLFIDLAIDADAKPGSFDIVFSAPDGRSVSYPYRLLAREQGSAERKGFDTKDAIYQVMPDRFANGDPTNDSVDGLADRLDRKLGHGRHGGDIQGMIDHLDYIEAMGFTQLWPTPLVENDMKSASYHGYAATDHYRIDPRYGSNDDYRRLSAEAKKHGIGLIQDVVLSHIGLNHWWMKDLPTPDWINHPKQFVQTMHHRTAVQDPYASKEDASNFTTGWFGRGMPDLNQTNPLVANYLIQNHIWWIEYAGLSGLRIDTFGYSDGAFLTEYTRRLMAEYPHLNMVGEEWSKLPAVVSHWQRGKVNFDGYVSSMPSLMDFPLAEAMRTALADKESKNIFNDVYETVSLDYLYPDPQRLVLFEGNHDMARIYSVVGEDFARYKMDIAFVMTMPRIPHFYTGDELLMTSATKERDDNSYRHDFPGGWAGDRVNAFTGAGLTARQKEAQDFVKKLVNWRKHNPVIHDGKLMHYGPQDNTYVYFRYDPKPGGRKVMVAFNANAGETVLDAGRFREMLAGVASGVDVLSGKTIGLQDRIRLPGKSVLVVEI
>NZ_CP051685.1|WP_170202805.1|2960089_2962861_+|TonB-dependent-receptor
MNLFANQRSGSRAFALSPVAAGCAVFMALAGQAAYAQDNTSAGTTANTEAAAATGATNSGVTTVKVTGIRRGIEAAISVKKNNDSIVEAISAEDIGKLPDQSIAESISRLPGLTAQRDIHGNASVISIRGMSPDFSTGLLNGREQVSTGDSRSIEFDQYPGELLSGVVIYKTPDANLVGQGLSGTVDLQTVRPLDFSKRTMAVNYRREKSGLGMDKKGHGNRFTFSYIDQFADRQVGIAFGFARLQGVGGDTSRFESWGNGTTTYQGRTVNVPYNGFNAFTETYSQERNGFMGVVQYRPSKTFSSTVDLFYSKYDRNTRNRGIQMPLNDTTSNAYDQPGQLINATLSGNNVTSGSFNNVRAVLRNDVEAWSDTTKSIGWNNKLKLDQDWTASLDLSFNSAERSGINIETYGSGTSFDTVGFTAGSRNFTTQLNYADPNTVRLTDPQGWGGADIQAGYVKFPHVYDKLNAVRFDVSRDLPDGWFFSKLSAGVNKSNRSKTREYTENLASIKGTTSPFASAPYPSGSGSGMAGDTGINVITFDPVASLNDVYTLRGKQHPDIFNKDWIVSEDVSTAFAKLGIDSQLGAIPVRGALGAQLVHTKQDSTAYSVDTNGGSGDTSRPTGSFKDGTSYNDFLPSLNLIGDLGSQQSLRFSLSKIMARPTLNDMRASSSFGYDTTRQQFSGSGGNPKLKPFRAKAIDVSYEKYWDSKAYVSAAVFYKKLDTYIVNAGQTYDFTPRLLPTSFQAPTNIGIYTSPVNGSGGNLKGVELAASLPLNLVTRYLDGFGVVVNGSQNSSAVSLPNTANGGSGTMDLPGLSKRVASLTVYYEKNGFSARAAERYRSDFIGEVATNTGDRELTYIQGEKVVDLQFGYEIQDGPAKGLSLLVQMNNVNDSHFIRYRQTKDNVIEDRRFGRSVMVGLNYKL
>NZ_CP051685.1|WP_170202806.1|2962967_2964479_+|tryptophan-7-halogenase
MTHQTPLHNIVIVGGGTAGWMAAASLSRLLKNRYAIRLVESDEISTVGVGESTIPMIRLFNNALGINEDEFVRETRATFKLGIEFEDWNRVGERYMHGFGRFGQDLGTLDFFQYWLRAHQAGRAPDLEHYSINRMAARAGKFMRPSNEVANSPLADIVYAFHLDAGLYARYLRRYAEAHGVLRTEGKVVEVRQRAGDGFIEALVMQNGERIEGDLFLDCSGFRGLLIEQTLQTGFEDWSHWLPCDRAWAVPCELSNDLLPYTRATARPAGWQWRIGLQHRTGNGHVYASRFMSDDEAASILMNNLDGAPLAEPRMLRFTAGKRNKVWNRNVVALGLASGFLEPLESTSIHLVQATLSRLMALFPDGGFDQADIDEFNRQSDFEVERIRDFLILHYHATERADTPFWDHCRTMDIPDSLRRKLDLYRSHGRVVRENNELFTEIGWQQVLHGQGIRAGAAHPLAGLLDERELADFLGRIENVVGKCVGVMPSHREFIAAIAAAKR
>NZ_CP051685.1|WP_170202807.1|2964593_2966426_+|DEAD/DEAH-box-helicase
MLDTPLQTFADLNIPAPILKALKDVGYETPSPIQAATIPLLMEGRDVLGQAQTGTGKTAAFALPVLAQIDTKLTAPQALVLAPTRELAIQVAEAFQSYAAHIKGFHVLPIYGGQSYGPQLSALRRGVHVVVGTPGRVIDHIEKGSLDLSQLKTLILDEADEMLRMGFIDDVEQILQQTPESRQTTLFSATMPPAIKRIAKTYLRDPQEVTVAAKTGTAENITQRYWLVAGLQKLEALTRILEAEPFDGMIIFARTKLGTEELAAKLQARGFAAAAINGDMAQQQRERTIDQLKNGKIDILVATDVAARGLDVERISHVINYDVPSDPESYTHRIGRTGRAGRSGDAILFITPRERGMLKAIERATRQPVSQLTLPTIKAVNEVRIARFKEQIGEALAAGGLDVFRSLIEDYEREQNVPAIDIAAALAKLYRGEEPLLIEKPDREPKPAAEWREREGSEGRAERPVRAARESFGDERAPRAPREGREGFGQARPDEGRGGFKKERVARAPEAGMATYRIEVGHAHGVKPGNIVGAIANEGGIASKEIGRIEIYDDFSTLDMPADLPNDLVDHLKKVWVAGQQLAITRDGEAPPEKKPAKRKFADKKPHRKG
>NZ_CP051685.1|WP_170202808.1|2966745_2968083_+|MFS-transporter
MDMQTNTLKPRLSFWQLWNMSFGFFGIQFGFALQNANTSRIFATLGASPDDLPTFWLAAPVTGLLVQPIIGYLSDNTWHPTWGRRRPFFFLGAVLAAIALFLMPNSSAVWMAVLLLWMMDAAINVSMEPFRAFVGDKLDASQQTAGFAMQTFFIGCGAVIASLLPMFFSDVMGVSNVPVDGAIPDSVRYSFYIGGLVFLLAVSWTVFSADELPPPDMARFQAQRRHARNFGVALREIVGGFAHMPKTMVQLAFVQFFTWIALFSLWIYTGSAVADNVYHTVDAQSAAYQEAGNWVGIMFAVYSGVSALAAFILPVLARATSRKTCHTVCLAIGGLSLASLFFITDKHMLMVPMIGVGIAWASILTMPYAILAGALPASRMGYYMGLFNFFVVIPQIVSGLLLGFLTKHLFEGHTVRTLVLGGACMLLAAVLTTFVTDNAKQAGAK
>NZ_CP051685.1|WP_170202809.1|2968176_2969808_+|alpha-D-glucose-phosphate-specific-phosphoglucomutase
MTIQTIATTPFAGQRPGTSGLRKKVTEFQQPGYLENFVEAIFLTLGDCSGRTLVLGGDGRFFNREAVQTILRMAAAHKVAKVLVGRGGILSTPAVSCVIRKHGANGGIVLSASHNPGGPDGDFGIKYNIENGGPAPEKITEAIFAHTLTVNAYRISDAGPVDLDRIGTTQLEDMQVEVIDPVADYAELMERLFDFDAIRALFSKGFRMRFDGMSAVSGPYAKAIIEGMLGAPAGTVINGEPREDFGGHHPDPNPVNAAELVALMDGADAPDFGAASDGDGDRNMIVGRRLAVSPSDSLAIIAANATLAPGYRAGLTGIARSMPTSQAADRVAAALGIPCYETPTGWKYFGNLLDAGMATLCGEESYGTGSDHIREKDGLWAVLFWLNLLAATGKSVNQLVEEHWARFGRNYYSRHDYEAVDAEAADQMMGALRGKLAELPGQDLGGYTVQLADDFVYTDPVDNSVATRQGVRIVMTDGSRVVLRLSGTGTEGATVRIYLERYEADPARHGLDTQAALAPLIAIAEQLSALKARTGRQQPSVVT
>NZ_CP051685.1|WP_170202810.1|2969836_2971555_+|alpha-amylase
MKYHALAVSLMLAFGAAAAQAPAPAASAPATPVPAPAQQGKPFTWENATVYFLLTDRFNNANPANDLAYGRKADAATARGFMGGDLAGVTAKIKEGYFTDLGVDAIWITPPVENIHGSTDEGTGKSYGFHGYWASDFTALDANLGSEQDMRELVDTAHAHGIRVLLDVVMNHTGPVTAQDPAWPASWVRTGPVCGFKTMRTTVECTLVKNLPDIRTDSNARVELPPTLVAKWKREGRYEREVKELDAFFQRTGYPRAPRYYLMKWHADWVRKYGFDGFRADTVKHTEPGVWKDLKQVAGAAYEAWKKGEAGQAAVKQIGDRPFFMTSEVYGYSINDGRKFAYDDGTKVDYFANGFDSMINFSMAGDARGGYEKLFAGYSNMLTGPLKGVSVLNYLDSHDDGNPFDALRQRPLEAANKLLLAPGQAQVYYGDESARVLKIDGAEGDANLRSFMNWDQLKANTRVGLHGAADVREHWARLGRFRHAHPAVGAGVHQMIAASPYTFKRTYANDGVTDRVVVALDLPPGAPASISVAGVFMDGQTVRDWYTGKSAVVKGGKVQFDAQAPVALIAQD
>NZ_CP051685.1|WP_170205417.1|2971685_2972705_+|alpha/beta-hydrolase
MTACLSIFPLLASAAAPAAAAPATASVEAVYGPELEGFDYPYPVQQYRFTSQGVALHMAYMDVKPDRPNGRTVVLLHGKNFCAATWKASIDALKEAGYRVVAPDQVGFCKSSKPEHYQYSFQQLAANTRGLLESIGVKQATVMGHSTGGMLAVRYGLLYPEQTEQLVLANPIGLEDWKALGVPSLGVDKWFERELATNADKIRAYEKSTYYVNQWKPEYEPWVQMLAGMNRGPGKRLVAWNSALLYDMIYTQPVVYELPLLRMPVLLLIGTKDTTAIGKDAAPAEVRAKLGNYAELGKRAASAIPKATLVELDGMGHAPQMQDPAVFHAALLKGLGAGR
>NZ_CP051685.1|WP_170202811.1|2972987_2974850_+|glucokinase
MTLPDTEPKQPRAAYSDGPRLLADIGATHARFALESAPGVLRNVAVLLCDDYPGIVPLLNAYLAQAGAGRISHAAFALANPISGDFIRMTNRDWQFSTDEVRRALGLNTLLIVNDFTALAMALPGFKPDDLLQIGGGKPQSNAVAGVLGPGTGLGVSGVIPTVDGFVTLGSEGGHMNFAPADEREFAILQYAWREFSHVSNERLISGPGMEIIYRALAERNGVSDAPARNAAEIASCALEQGDALCLEVLECFAGMLGGAAANLAVTLGAFGGIFIGGGIVPRMAQWFETSPFRARFEAKGRFTDYLAQIPTYVIMMPTPALYGVSSILSEHLRNRSGANTLMEKVQNLQHELSPAEQRVAALVIDHPRKVLSEPIAEIAKLADVSQPTVIRFCRSLGFSGLADFKLKFAGSLTGTIPVRHSQVRMTDSTHDLSAKVIDNTVSAILKFRDQLDVNSIDRAIELLRRAKRVEFYAMGNSRVVALDGQHKFFRFRIPTSSYGDSHLFALAAELLGPGDVVIAISTAGQLPELLSAVDTARAAGADVIAITSSKSALARKASICLAVDHSEDSTTFLSMISRILQLLLIDIMAVGVSLGPQGEAALEGADSERRRMLISHLDS
>NZ_CP051685.1|WP_170202812.1|2974851_2975967_+|serine-hydrolase
MRGVAALAVAALVGASAGCVAAAAPPPSPAGCDAAALAAQGFDAQQLCRVLDDVAAGNPDLHGLLVERHGVPVVERYRSGKDRSVYSLFAHEVDFGPATRHDLRSISKSITGLLWGIAEAEGKAPPLDTRVLDLFPELADLETAGRAAITVRHLLSMTSGLAWDEAGAYDWRNDELALYWRSSQARYVFGRRMAAPAGTRFRYNGGGTAVLAAALAQRTGMALPDYAREKLFAPLGIVDWEWLRDARGRPLAFSGLRMRPRDLARIGQLVLQHGQWHGRQIVPRAWIEASLVPQADVGDGRRYGYQWWLGDTVAAGAPHRWAAAFGNGGQRLFIVPDLDLVVVMTAGAYDDEAGAIRINRLFRRIAAAVAK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051685_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_3

3659409-3659528

Orphan

Consensus_repeat	Method
AGGCGCACTACTGTCCAAGATAGTATTGCTGGCCTAAAGACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051685_3

>merge|NZ_CP051685|3|3659409-3659528|CRISPRCasFinder
AGGCGCACTACTGTCCAAGATAGTATTGCTGGCCTAAAGACCGTCGTTCCAGGCACTGCCTGAAACGACTCCCCGCGAAGGCGCACTACTGTCCAAGATAGTATTGCTGGCCTGAAGACC

>NZ_CP051685|3|3|3659409-3659528|CRISPRCasFinder
AGGCGCACTACTGTCCAAGATAGTATTGCTGGCCTAAAGACC	GTCGTTCCAGGCACTGCCTGAAACGACTCCCCGCGA
AGGCGCACTACTGTCCAAGATAGTATTGCTGGCCTGAAGACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170203324.1\|3668114_3668681_-\|gamma-glutamylcyclotransferase	unknown	unknown	gnl\|CDD\|368097
NZ_CP051685.1\|WP_170203309.1\|3646592_3647054_-\|response-regulator	unknown	unknown	gnl\|CDD\|381108
NZ_CP051685.1\|WP_170203319.1\|3663627_3664392_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379235
NZ_CP051685.1\|WP_170203314.1\|3654590_3655022_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP051685.1\|WP_170203311.1\|3649750_3651673_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|237425
NZ_CP051685.1\|WP_170203323.1\|3667450_3667993_-\|ankyrin-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|293786
NZ_CP051685.1\|WP_170203316.1\|3659818_3660466_+\|NADPH-dependent-FMN-reductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP051685.1\|WP_170203312.1\|3651778_3652981_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224001
NZ_CP051685.1\|WP_170205471.1\|3644454_3644700_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170203315.1\|3656820_3657903_+\|HlyD-family-secretion-protein	unknown	unknown	gnl\|CDD\|224482
NZ_CP051685.1\|WP_170203321.1\|3665934_3666702_+\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP051685.1\|WP_170205473.1\|3661524_3662742_+\|PA0069-family-radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
NZ_CP051685.1\|WP_170203313.1\|3653135_3654398_-\|prolyl-oligopeptidase-family-serine-peptidase	unknown	unknown	gnl\|CDD\|223489
NZ_CP051685.1\|WP_170203318.1\|3662794_3663397_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP051685.1\|WP_170203310.1\|3647067_3649365_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|226702
NZ_CP051685.1\|WP_170205472.1\|3657935_3659372_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP051685.1\|WP_170203317.1\|3660633_3661284_+\|DTW-domain-containing-protein	unknown	unknown	gnl\|CDD\|377168
NZ_CP051685.1\|WP_170203308.1\|3644924_3646529_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP051685.1\|WP_170203322.1\|3666750_3667305_+\|RNA-2'-phosphotransferase	unknown	unknown	gnl\|CDD\|179136
NZ_CP051685.1\|WP_170203320.1\|3664414_3665749_-\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|234897

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170203324.1\|3668114_3668681_-\|gamma-glutamylcyclotransferase	gnl\|CDD\|368097	pfam04752, ChaC, ChaC-like protein. The ChaC family of proteins function as gamma-glutamyl cyclotransferases acting specifically to degrade glutathione but not other gamma-glutamyl peptides. It is is conversed across all phyla and represents a new pathway for glutathione degradation in living cells.	4.90929e-54
NZ_CP051685.1\|WP_170203309.1\|3646592_3647054_-\|response-regulator	gnl\|CDD\|381108	cd17557, REC_Rcp-like, phosphoacceptor receiver (REC) domain of cyanobacterial phytochrome response regulator Rcp and similar domains. This family is composed of response regulators (RRs) that are members of phytochrome-associated, light-sensing two-component signal transduction pathways such as Synechocystis sp. Rcp1, Tolypothrix sp. RcpA, and Agrobacterium tumefaciens bacteriophytochrome response regulator AtBRR. They are stand-alone RRs containing only a REC domain with no output/effector domain. The REC domain itself functions as an effector domain. Also included in this family us Methanosaeta harundinacea methanogenesis regulatory protein FilR2, also a stand-alone RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.12847e-63
NZ_CP051685.1\|WP_170203319.1\|3663627_3664392_+\|ATP-binding-protein	gnl\|CDD\|379235	pfam13521, AAA_28, AAA domain.	2.71689e-30
NZ_CP051685.1\|WP_170203314.1\|3654590_3655022_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	2.40268e-15
NZ_CP051685.1\|WP_170203311.1\|3649750_3651673_+\|PAS-domain-S-box-protein	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	1.11639e-135
NZ_CP051685.1\|WP_170203323.1\|3667450_3667993_-\|ankyrin-repeat-domain-containing-protein	gnl\|CDD\|293786	sd00045, ANK, ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.	1.21581e-25
NZ_CP051685.1\|WP_170203316.1\|3659818_3660466_+\|NADPH-dependent-FMN-reductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	1.20529e-39
NZ_CP051685.1\|WP_170203312.1\|3651778_3652981_-\|hypothetical-protein	gnl\|CDD\|224001	COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only].	3.30088e-09
NZ_CP051685.1\|WP_170203315.1\|3656820_3657903_+\|HlyD-family-secretion-protein	gnl\|CDD\|224482	COG1566, EmrA, Multidrug resistance efflux pump [Defense mechanisms].	1.35224e-88
NZ_CP051685.1\|WP_170203321.1\|3665934_3666702_+\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	2.34923e-20
NZ_CP051685.1\|WP_170205473.1\|3661524_3662742_+\|PA0069-family-radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	1.00066e-19
NZ_CP051685.1\|WP_170203313.1\|3653135_3654398_-\|prolyl-oligopeptidase-family-serine-peptidase	gnl\|CDD\|223489	COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism].	1.11684e-17
NZ_CP051685.1\|WP_170203318.1\|3662794_3663397_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.1421e-20
NZ_CP051685.1\|WP_170203310.1\|3647067_3649365_-\|GAF-domain-containing-protein	gnl\|CDD\|226702	COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms].	0
NZ_CP051685.1\|WP_170205472.1\|3657935_3659372_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	4.68343e-78
NZ_CP051685.1\|WP_170203317.1\|3660633_3661284_+\|DTW-domain-containing-protein	gnl\|CDD\|377168	pfam03942, DTW, DTW domain. This presumed domain is found in bacterial and eukaryotic proteins. Its function is unknown. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after.	1.0659e-53
NZ_CP051685.1\|WP_170203308.1\|3644924_3646529_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	3.52837e-121
NZ_CP051685.1\|WP_170203322.1\|3666750_3667305_+\|RNA-2'-phosphotransferase	gnl\|CDD\|179136	PRK00819, PRK00819, RNA 2'-phosphotransferase; Reviewed.	2.20651e-80
NZ_CP051685.1\|WP_170203320.1\|3664414_3665749_-\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|234897	PRK01096, PRK01096, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	1.97277e-164

>NZ_CP051685.1|WP_170205472.1|3657935_3659372_+|efflux-transporter-outer-membrane-subunit
MAPHPRARLAAGAAVLALGPLLLAGCRLPVQTPPARTLAVPGEWRGEVEAAPQAGAVETGWWRSFGDPALDALVTQALASNADIRTAQSRLQEYRARIDVARSALQPALSVGLTPARARAIGPFGTPVEATTLQGNVQASYELDPFGRLAGTLDAARLDLASQQAAADATALAVAANTASGYLNLRGLDAQLALARDTLASRSRSLALARRQFEVGYSSRLELAQAEAEFRATAAVVPQLERSITQQENALALLLGASPGPIARGTTLNELRAPAIQPGLPSALLRRRPDIAQAERAIAAADANLAVARDQMLPSLRLTASVGGYAHSLPDLLGSGTTLWSVGGSILAPLFDAGRLRAQADVSASLRDRAVFAYEAVVRNAFAETENGLSAVQRLREQLEQSEARAVATGETLRVAHNRYRNGYSSYLEELDAQRNNFSAETNVLQLRASYLAAHVDLYRALGGGWGAAAPARTAPAP
>NZ_CP051685.1|WP_170203315.1|3656820_3657903_+|HlyD-family-secretion-protein
MPESATTTQRQSNRKVIASGLLFALVALTGVLIVLYAWNLPPFHSAIQSTENALVRGQVTIISPQLSGYVVEVDVQDFQTVRQGQLLMRIDDRIYLQRLEQARAALATQRAALANFAQSQGSARATIAQNEAAVANADAQSRRASADLRRVEELAADGSLSARERDAARATRAQTVAATAQAAAALDIARQNLRTVDVNRGALAAAVANAEAAVKLAEIDLANTRILAPRDGQLGQVGVRLGAFVNAGAQLTALVPQAMWVIANMKETQMADVRLGQPVTFTVDALNHARLRGRVQEIAPATGSEFSVITPDNATGNFVKIAQRIPVRISIDANQALAQRLRPGMSVVASIDTAPKGPAR
>NZ_CP051685.1|WP_170203314.1|3654590_3655022_+|MarR-family-transcriptional-regulator
MFPVEERFTIALHAGARAWRAALERHLKANGVTAAGWSALAVLAAAMEPPSQRELARRLGVDGATLVSTIDRLVAGGLVERLPGPHDRRVKLVALTDAGRDLAGRVEREAALLRLAIAERIDGERLESAAAVLEELQRILEHA
>NZ_CP051685.1|WP_170203313.1|3653135_3654398_-|prolyl-oligopeptidase-family-serine-peptidase
MFRALASVRTLTTALIASLALLPGLAIEQELQLDYHINERIVLIPAGNNHQSRLETTVFQPNGPGPFPLIIINHGKDPGRTNLQPRDRFYYMARAFVERGYAVIVPMRQGFANSTGRYRDHGCDMTANGYTQAEDILSALDYARAQKWVDADHVVIAGQSYGGLATMALGTQDLPGVRGLINFAGGLRDDGDSCGWRSALVAAFSQYGAENRVPSLWMYGRNDSLFGPELVARMHDAFEQAGGKAELVEYAPFKRDSHGMLASRDGARVWLEDTMKFLKGVGMPTEVLYKIPEPPMPQPTDFAGVGDIDSVPFLSENGRRAYKEYLTKLTPRAFAISPSGGWCWAEEGEDPESRALATCSAKSDKPCRLYSVDEHVVWNPDLLEKAAVTASNTPAPAPALDGPGGAPGATALGSTAMLPH
>NZ_CP051685.1|WP_170203312.1|3651778_3652981_-|hypothetical-protein
MLRLIKVCACALLAFPLLLTAGNAGAANNYPVVLVHGFLGFGPDAYPGSGFLYWGGYQNIAAHMQLYHGPHAVYAAGVGAISSNWDRAAELYAQIKGGCVDYGAAHMANSGDFGQVQKPPGKCWAADPKDNPDGYPLALYPQWDEAHPIHLIGHSQGGTTIRALIQLLEHGSPNGDEGGYDLYRGGKVGWVRSAVTLSAPHNGTTLRDAILNVLPMLRSPLRDIVDHRLANWELSPDGAREFNTWAQTSPRVYYFSVGTLATEAGAWCCNGTDRLLAPVQSANFQYPRVDMMSYFKPYAGEWIVPSLGQPGMGSYTQSSPDRVRIDSSWFPNDGVVNTVSMRAPNGQPVRDYDGTALRGSWNFLGNYRGYDHFDILNWPHQGDSADAIYDRISDIIFALE
>NZ_CP051685.1|WP_170203311.1|3649750_3651673_+|PAS-domain-S-box-protein
MNDQTQPRKSLLDERRFEYLISGISDYAIYMLDPRGLVSSWNAGARRFKGYQTQEILGEHFSRFYTPEDREAGMPARALDTALTQGKYEAEGWRMRKDGSRFWAHVVIDPIYDEHAQLLGFAKVTRDVTERKRAEDALRESEQRFRLLVQGVTDYAIYMLSPEGTVTNWNTGAERIKGYLQDEIVGSHFSRFYIDEDKLAGIPAHALGTASSAGRFEAEGWRVRKDGSRFWAHVIIDAIHDESGTLIGFAKITRDLTEKKRAAQALEAADKALFQAQKMESIGQLTGGVAHDFNNLLSVLSSGLEVLALQRAEGDVRTIESMRRAVDRGARLTQQLLAFARQQPLQAEVRNINRIISGFETVLRRAGNSAIDFTIDLDRKAHSAEIDSARFESALLNLVVNARDAMPDGGRLLLTTANAALDGKSGPAQLAALPPREYVRISVADSGTGMPPDVVARAFEPFFTTKEVGKGTGLGLSQVYGFIKQSGGEVVIESRPGEGTTVSIYLPAVVDATVEDDNGHIERVLIVEDEPDLMDVAASLFTSMGYEVVTAASGYEAIDVMRQRDVDILFTDVVMPNGMNGIELASYTREHYPDTRIMLASGYPLPALKQRHGSGLGEFAFVNKPYRLSDLARTLRSAMR
>NZ_CP051685.1|WP_170203310.1|3647067_3649365_-|GAF-domain-containing-protein
MNKAINAELLDLSNCAKEPIRTPGSIQPHGFLLALSDELTVLQASANLGDWAGCSAAAVVGGPLAGVIGEDGVQRIVAQLGPELGSHPFYAGTVGIRSKRHFDVLAHRWDRVTYLEFEPVDRAEAADFRHLYPLIGDFLLKVNEAGSIQMLAQQACEHVRAVTGYGRVVAYQFDPDGHGHVMAESLEAGYHAYMGQHFPATDIPAQARELYLLQHIRLIQNADYHPAALVPALNPLTQQPNDLSFAALRSVSPVHLQYMRNMETLASMSVSLIVKGKLWGLISCHNRDPKPVGFEKRTACEQLGQILALCIESREDARELQFRLEVRRIMVAMLAGLTQGSNFIDNLSSVFPDLLRFARAAGAAIVVDDRILLHGDTPGKEEIAALVDWLARSEHGDLYHTDNLSRAWPPAAAMVRNASGLLALPISRIHKHYLLWFRPEYVHTIEWAGNPREKEAADKALHGAPLQLSPRTSFASWRETIHGSSVRWHAGELELALEFRTALLGIVLERAEQMAELAGELGRANKELEAFSYSVSHDLRAPLRHIVGFSDLLLESAGSEDAVQRQRFLKNIKESARLAGKLVDDLLSFSQMGRAALRPTEVDMNDLVNSCIHKLAPETRGRDIEWDVAPLPVVWADPTFLHLALSNLLANAVKFTGQREMARIRISADDHAQETVFHVDDNGAGFNMDYVHKLFGVFQRLHRMEDFQGTGIGLANVRRIVERHGGRVWADSVLGESASFSFALPKHEDEDEADDGAQADNPTKQ
>NZ_CP051685.1|WP_170203309.1|3646592_3647054_-|response-regulator
MLKPILLVEDNPNDLELTLIALSKSQLANQVVVMRDGAEALDYLHRRGEHATRVAGNPAVVLLDLKLPKVDGLEVLKDIRETDSLKPLPVVMLTSSKEEQDLVRSYELGVNAYVVKPVDFTDFVRAISDLGIFWAVLNEPPPGSQRYIKPPKN
>NZ_CP051685.1|WP_170203308.1|3644924_3646529_+|response-regulator
MSQYEPNPCSVLLIDDEPFAEDIISHGLKGCAAHTLRYANRAELAVELAREVAATVVLVDLRMPGVDGFEVTRRLRAERDTENVPVILLSSEEDPDIKAMAFAAGANDYLVKWPDPRELVARVRYHSDAFGARRQRDAAFVSLRLSQEQLAASQSALYQAQKMEAIGQLTGGVAHDFNNVLQIIGGNLQLLKLVGNLNDAGRTRVDMALSGVERGAKLSSHLLAFARRQPLQAVVTHPGHLLREMDDMMRRLLGPNASVVTDIADGLGSALVDPNQLNNVLLNLAINARDAMGGSGTLTIRAANVEPDTPVPATLAPGRYIAIEVLDTGKGMPPDVLERAFEPFFTTKPLGQGTGLGLSMAYGFVKQSGGDIVLASEIGRGTSVRIFLPRVDAEPVRQRNSAAAPLQGGAETILVVEDEDAVRDTTCGILSALGYRVLQAADAAAALAIIDDGQAIDLVFTDVIMPGPVSSLQLGEAVRAKLPRAQVLYTSGYAEGVLTHEGKLDAAVDLLQKPYHPDALSARIRHLLRRGRQG
>NZ_CP051685.1|WP_170205471.1|3644454_3644700_+|hypothetical-protein
MNIDRHHLIPKSLKGKEQFPIHKICHRKIHATFSEKELLRSYHTWGALQADADIGSFIGWVANKPPEFYTRTFTSNKKKQR
>NZ_CP051685.1|WP_170203316.1|3659818_3660466_+|NADPH-dependent-FMN-reductase
MIKIGVIAGSTRPGRRALDVANWVLDVAGMRGDAVFELVDIQEYKLPLLDEPVPPSMGQYTQPHTKVWSAKIAGFDGFVFVTPEYNHGTSGALKNAIDFLFKEWNDKAAGFVSYGSIGGARAVESLRLVMGELMVADVRAQVMLTLRDDWQEHAFKPREHHEQALDTLLDQVVAWSRALKTLRHDAEQPALADAPQLAPELAAEAPPPGRRVGSM
>NZ_CP051685.1|WP_170203317.1|3660633_3661284_+|DTW-domain-containing-protein
MTDPLPSRRPECGACLRAQSACICRWAAPVASSVELLILQHPLEVRNAKNSARLLHLCLPESSRIVVGEAFAPGDLETLLHGGGRTPLLLYPETPGVATPGVATPGVATPGVTAPDDAVPDAQPAALRLVLLDATWRKSRKMLYLNPALQWLPRLALQAAPPSAYLIRKAHAPHQLSTLEAAVHALAQLEGAPARYRPLLAAFDGFVQQQAAQFRA
>NZ_CP051685.1|WP_170205473.1|3661524_3662742_+|PA0069-family-radical-SAM-protein
MPEAALRSAGARGANLALDLHPDLPIKGRGAVTNIQSRFEVHGRERFDDGWTIPVQAPAQPRGQVPARDQHQDQAASLKTVVTDEIARSILSRNSSPDIPFGVSLNPYRGCEHGCIYCYARPSHGYLGLSPGLDFESKLFAKVNAADLLRQELARPGYVPHNIAIGVNTDAYQPCERNKRITREVLEVLAECRHPYGLITKSALIERDIDLIAPMAEQGLACAAITLTTLDGEIARTLEPRAAAPARRLRAIRTLTEAGIPVSVSVAPIIPFVTEPEIERILEAARDAGAVGAHYTVLRMPWEVNPLFQQWLQTHFPDRAQRVLNRIRDMRGGKEYDSDFGKRMTGEGVWADLIRQRFTKAVKRLGLDGYTSRFNKLDGEQFRRPVVVPKTAKQTIAEAAQMDLF
>NZ_CP051685.1|WP_170203318.1|3662794_3663397_-|GNAT-family-N-acetyltransferase
MTHLDAGAYLLRPFVPDDAPAFAAAVRESVSSVGRWMDWAHAGFSEQNALDWFAACDAGRADGSSHEFAIVSKVERRLVGGAGLNKFIQLHAFCNLGYWVRTSAQRQGAASAAVAALARHAFQSLGQARVEIVVADGNAASLAVARRSGAQHECLARRRLQLRGRAVDAHMFALIPEDFPDLPTHIAALRCAPGHTRSPA
>NZ_CP051685.1|WP_170203319.1|3663627_3664392_+|ATP-binding-protein
MAEQGSAVEHAQRAGQQRAAKEQAPGKQRESGEQQAGQQRQAAQPSQQRQQEQQAQQEQQAREAAWPGSGPPAAAQSAAQRVVFVGAESTGKSTLAEYLARVYDSVSVPEIGRFIWEQKQGKLDADDYVDIALKHRQAEDEAMQRARRWLFVDTNALTTLLLGLQFGQVTPPAPAELLRCADECAARYAHTFVCADDIPYEEQEVRENEAWRGRIQRLVLQDLEARGIPYTIVRGSVEERAAQVMGVLDARPPA
>NZ_CP051685.1|WP_170203320.1|3664414_3665749_-|deoxyguanosinetriphosphate-triphosphohydrolase
MTMEWPRLVSTMRLGREDDRGEDASRTGYMRDWDRVVYSSAFRRMQDKTQVFPLSDNDYVRTRLTHSIEVSSVGRSLGMLCGEFILRKEAALTMAPQDFGSIVAAACLAHDIGNPPFGHSGEAAIQSWFSDHRARWLDGLSERERQDFLRFEGNAQGFRLITRLQNAVDHGGFQLTCAVLAAFAKYPRASDLPADKGRISEKKFGYFAHDADNFARVALQTGLLQKAPGAWARHPLAFVMEAADDICYGIVDLEDGHRLARVSFEQAHALLWPIAFPDGQQASASYRQLDDDEGRIEYLRARAIGNLVRAALAVFEEHYDAIMAGRFEHDLAGRSRFAPQLKEIAALSRERIYATPSVLQIEAAGFEILGGLLEKIVPALATPVDERSPVHRKIVQIVPRQFTRGTSAYERLLGATDFISSMTDTYALKLFRRLNGIELPGTMV
>NZ_CP051685.1|WP_170203321.1|3665934_3666702_+|PadR-family-transcriptional-regulator
MHHHHHHDHCHDHQAHGDRQHGPAGFAGRHGGHGDGPGTHGEGRHAHGHGHGGGRGGRPGRGGGRGGFGFDDDGGMPRGRKLSSDDLQLLLLALIAERPGHGYELIKELEARSNGFYVPSPGMMYPALACMEDQGHVTIEQEGNRKRYAPSDEGRAHLEANRERADAMLAKLQQAADKMARMRSALSGEEGAGDPAGEGRRGGWVSEFHDARHALKHALHACGDAGEDEQRRIAAILARAAAEIDGQAGAGQQQA
>NZ_CP051685.1|WP_170203322.1|3666750_3667305_+|RNA-2'-phosphotransferase
MSPDPIVATSKLLSYVLRHRPDSIGIALDANGWTGVDELLARLAAGGHAVDRDLLQRVVAGNDKQRFAFSADGSRIRASQGHSVAVDLGLVAAEPPAVLYHGTASRFLKSILVSGLKASGRQHVHLSADAATARTVGARHGFPVVLRVDARRMRADGLVFYRSDNGVWLTQAVMPRYLDAAGNA
>NZ_CP051685.1|WP_170203323.1|3667450_3667993_-|ankyrin-repeat-domain-containing-protein
MQQQPPTSPAQRPELDEDTLAFVRRVFGLVRAGEAVELSSLLERGLPRNLRNERGDSLLMLACYHGHFDAAKTLLEHGADPEVQNDAGQTPLAGVAFKGDLPIATLLLDHGAQVDNAGPNGKTALMFAAMFNRVDIAQLLLARGADPLRPDADGNTILDAARKMGAHDTAELLASATGAA
>NZ_CP051685.1|WP_170203324.1|3668114_3668681_-|gamma-glutamylcyclotransferase
MSLNTVEINQRMDKFDRHASVWLFGYGSLIFKADFPFLERRPAHIAGWTRRFWQGSHDHRGTHSAPGRVVTLVPEPGALCHGMAYLVTPDAFAHLDYREKNGYLRLATDIRFEDGASIEGLVYIATHENAAYLGPASERDIARQIAAASGPSGPNVDYLLELAGALRELGKFDPHVFEIERHLAAFKP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051685_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_4

4207935-4208037

Orphan

Consensus_repeat	Method
GTTTCAGGCAGTGCCTGGAACGACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051685_4

>merge|NZ_CP051685|4|4207935-4208037|CRISPRCasFinder
GTTTCAGGCAGTGCCTGGAACGACGGTCTTTAGGTCAGCAATATTATCTTGGACAGCAATGCGCCTGCGCAGGGGTTGTTTCAGGCAGTGCCTGGAACGACGG

>NZ_CP051685|4|4|4207935-4208037|CRISPRCasFinder
GTTTCAGGCAGTGCCTGGAACGACGG	TCTTTAGGTCAGCAATATTATCTTGGACAGCAATGCGCCTGCGCAGGGGTT
GTTTCAGGCAGTGCCTGGAACGACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170203699.1\|4199507_4200350_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|131868
NZ_CP051685.1\|WP_170203708.1\|4212120_4212999_-\|chemotaxis-protein	unknown	unknown	gnl\|CDD\|224271
NZ_CP051685.1\|WP_170203712.1\|4221777_4225239_+\|exodeoxyribonuclease-V-subunit-gamma	unknown	unknown	gnl\|CDD\|335690
NZ_CP051685.1\|WP_170203711.1\|4219585_4221631_-\|S9-family-peptidase	unknown	unknown	gnl\|CDD\|224422
NZ_CP051685.1\|WP_170203709.1\|4212998_4218008_-\|response-regulator	unknown	unknown	gnl\|CDD\|236848
NZ_CP051685.1\|WP_170203697.1\|4197677_4198502_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_169433516.1\|4202054_4202285_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170203701.1\|4201662_4201839_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|184603
NZ_CP051685.1\|WP_170205513.1\|4196270_4197602_-\|erythromycin-esterase-family-protein	unknown	unknown	gnl\|CDD\|377470
NZ_CP051685.1\|WP_170203700.1\|4200540_4201644_+\|DUF4380-domain-containing-protein	unknown	unknown	gnl\|CDD\|373010
NZ_CP051685.1\|WP_170203698.1\|4198470_4199193_-\|phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|224837
NZ_CP051685.1\|WP_170203714.1\|4229155_4231366_+\|exodeoxyribonuclease-V-subunit-alpha	unknown	unknown	gnl\|CDD\|236783
NZ_CP051685.1\|WP_170203702.1\|4202750_4204871_+\|ATP-dependent-helicase	unknown	unknown	gnl\|CDD\|223288
NZ_CP051685.1\|WP_170203704.1\|4206114_4207842_+\|glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237027
NZ_CP051685.1\|WP_170203713.1\|4225235_4229159_+\|exodeoxyribonuclease-V-subunit-beta	unknown	unknown	gnl\|CDD\|236784
NZ_CP051685.1\|WP_170203706.1\|4208430_4211094_-\|M1-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341064
NZ_CP051685.1\|WP_170203703.1\|4205300_4205948_-\|phosphohydrolase	unknown	unknown	unknown
NZ_CP051685.1\|WP_170203705.1\|4208058_4208421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170203707.1\|4211293_4211914_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
NZ_CP051685.1\|WP_170203710.1\|4218403_4219135_+\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377050

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170203699.1\|4199507_4200350_-\|S-formylglutathione-hydrolase	gnl\|CDD\|131868	TIGR02821, S-formylglutathione_hydrolase, S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification].	7.19148e-156
NZ_CP051685.1\|WP_170203708.1\|4212120_4212999_-\|chemotaxis-protein	gnl\|CDD\|224271	COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms].	2.61411e-25
NZ_CP051685.1\|WP_170203714.1\|4229155_4231366_+\|exodeoxyribonuclease-V-subunit-alpha	gnl\|CDD\|236783	PRK10875, recD, exodeoxyribonuclease V subunit alpha.	1.95029e-168
NZ_CP051685.1\|WP_170203711.1\|4219585_4221631_-\|S9-family-peptidase	gnl\|CDD\|224422	COG1505, COG1505, Serine proteases of the peptidase family S9A [Amino acid transport and metabolism].	0
NZ_CP051685.1\|WP_170203709.1\|4212998_4218008_-\|response-regulator	gnl\|CDD\|236848	PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional.	7.08049e-54
NZ_CP051685.1\|WP_170203701.1\|4201662_4201839_-\|hypothetical-protein	gnl\|CDD\|184603	PRK14282, PRK14282, chaperone protein DnaJ; Provisional.	0.000388283
NZ_CP051685.1\|WP_170203700.1\|4200540_4201644_+\|DUF4380-domain-containing-protein	gnl\|CDD\|373010	pfam14315, DUF4380, Domain of unknown function (DUF4380). This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 288 and 372 amino acids in length. There are two completely conserved residues (G and E) that may be functionally important.	1.73957e-114
NZ_CP051685.1\|WP_170203698.1\|4198470_4199193_-\|phosphoribosyltransferase	gnl\|CDD\|224837	COG1926, COG1926, Predicted phosphoribosyltransferases [General function prediction only].	2.69672e-80
NZ_CP051685.1\|WP_170203702.1\|4202750_4204871_+\|ATP-dependent-helicase	gnl\|CDD\|223288	COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair].	3.69413e-154
NZ_CP051685.1\|WP_170203707.1\|4211293_4211914_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	1.18829e-38
NZ_CP051685.1\|WP_170203713.1\|4225235_4229159_+\|exodeoxyribonuclease-V-subunit-beta	gnl\|CDD\|236784	PRK10876, recB, exonuclease V subunit beta; Provisional.	0
NZ_CP051685.1\|WP_170203706.1\|4208430_4211094_-\|M1-family-metallopeptidase	gnl\|CDD\|341064	cd09601, M1_APN-Q_like, Peptidase M1 aminopeptidase N catalytic domain family which includes aminopeptidase N (APN), aminopeptidase Q (APQ), tricorn interacting factor F3, and endoplasmic reticulum aminopeptidase 1 (ERAP1). This M1 peptidase family includes eukaryotic and bacterial members: the catalytic domains of aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; alanyl aminopeptidase; EC 3.4.11.2), a type II integral membrane protease, preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1, also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP), or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established.	0
NZ_CP051685.1\|WP_170205513.1\|4196270_4197602_-\|erythromycin-esterase-family-protein	gnl\|CDD\|377470	pfam05139, Erythro_esteras, Erythromycin esterase. This family includes erythromycin esterase enzymes that confer resistance to the erythromycin antibiotic.	8.34543e-154
NZ_CP051685.1\|WP_170203712.1\|4221777_4225239_+\|exodeoxyribonuclease-V-subunit-gamma	gnl\|CDD\|335690	pfam04257, Exonuc_V_gamma, Exodeoxyribonuclease V, gamma subunit. The Exodeoxyribonuclease V enzyme is a multi-subunit enzyme comprised of the proteins RecB, RecC (this family) and RecD. This enzyme plays an important role in homologous genetic recombination, repair of double strand DNA breaks resistance to UV irradiation and chemical DNA-damage. The enzyme (EC:3.1.11.5) catalyzes ssDNA or dsDNA-dependent ATP hydrolysis, hydrolysis of ssDNA or dsDNA and unwinding of dsDNA. This family consists of two AAA domains.	0
NZ_CP051685.1\|WP_170203704.1\|4206114_4207842_+\|glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237027	PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed.	0
NZ_CP051685.1\|WP_170203710.1\|4218403_4219135_+\|LuxR-family-transcriptional-regulator	gnl\|CDD\|377050	pfam03472, Autoind_bind, Autoinducer binding domain. This domain is found a a large family of transcriptional regulators. This domain specifically binds to autoinducer molecules.	8.03897e-32

>NZ_CP051685.1|WP_170203704.1|4206114_4207842_+|glycerol-3-phosphate-dehydrogenase
MDGQARRIDCDVLVVGGGINGAGIARDAAGRGLRVLLCEQDDLASHTSSASSKLIHGGLRYLEQYQFGLVRKALAEREILLRSAPHIMRPLRFAMPHAAGGGDGAGQRPAWMVRAGLFLYDHLARRDFLPGSCSIALRGAHRGQGGAPLAAALAAPLQPHFAHAFLYSDAWVDDARLVVLAALDARERGATVLTRTRCTALERGPARWSATLRGVQGAESAEGLVGEIRVQARCVVNAAGPWAARFLQAAVGGAGAAGLEGAGGSLRLVKGSHIVVPRLFAHDHAYLLQQPDGRIVFALPYEEAFTLVGTTDVDYDGDPGRVAIGAAETAYLCEAANRCFQRRIGPADVVWSFAGVRPLIGAAAGASAARVSRDYRLHTDTRGAPLLSVFGGKVTTFRKLAEQAVDWIAPALGRRMPGWTAHACLPGGDLFGRRPDVRGVLEFDAWLRTRRQQYAWVAPALLARWARAYGTRIGTLLAHCRMHADLGEEVAPGLFEVELDYLRRHEWAQCADDVLWRRTKLGLHVPADSVGRVDAWLAAGKARSRAAHMAAPGASLAMSGPEQPPRRPRAGGDPY
>NZ_CP051685.1|WP_170203703.1|4205300_4205948_-|phosphohydrolase
MAPALRAWVRMPSGKRLDLLNPTPFDWDDADLALGLARTYRWGGHSAWPLPLSVAQHSIAVLLLRRGAATGRPLPPLVELRELLHDAEEGLLGFDAVSPIKPFLGEGFRALTRRLEQAVFLRYGLPAWTAAEHERHKRADRLAAAGEAIHVAGWSEQEVRSTLRIRSPLLHDDPLAAVYDCRPWEPWPPALAAERFLAQLQALQRRVDEDERRRA
>NZ_CP051685.1|WP_170203702.1|4202750_4204871_+|ATP-dependent-helicase
MPAAPAPAHAPAASTARDPFAELNPQQRAAVEHDIGAAAPRPLLVVAGAGSGKTSTLAHRVARLIQSGADPQRILLLTFSRRAANEMGQRAAGVLQRVLGLSGRHGSSQPMAGLPWAGTFHAIGARLLREYAGRIGLEPSFTIHDRGDAEDLMGMVRHEIGLGAAGGQKRFPLKGTCLAIYSRVVNSREPLERVLQSTFPWCSEWEAQLKRLFGAYVDAKQEQNVLDYDDLLLFWAEMAADPELGPELGALFDHVLVDEYQDTNRLQAAIVRGMKPDGRGVMAVGDDAQSIYSFRGATVRNILDFPQQFSRPACTVTLERNYRSTQPILDASNAVIAAALERHAKTLWTDRVSSARPQLILIPDEAEQARWVCNRVLALREEGVKLIQQAVLFRAASHSAALELELVRRNVPFVKFGGLKFLEAAHVKDLLALLRFAQNPSGRLAGFRAAQLVPGIGQATAARLLEAVGQAADACAAVDAFAPPPRAQTDWDAFAALFRTLRAPGLRWPLDAELARDWYLPHLERLYDDAPVRAADLDQLVQLAGGHGSRESFLTELTLDPPDATSDRAGPPLLDEDYLILSTIHSAKGQEWKSVTVLNAVDGCIPSDMSTGSADDIEEERRLLYVAMTRAREHLQLVLPHRFFVRQQAQMGDRHVYAQRTRFISPAMLKHFDECLWQDADTPHSRKPMPDSVRMLVRERARNAWK
>NZ_CP051685.1|WP_169433516.1|4202054_4202285_+|hypothetical-protein
MNPDQSADSLEQTGSELAISYQRRDARQKDIVDLGIALQQRSNTMSAIKYMRSQEVSNEVIERVLTEPGRRRSWSV
>NZ_CP051685.1|WP_170203701.1|4201662_4201839_-|hypothetical-protein
MNTTFNPDLKPGDEAEPGTPGAAEDLCDGCGGTGKLADGKKCPECEGTGRVMRGIGGG
>NZ_CP051685.1|WP_170203700.1|4200540_4201644_+|DUF4380-domain-containing-protein
MTKTSIAALLLALAPISATAGARPAPVSAPLTTHALDNGTVRASITDAIGGRLLSFALAGKANFLKIDTAAGDPGARVDADTGNVGYLGHEVWIGPQKQWWSHQDANPGRAAAGAEWPPDPYLSLARYTVVRSDRAGIALASPASPVNGLQLDKRYNLVPGRPNSLRLEVDAVNRRRAGVAWDIWFNTRVHGDTRVYVPVARREDVAQHAIERGADIVPLAWTLADGVLSIDMAVPEAGGTEAGVIARKAGRRNGKLLLQPSGGWMAGFRDGMALVIQFALQPRAAIHPDQGQVELYNDYAADDPGNGLLEMEVHAPYRQLAPGARMAAAETWTLLPYDGPDTRAAHLDFLRAQAQALGLAGIGAAR
>NZ_CP051685.1|WP_170203699.1|4199507_4200350_-|S-formylglutathione-hydrolase
MLELLSEHACFGGVQRFYKTDSAAVKLPMRFSVYLPPGFEGQRLPVLFYLAGLTCTEETFMTKAGAQRVAAEQGLILVAPDTSPRGAAVPGETDSWDFGAGAGFYVDATEEPWARHYRMYSHILELRELVLAELPADPARVGIFGHSMGGHGALMLALRNPDLFRSVSAFAPIAAPMRCPWGHKAFGGYLGADRAAWREYDATELMARHQTAPFPAGILIDQGLADKFLAEQLYPDAFEEACRAAGQPLELRRHAGYDHGYYFIQTFVEDHLRFHRRQLG
>NZ_CP051685.1|WP_170203698.1|4198470_4199193_-|phosphoribosyltransferase
MTEIRRFKNRLQAGRLLAQQLGRHARQADAIVLALPRGGVPVGFAAARRLGIALDVLVVRKLGLPRHEEFAMGAVGSGGVRVLQPGVPGLMGVTQAEVDAVTARELAELQRRERVYRGGRPEPDLAGRSVILVDDGVATGSTMLAAIQVTRRRRPGMLALAIPVAPPDTVRRLAPQVDRLVCLLAPPGFQSVGQWYDAFDQTTDAQVQDLLATAWHAQAASISHPTGGPHRELLDQRHKS
>NZ_CP051685.1|WP_170203697.1|4197677_4198502_-|hypothetical-protein
MNFSTNDTSLDLAKLLGGAAAGALLMYMLDPDRGSARRAQSAGAVRQAGIRTSGAIGNAWHDAGARLGAAADRLRERAAERAAHAFRAGSAAGRASDLADAVLSRAAGKAGSGAPASGRPKHAGARTPARESGHNAGHDAGREADGSRRRWFGAGARAHDTAHATAGDWQAAWRNPGVLGGGLLGLYGLARGLAERRPLGLALGLAGAALAARGIGGQPPGRLPARRGPSNQTVDFEKSVHIDAEPDIERGAGHAARQGRAAQQARSGNGRFLH
>NZ_CP051685.1|WP_170205513.1|4196270_4197602_-|erythromycin-esterase-family-protein
MTMADRDTIAAIRSAAVPLDGGAHDHDALLDLVGDARFVLLGEATHGTREFYQERARITRRLIEEKGFHAVAVEADWPDAYRVNRYVRGQGGDRDAEHALRGFQRFPNWMWRNTDVQQFVEWLHRHNGASGSAPVGFYGLDLYSMFTSIGEVLAYLDKVDPHAAGQARERYACFDHYREDTQHYGYTASLDLSESCEQGVITQLGMMQARALDYMARDGDEEAFFYAQQNARLVKNAEEYYRTMFRGRISSWNLRDSHMAETLDALAARLSKDGEPARIVIWEHNSHIGDARATEVGELGEWNVGELARKAYGDAVRLIGFSTYDGFVTAASEWDGAAEHKRVQPGLAGSYEALLHETGIPRFILPLRTPGAARDALLGPRLERAIGVIYLPRTERHSHYFSASMARQFDAVIHIDRTSALRPLDPGGGWHAEEPPETYPGGL
>NZ_CP051685.1|WP_170203705.1|4208058_4208421_-|hypothetical-protein
MRSSDLMTLLFDAGLPTAGYGFSRQTPAERDALLADLTGRPDAVVTRSPGISLVELEDEQTVYLVTEAGHFAHPSVLRRSVVLKEGRRTVETRGFTVAPGGVMSTWVDQFREQDALMGRR
>NZ_CP051685.1|WP_170203706.1|4208430_4211094_-|M1-family-metallopeptidase
MHRSLLSTAVALALAALPALPVHAAAPAARTAQAETTTQLPRGVVPSHYEVSLTPDAAAGRFGARTVITLALARGMDSITLNAADLAFSRAEIVPAGGGAALPATVSVNAEAQTATFRFARPLAPGGYRLALDYSGIIGTQAVGLFSLDYPGAGGKQQRALYTQFENSDARRMIPSWDEPGYKATFKLDVTVPAGQMAVSNMPAANTATLADGRKRVSFAQSPKMSTYLLFLGVGDFERATASVDGTELGVITRRGALDQARFALDSSAAVLKEYNDYFGVRYPLPKLDNIAGPGQSQFFGAMENWGAIFTFEYALLLDPAISTQHDRQEVFATAAHEMAHQWFGDLVTMRWWDDLWLNEGFASWMESRMTARLHPEWNTRLGALNGRDAAMRRDSVAATHPVVQHIETVEQASQAFDEITYQKGEAVIRMLEAYVGEDAWRSGVRAYMKAHAYGNTVSDDLWRQIEKAANKPVTAIAHDFTLQPGVPLIRVGAPVCAGGKTTVALTQEEFSRDRPGKKPLAWRVPVIAQIGGNGKPASTLVAGGKGSLALPGCGAVVVNAGQSGYYRTLYAPKEFAALAGQFATLAPIDQIGLLSDSTALGMAGMQPASDVLDLARRAPLGADPQVWQRIASVLDGLHDRYAADAARQQRFDAFARARLAPVMAQVGWTARSGEASAVANLREQLIVVLGELGDANVVQEARRRYAAMQQDPAAVPGALRKVVTSVVAQHADAATWDALRASARVEKTPLVRDNLYVQLALGADRALAERALQLALTDEPGLTNSAAMISAVARRHPDLAFDFALAHQEQINRRVDASSRSRYFARLAGGSSDPAMVGKLNAYAGANLAAGARGDVEAAIAAIQDRVKVNAARLPEIDAWLARHPD
>NZ_CP051685.1|WP_170203707.1|4211293_4211914_+|glutathione-S-transferase-family-protein
MKLYTTARAPNPRRVLMFIAEKGIRDIEPVQVDLGKGEQRDPAFTRLNPLAQVPLLQLDDGRVLGETRAICTWLEGLHPQPNLMGEGFEERAFIEMADRRVELGLFMRIANHLRHAHPGLAHLEQPQFGDFGAAQKDKMLDSARWLDGVLAAQPYVAGERFTIADITAFCALEFARLMKFRAADAGLAHLQAWRDRIAERPSAQVV
>NZ_CP051685.1|WP_170203708.1|4212120_4212999_-|chemotaxis-protein
MAAPNEAAPAGAAHAWTGPAAALAVEELETELLLEALFQRFGHDFRAYDRAALRRRLVQALRAQGAATLSGLQERVLHDAAAAAVVLRALSVAPGPLFAHPGHAARLRGVLAPALRGWPVPKVWMAECAGVGEAWTLAIVLAEEGVAGRLDIHATLANEELVGEMQDAAIPVAELAAAQERYALAGGAAALASYFEVEDGMARLRPQLRRAITWSQYSLVTDASFNEFQAILCCGALPDFGPLLRQRVLRLFHDSLARFGVLCLDRPLAVTDAHAGTYQAVGGDRPWYKRVG
>NZ_CP051685.1|WP_170203709.1|4212998_4218008_-|response-regulator
MNNMTDMAEQLDVKLLLSTLMALKKGDFSVRMPSDWTGVSGKIADTLNDIIETKQKMVETVTEVSRVVGREGHLTQRADVPGVVGGWSTIISSVNTLIDDLVRPTTEMARVIGAVAKGDLSQTMALEVDGHPLKGQYLRAAQTANTMVEQLSSFSSEVTRVAREVGTEGKLGGQAQVKGVAGTWKDLTDSVNSMAGNLTSQVRNIAEVTTAVANGDLSKKITVDVRGEILQLKDTINVMVDQLRAFASEVTRVAREVGTEGKLGGQAYVPGVGGTWKDLTDNVNFMASNLTGQVRNIATVTTAVANGDLSKKITVDVKGEILELKNTINVMVDQLSSFSSEVTRVAREVGTEGKLGGQAQVKGVAGTWKDLTDSVNSMAGNLTGQVRNIADVTTAVANGDLSKKITVDVKGEILELKNTINVMVDQLNSFASEVTRVAREVGTEGRLGGQANVPGVAGTWKDLTDNVNFMAGNLTGQVRNIAEVTTAVANGDLSKKITVDVKGEILQLKDTINVMVDQLSSFASEVTRVAREVGTEGKLGGQAYVPGVGGTWKDLTDNVNFMASNLTGQVRNIAAVTTAVARGDLSKKITVDVKGEILELKDTINVMVDQLSSFASEVTRVAREVGTEGRLGGQANVSGVAGTWKDLTENVNQLAANLTNQMRAIGEVATAVTRGDLSRSITVEARGEMSYLKDNINEMIRNLKETTQKNAQQDWLKTNLARFTRLLQGQRDLQAVTKLILSELAPLISAHHGVFYMMDSQETDARLRMIASYGYRSSRKLPTSFLPGEGLVGQCALEKSRIWLTDVPRDYIVVSSGLGAAPPTNIVVLPILFEQQVKAVIEIASLDRFTETHLSFLDQLMESIGVVLNTIEANSRTESLLTQSQSLAQELQQTNLELAEKARLLSDQNIEVERKNREVEQAKLALEEKATQLALSSKYKSEFLANMSHELRTPLNSLLILAQQLSDNPEGNLSGKQVEFAKTIYGSGSDLLTLINDILDLSKIESGTVTLDVAEYRFATLRNYVDRTFRHMAEAKHLGFQVELADNLPGAVMTDTTRLQQVLKNLLSNAFKFTSHGHVSLSIGLVAGGWSQEHPHLPDADAVLAFSVRDSGVGIPADKLQLIFEAFQQADGSTARKYGGTGLGLSISRELARLLGGEIRVESTVGAGSTFTLYLPYNRAGFINYEQTRQPQPARLAPPQAAAQAAAPSATAPAASAASARDTGAGVGAGTAAQTDAAAGVRGPGAGGAPEADAGAFPAAAHSAAGDDDVMDDRGITTPGDPSVLIVEDDERFAATLLDFAREKNFKGIVTHRGDSALSLARDYLPSAILLDIDLPDIDGLTVLDRLKRDPGTRHIPVHVISALRERERALRQGAISYVEKPVTREVLQDEFKRIQKFLMGGKRALLVVEDDPAQRDAIVSLVGAADVHIVTAHDGAAALAALAERDFDCMVLDLTLPDVTGFELLDRIGSQPALRDLPIVVYTAKELSHQDVARLKRYAKTIVVKDARSPERLLDETALFLHRSQASLPDAQRRMLEEIHALDGTLAGRKVLIVDDDLRNIFALSSLLERQQMQVAFAENGRDGIEVLEKDPGIEIVLMDIMMPEMDGYDTMRAIRRIPEFKSLPIITLTAKAMKGDRDKCIAAGASDYITKPVDVAQLLSMMRVWLH
>NZ_CP051685.1|WP_170203710.1|4218403_4219135_+|LuxR-family-transcriptional-regulator
MKIAQLEQLLRRDNPDAWGEALFALGRAYGFDKMLFRLTGPRHARKEFSLVQSNYPAGWREHYDAARYVYIDPIVSHCLASVLPLIWDAQVFAAAAHQGLYQEACSYGIRSGVSLPMHGPNGEFGIVCFASGLAPDAAFARDVEAMLPDLALVRDYAFASGVRFCPTTPAEAAPRLTPRELEVLGWVMAGKSSWEISKITGCAETTVKFHMGNIRQKFNVNTRQQAVVKAISLGLITPEDHRR
>NZ_CP051685.1|WP_170203711.1|4219585_4221631_-|S9-family-peptidase
MSDPAIPSSPHDPYLWLEEVSSTRALDWVGARNTHSEQELARDPRYAALRTRLKTILDSKERIPYVGRHGDFYYNFWRDAEHERGIWRRTTPDEYAKSTPQWETVLDLDALARDEDENWVWAGVSTLKPRGERCLVSLSRGGGDAHVVREFDLSTLRFVDDGFVLPEAKASAGWIDRETLFVATDFGEGSMTESGYPRIVKEWRRGTPLEQATLVYAAQPDDLSASAWHDPTPGFEHQFVRRQVDFYTSELFLREAGALVPVPKPFDADAFTVRDQVVIELRSDWDAGGRTWPQGALLAMDFTRFMAGERDFDLLFAPSPTTSMDGLTATRDALLLTVLDNVKSRIVELRLTADGWQRRDVAAPSMGSLDVSSVDEFASDDYFLTVTDFLTPSSLYLGRAGSDTRTLLKSMPAFFDADPYTVDQFTARSQDGTEVPYFVVRRRDTVFDGANPALLYGYGGFEVSLAPFYSGVTGSAWLEQGGVYVLANIRGGGEFGPRWHQAALKERRQHAFDDFIAVAEDIVARKLTGPRHLGIMGGSNGGLLVGAVLTQRPDLFNAVVCQVPLLDMRRYHQLLAGASWVGEYGDPDDPAQWAFIGKYSPYHNVSAHKRYPRVLFTTSTRDDRVHPGHARKMAALMQEQGHDVLYWENTEGGHAGAANNEQTATMWALTYVFLLRQLGRA
>NZ_CP051685.1|WP_170203712.1|4221777_4225239_+|exodeoxyribonuclease-V-subunit-gamma
MPAPITPGLLILHGNQMELLRAAVFDWLRDNPLGPLEEELILVQSNGVAEWLKIALAEDVGVCAATRVALPARFLWQAYRGMLGPERVPRRSPFDKDALVWRLMRLLPEAIEKEKFAPLRQFLADGDPERRLQLAERLADLYDQYQVYRADWLSDWADGRDQLRRPGGDAVELAHDQCWQAQLWREIHASLPPERRWSGRATIHQQFMAAAEDGKPPAGKLPRRVVLFGMSTLPYQTIQAMAGLSRYTQVLLAVPNPCQFYWGDIIEGRELLRAAYQRHQPRNGASLADIPPEQMHAHCHPLLASWGRQGRDFVRMLDEFDGDHGARFGSLRVDLFSDDAGDCLLAQAQAAIRDLLPLDEHPKAPPAASDRSIEFHIAHSAQREVEVLHDQLLSWFAEERDEPLRPRDVVVMMPDIDTFSAAIHAVFDQHKRSDPRYIPFEIGDVKDRSVNPLLVALEWLLRLPQQRCRQSEVRDLLDVPALAARFGVGEDDLPILGHWIEGASVRWGLDRQHRAGLGLGSAGEQNSWLFGLRRMLLGYATGAGPSFGDIEPYAEVGGLDAALAGSLAELVEALLAWREQLDEHLRPLEWGKRVRAMMARFFRAAGEEDRLVLNQLDEALQCWLEICANASFDEPVPLAVLREAWLRELDQPALTHQFVSGGVTFCTLMPMRAVPFRVVCLMGMNDGDFPRRAQHADFDLLAMPGMGRPGDRSRRDDDRYLMLEALLAARDKFYVSWVGRNVRDNTEQPASVLVSQLRDYLASGWNMDAQALTTVHALQPFSRRYFERGGLLTYAGEWRAAHGAAAGAGDGGDAPASAVLEPYELEPDYRLKLGELASFLRQPARYFFRRRLGVHFDSLEVVGEDEEPFSLDALERYFLEDTLLDDSGLPEPQEDVRRVLAARAERLAREGVLPIGLIGRQWQQQLVDELVPVRTAWLALGARYPHEAPKLALALELACADGSTLPLDDWIDRLRSDGARSVWLMQVSSKVLDRKGAPRGDKLIGAWLRQLAAGAMGHAVTGYLVGRDATVEMAPLDPDAARAALSRLAALWRANLDRPLEVACKTALAHLQGGDARETYDGGFELDGEVIDPCLARLWPEFALLAASGGWPGVAQELYGPLADWLAGGVRVLPFGADADADADAGAHAGAAA
>NZ_CP051685.1|WP_170203713.1|4225235_4229159_+|exodeoxyribonuclease-V-subunit-beta
MSNLEPLAFPLHGSRLIEASAGTGKTYTIAALYLRLVLGHGSKGADGSAAAGDDGQGGMGMDAEFDPDFDLAFDAGFGDAEADFAARFDAGAGPDLDGAPAWSLDDAAGEPASHGAYGGAQGGGEAEPSAYLRPLMPPEILVMTFTRAATRELSNRVRERLVQAAAYFRGEARSDDPYLAALADSYADEGGRALAAHRLVLAAETMDEAAIFTIDAWCQRMLREHAFDSGSLFDEELVSDERGLFEDAAHDYWRQHVYPLGGAALAALLSCFKDVEALKRAVRELVPRADGLDQEGDDAAESLGALIVRIERRRQGELARIKAGWAERADAMENWIAAERDRNPKCFHGSKMRADTLAKWFDALRAWALDPQLHTPALTEAAWNRLAPDGIVDAFSKGFSTTVPACFDAMRDLRAALDAVAPLAHALLRHAAGQIARRVAELKRRNRQFGFADMLARLKEALEGPNGAALRQRILDQFPVAMVDEFQDTSPDQYRIFDLLYRVADNDPARGLFLIGDPKQSIYGFRGADIHSYLAARRATAGRHYQLGTNYRSTAQLVRAVNRLFQYAEGEAGDPGQPGYAAGAFRFRKDGDNPLPFEAVAAAGRRQQLVGVDGPFQALAVCSTGRDDLRTDDYRAFFAEHCAEHIVTLLNDARVGFGDPGGGFQRLVPADIAILVRDRREAAAVRHALARRRVASVYLSDQDSVLDSEEAADMLRWLQAVANPLDGALARAAFATATCALPLAALARLASDEQAWENRVEQLKNLHQAWQRQGVLAMLRRFIHELGLPSQLLAAGGGERRLTNLLHLAELLQEASRELDGEQALIRWFAEQIDGMGEAGDERVLRLESDAELVKVVTVHKSKGLEYPLVYLPFAVTARKTERRNRAFFEYVDDGGARRIDLGLGDAALEAVDRARLEEDLRLLYVALTRARHFLWLGVAAVAAGRKGENRLHESALGYLLTGGEAIPAASMGARWQRLRGDVDGIALHDLQPLDGFTVLARQDARPELLRAAPFEHAFERNWSIGSFTSLTRHTVAPPTRPQEENLMEEAEAGAVEPVRVEDAPWHRFPRGATPGNFLHEQLEWMAQEGFDRIDDAEHGARLAQRIERAGWANRLDDALAWLRALATTPLPPLDAALADLAREGTLLPEMEFWFPSRSLDVGALDRLCRARLLGDVARPTLPERQLHGMLKGFTDLVFEHRGRYWVLDYKSNALGPGDAAYTQAAMAAGMAGHRYDIQGAIYLLALHRLLRARLGAAYDPATQLGGALFLFLRGIASPATHGCFLLAPDLELLDGLDGLLGDGERT
>NZ_CP051685.1|WP_170203714.1|4229155_4231366_+|exodeoxyribonuclease-V-subunit-alpha
MNRRARHEPQQAGLPADDAPAAAAVVAEGAGAPAPASSRASGAVDEGNVDTGGPRIDGIGGSDLEGGAAGGPYAAFWRETERLTEAGALRRLSGAFARFVATLGAGEGASGGRGTSGDGALLLAALVLSELEGRGHSCLLLSDLAGDPAALLGWLDDDWKALARAARPLPRGAKGWSARLAACEQVWQAGNLDYGQPLVLDTEAAGGSGARLYLRRYWRDETLVAASIRARALDRRQVDTARVHAWLDQLFGARRPDDAAQGPDWQKLACAVALRGAVAIITGGPGTGKTYTVARLLALLFATAPDAARQRVALAAPTGKAAARLKQSIDKALGELAERVGAALPLRELTARMGAARTLHSLLGARPDTRAFAHHRGNPLDVDVLIVDEASMVHLEMMASLLDALPPGAILILLGDKDQLASVEAGAVLGDLCHDAQAGNYDAATLDYVKAASGEDVPAAFAGAGGALAQQTVMLRHSRRFGGPIGRLALAVNRGDVEAAIAELRSGAPLRWIERAQQQHAIALAEDGYRPYLQLLRATLARAADGCAAHDDHEQRVRAVLQRFEAFRILCAVREGEWGVQGLNGAIEARLEQAGLVRRGGDWYVGRPVMVTRNDYGTGVFNGDIGLTLDDPARPGSLRVYFLEGDKVRSVLATRLRHVETAYAMTVHKSQGSEFAHTVLALPKEGGAVLARELVYTGITRASAAFTLVTPSAAVLGEAVERRTHRASGLRAMVER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051685_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_5

4710722-4710833

Orphan

Consensus_repeat	Method
GTCGCCGGCACGGTCCATGGCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP051685_5

>merge|NZ_CP051685|5|4710722-4710833|CRISPRCasFinder
GTCGCCGGCGCGCTCGGCGGCGTTGTCGATGCGGTCGCCGGCACGGTCCATGGCGGCGCCGGTACGGGCGGCGGCATTGTCGATCTTGTCGCCGGCGCGGTCCATGGCGGCG

>NZ_CP051685|5|5|4710722-4710833|CRISPRCasFinder
GTCGCCGGCGCGCTCGGCGGCGTTG	TCGATGCGGTCGCCGGCACGGTCCATGGCGGCGCCGGTACGGGCGGCGGCATTGTCGATCTT
GTCGCCGGCGCGGTCCATGGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170204079.1\|4713357_4713783_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381085
NZ_CP051685.1\|WP_170204074.1\|4706772_4707201_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379228
NZ_CP051685.1\|WP_170204073.1\|4705777_4706788_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP051685.1\|WP_170204069.1\|4702451_4703201_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP051685.1\|WP_170204075.1\|4707257_4708163_-\|LysR-family-transcriptional-regulator-ArgP	unknown	unknown	gnl\|CDD\|235144
NZ_CP051685.1\|WP_170204068.1\|4701442_4702360_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
NZ_CP051685.1\|WP_170204083.1\|4718619_4719618_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204077.1\|4711212_4711827_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204078.1\|4711787_4713221_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|225186
NZ_CP051685.1\|WP_170204072.1\|4705223_4705718_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP051685.1\|WP_170204070.1\|4703703_4704642_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176150
NZ_CP051685.1\|WP_170204076.1\|4709070_4710480_+\|lysophospholipase	unknown	unknown	gnl\|CDD\|238868
NZ_CP051685.1\|WP_170204085.1\|4720264_4720849_+\|outer-membrane-beta-barrel-protein	unknown	unknown	gnl\|CDD\|379226
NZ_CP051685.1\|WP_170204081.1\|4714757_4717178_+\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
NZ_CP051685.1\|WP_170204084.1\|4719610_4720042_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235142
NZ_CP051685.1\|WP_170204080.1\|4713928_4714771_+\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377292
NZ_CP051685.1\|WP_170204071.1\|4704658_4705090_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170205566.1\|4708316_4708880_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|224198
NZ_CP051685.1\|WP_170204082.1\|4718083_4718623_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170205568.1\|4717205_4717988_-\|DUF2135-domain-containing-protein	unknown	unknown	gnl\|CDD\|227021

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170204079.1\|4713357_4713783_-\|hypothetical-protein	gnl\|CDD\|381085	cd00156, REC, phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.	6.73607e-05
NZ_CP051685.1\|WP_170204074.1\|4706772_4707201_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379228	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	3.96419e-05
NZ_CP051685.1\|WP_170204073.1\|4705777_4706788_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	3.96769e-08
NZ_CP051685.1\|WP_170204069.1\|4702451_4703201_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.75087e-23
NZ_CP051685.1\|WP_170204075.1\|4707257_4708163_-\|LysR-family-transcriptional-regulator-ArgP	gnl\|CDD\|235144	PRK03635, PRK03635, ArgP/LysG family DNA-binding transcriptional regulator.	3.45427e-125
NZ_CP051685.1\|WP_170204068.1\|4701442_4702360_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.27698e-120
NZ_CP051685.1\|WP_170204084.1\|4719610_4720042_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|235142	PRK03624, PRK03624, putative acetyltransferase; Provisional.	4.89826e-19
NZ_CP051685.1\|WP_170204081.1\|4714757_4717178_+\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
NZ_CP051685.1\|WP_170204078.1\|4711787_4713221_-\|FAD-binding-protein	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	1.02764e-25
NZ_CP051685.1\|WP_170204072.1\|4705223_4705718_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.79592e-23
NZ_CP051685.1\|WP_170204070.1\|4703703_4704642_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176150	cd08461, PBP2_DntR_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.67986e-87
NZ_CP051685.1\|WP_170204076.1\|4709070_4710480_+\|lysophospholipase	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	1.95232e-63
NZ_CP051685.1\|WP_170204085.1\|4720264_4720849_+\|outer-membrane-beta-barrel-protein	gnl\|CDD\|379226	pfam13505, OMP_b-brl, Outer membrane protein beta-barrel domain. This domain is found in a wide range of outer membrane proteins. This domain assumes a membrane bound beta-barrel fold.	2.43298e-06
NZ_CP051685.1\|WP_170204080.1\|4713928_4714771_+\|ferritin-like-domain-containing-protein	gnl\|CDD\|377292	pfam04305, DUF455, Protein of unknown function (DUF455).	2.24555e-120
NZ_CP051685.1\|WP_170205566.1\|4708316_4708880_+\|LysE-family-transporter	gnl\|CDD\|224198	COG1279, COG1279, Lysine efflux permease [General function prediction only].	2.65461e-52
NZ_CP051685.1\|WP_170205568.1\|4717205_4717988_-\|DUF2135-domain-containing-protein	gnl\|CDD\|227021	COG4676, COG4676, Uncharacterized protein conserved in bacteria [Function unknown].	1.61835e-104

>NZ_CP051685.1|WP_170204076.1|4709070_4710480_+|lysophospholipase
MENEDSVQPDRNREAPARRRFLQAAAGVAALTGAAGATSGRAFAAADDGRHGADGRGDWVTTWSGVAHGTYPTGTAILQPSLAFAFPDGATSAVDQSFRMIVRPTAWGDTFRFRFSNVFGTQPLTLDDVHAGLQASAGTIADDTNRPVSFQGGRRRVVIPAGQLLWSDPVALDATRGPDRLLLYGRKLAVSFHVVGSSGPMSWHSKALQTNYLSAPGAGAHGGEESDEAFPYTSTSWYFLDAVDTRGLRNAVTVVALGDSITDGTGSTLNGDDRWPDVLGRRLRDAYGNQIAVANAGIGGNRILTDAGAGGPPALGRLERDVLGLSGGSAVIWFEGINDLSAGASAASLIDGIRSGVATLRARRPSIKLIQATITSNLGSASGTPELDARRQAVNAFIRSAGIFDAVADFDAATVDAATGRLRPAFQPNSSTAAIDFLHPNRAGYLAMARTIDLDLLAPPYAVRRRKNQ
>NZ_CP051685.1|WP_170205566.1|4708316_4708880_+|LysE-family-transporter
MPIGAQNAHVIRTGIRGRHVLLTVATCIAVDAALIALGVSGFGALVQSAPALLAACRYGGAAFLLWYGLRCLAGAWRGSAGAPQPADAARQGDAGKALAAVLTMSLLNPHVYLDTVVLLGAVGSGLADGHRASFAAGAMTASLLWFSGLGLLARHCAGLLGRPAVWRGIEALTGAVMLLMAVLLLRD
>NZ_CP051685.1|WP_170204075.1|4707257_4708163_-|LysR-family-transcriptional-regulator-ArgP
MKIDPRRSEAFLATVDNGSLEQAALQLRITPSAVSQRISALEQDMGTPLLMRTRPCRPTAPGMRLLQFLRRRALLEAEFSADLAQDAGPVRVTLAVNNDTLATWLLPVLAPVLIDEGLLVEFVLDNQGHTFALLEQGQAVACISGEERPMRGCAVSALGLMRYRMVAAPAFARRWFPAGLEREAARRAPVMVFDRKDTLQTQFLLRHAGLPEGAYPFHYVPASDPYVQAIRLGLGYGMLPLEQCAAMLASGDLIDLAPGLHADVPLYWHAWRIQPARLERLGAALIGAARATLLPLAPPVP
>NZ_CP051685.1|WP_170204074.1|4706772_4707201_-|GNAT-family-N-acetyltransferase
MIRIETIALGELARIDAFYRVTGYGGGVSSADLTLAASMDDCLAGAVRLCPEHGVTVLRGMQVASAFQRRGIGRALLDHCIPYLDRGDAWCLPYDHLVAFYACAGFSPAPPESLPPFLARRLAGYLASGQRVLAMHRRQPSG
>NZ_CP051685.1|WP_170204073.1|4705777_4706788_+|DMT-family-transporter
MVGKHESGGIGAGTGVHTNTGIGTGKGIGAGIGAGALWGLVFLAPQLAPGFTPLQLSAGRYLAYGLAAAVLIAPSWRRLAAVLAWRDWCALAWLGFTGNILYYVLLAQAVRGGGVAMAALVIGLLPLAVTLVGSREHGAVALRRLLPSLALGLAGLACTSRQSLATLGRDALPGLLCALGALVSWTVYAVGNSRRLAGLRALSPHDWNLLTGVATGIEALLLALPAFFPHLLPAGVGPDAPVHAAADWLRFAAIAGGVAILCSIVGNGLWNVASRALPLTLMGQMIVFETIFAAGYGFLWERRWPTGLEAAALALLVAGVASCAAVHRRDGRQPDG
>NZ_CP051685.1|WP_170204072.1|4705223_4705718_+|helix-turn-helix-transcriptional-regulator
MHMTAPAIANVDIRSYREDCGADRHAFAQLVLPLSGGLLLDTLAADAPQPRARLAVLKAEVEARPGLPWTTASMARLAGLSVSRLHALFREELDSTPHAWLLGRRLDLACRLLATSAGPVAAVALAAGFSDQSALTRAMRRELDATPAAWRRRSRSRETGSGKQ
>NZ_CP051685.1|WP_170204071.1|4704658_4705090_-|hypothetical-protein
MQVERICFEEVFDAPSRRGSFSFRSGGKSSYGVQLPGRPVPRAGAVFGVAFGRPGDWSTVLGTRDLATQRVTLAMPAWDIVMHQFDLLWLLAVPLLAGSLLFGGALAALAMLAALAAGVAAFSRRGMRQNRRVRAALLAMAPA
>NZ_CP051685.1|WP_170204070.1|4703703_4704642_-|LysR-family-transcriptional-regulator
MRTLHDLDLNLLKALDALIDERSVTRAAARLGVTQPAMSGMLTRLRDVFGDPLFVRAQRGVVPTARALQLALPVKAVMGGIGALLQPDVFEPARAELTFTVAATDYALRAVAAPFLAALKPRAPNIRVALVALEAGPPELVQARLERGQVDLALLTPESTPPDLHARRLFEERYVCAMRAGHPASRPGALTLERFCALEHALVSYDGGSFEGVTDAALARLGLRRTVSLSVQNFLILPELLAAGDLLAVLPRRLVDGVPGLALVEPPLAIPGFVKTAAWHERTHADPARRWLRELLFAACADPAWRPAGQAV
>NZ_CP051685.1|WP_170204069.1|4702451_4703201_+|helix-turn-helix-transcriptional-regulator
MPYPAFTLHRAYKTRGAGEPMHAHDEAQLTFAATGMVQVHTGAGRWLVPPQLGVWIPAGVQHHVEVLSDAELWMVHWDPAAARAWAPPTRLDRAFALRITPLMRTLLAVAFNSAMSADKTELVVRLMLHELTETAHAPTFLPLPTGATGKRIAAVAAGDVRNRLSVAEIASRAATSVRTLSRVFLTETGLTFKTWRQRARIVHAMDSLARGKAIAQVASELGFASTASFSSAFRQVTATTPSAFLEPSA
>NZ_CP051685.1|WP_170204068.1|4701442_4702360_-|NADP-dependent-oxidoreductase
MRAVVIESYGDNSVVNVFDVARPAPQAGELLVKVRAAGVNPIDWKIRGGVGQRMGMTLPIHLGGEISGTVEQVGAGVAGFSVGDAVFGIIKDGGFADYAIAPAADMVRIPADLDFIAAAAIPLGALTAWQALFDVAKLTRGQRLLIAGASGGVGSLAVQIAKTAGAHVTAIASGRNADFVRSLGADTFIDYTAQPFEQVARDMDVVFDTVGGDTFQRAFGTLKHGGFLVTSVEFPTEEDGRRGVGVGRVFCKPNAAQLTAIRDLVEAGKLQPHVATVLTLDEVKEAFALSEGGRTRGKIVLGISQ
>NZ_CP051685.1|WP_170204077.1|4711212_4711827_+|hypothetical-protein
MPSLSSIGRFAGAALYMMAYDAREPNAVHRLMAGYADRGSDAGMAFWWAAKNPVRDRFPAQCIPKANPEADPDGFNGELERMPPAVFAACSYLFAVVGTVSVQSEYPPLALYHGVSGSVAMEFDPASGRIAWRQQDVNMAERPTRMVRDLAREELDDPRKIRDSLVSYMKARGDAALARHRKPLPALDPDYVYRTTFVFDLHAD
>NZ_CP051685.1|WP_170204078.1|4711787_4713221_-|FAD-binding-protein
MNRRVHPVRLHGAAASPLADAPDAIVVGSGPGGAGAARALARAGARVLVLEQGGAEALSGTLGQMASMAAVPGKGAFLHRDLSLLVRALTLGGTSTINFATAAPPPAAMFAAHGIDLAPALGELRAELPMAPLPDALVGPMARRIMAAARASGLDWHKLDKLIRPASCRSGCWRCVYGCPFGAKWSARDFIDDACSHGARVRSRARVTRVLVEDGRAAGVEAEIDGRLQQLRAPLVVLAAGGIGSPRLLHASGLLDQSPAFFSDPVVAVMGSVDDLETDPTRDERGGAEVPMAAGAALHEDGISLADLTLPQPMYAAFAAQAGRVDRLLAHARTLTVMVKIRDRIGGRIGPHWVDKTLHPEDRARFARGIGLARDILARAGAHHVFASHHFAAHPGGSVRIGERVDSDLQTATPGLYVCDAAVIPAPWGLPPTLTLLCLGTRLGAHLARGEFPDRAHTGLGAGGAQSACRSNTNVVR
>NZ_CP051685.1|WP_170204079.1|4713357_4713783_-|hypothetical-protein
MKSALLLEYDHTARTQAAAQLQALGYVVAHADSPQAALHTAQAIRFDAMLTCTDTNADDRRSLLGELARLAPGAPIALLLDDRRTPAPRVGRGVALLSRPLTQRSLRRSLRRAAAAALDATAPGPAAQERRHAPQRRLQPR
>NZ_CP051685.1|WP_170204080.1|4713928_4714771_+|ferritin-like-domain-containing-protein
MAHPPELRTQALHCLLLTDPAAKTAAVAALAQAWHAGACTLATDTVLAEPADIPGRPSRPALVPPRLLGRRSMATVEGRAMLVHALAHIEFNAVNLALDAVWRFGGMPAAYYADWLRVAAEEAAHFALLAAHLRTLGYEYGDFPGHDSLWEMVAKTSGDALARMALVPRTMEARGLDAIPPLRAKLAQAGDVEAARILDILLRDEVGHVEIGNRWYFYLCAGSGLEPCATYDALTVQYKAPVLKGPFNVDARRRAGFTEAELARFERDPIAGGRLSHACD
>NZ_CP051685.1|WP_170204081.1|4714757_4717178_+|DNA-polymerase-II
MPATDAAADAAADAAGPHGDSGQGFLLTRHWRDVDDGVEIECWIATDAGPRRLRLAPAPAVAFLPAEQEDAARALLGRERGVELRPLALADFRHRPVLGLYCRHYRQLLRLEKRLREHGVDVYEADVRPPDRYLMERFITAPLAFGGTPAPHDPSLLLDVRLKPVPDYRPRLRTVSLDIETTMQGELRSIGLEGCGERRVYMLGPPNGDATGLDFDLDYCDSRRMLLDRLEAWMARHDPDAVIGWNVIGFDLRVLQRQAEGMGHPLRLGRGGAPMEWRDTGREERYFAGMPGRLVIDGIEALRAATYNFPSFSLENVSRTLLGEGKAIGNPYDRMGEIDRMFAEDKPALATYNLQDCVLVTRIFAKTGLLDFLLERASVTGLAADRSAGSVAAFDHLYMPLMHRQGLVAPNIGDVPGEDSPGGFVMDSRSGLYDSVLVLDYKSLYPSIIRTFLIDPVGLLEGLRAPEEDTVPGFRGARFSRTRHCLPGIVTRVWAGREAAKRDGNAHLAQALKIIMNAFYGVLGTTACRFFDARLASSITLRGHEIMHRTRALIEARGHQVIYGDTDSTFVWLGRPHSDAEALRIGRELVDHVNGWWRAHLRDAMGLDSALELEVDTHFRRFLMPTVRGSEEGSKKRYAGLATAPGGGDEFVYKGLETVRTDWTPLAQQFQQGLYERIFRREPYQDWLRGYVARTLNGELDDLLVYRKRLRRPLAEYERNLPPHVRAARIADAWHLAQGRPAPYRNGGATIAYVMTTGGPEPLETLQSAPDYEHYLTRQLEPVADAILPFLGDGFDKLTSTQGALF
>NZ_CP051685.1|WP_170205568.1|4717205_4717988_-|DUF2135-domain-containing-protein
MRTLSAALLGLAALLPAASQTLETPAGGWNRAGLVDRSEEPAVNYPYALIDRGVQRNRTMIRGRLAAAGKQRPFHTLVVNGNPTPLYTDDEGRFARGYTFGRGSNSVEIRSPSGKAVKRVQYYEADSSRPQPVLRVIAAWDDNQAEIDLHVVTPDGQHAYWMHPALTNGGGLDVDSVDGPGPEMFTMTAPMRGAYQVWVNYWGNFGSEGYHFDASTRQRPIITTRVTLIFNENTGRERREEFVIPLRALGELTLVKSFRL
>NZ_CP051685.1|WP_170204082.1|4718083_4718623_-|hypothetical-protein
MNRTWVGVAVALLLFVCSDSGLPGHTSPEPFTDFETLSVDNRGCIFDCPVFEVRIFSDGRVRHSGPIFAQTGGTEEFRIDRASLVRIAHALREAHIDDMRDRYVDEADGCASVMTDQSTLVLHVNRGRGKRNKSVELYTGCFGGSVPAERINALLEAIDHVTGTGTLVERRIQARPRVH
>NZ_CP051685.1|WP_170204083.1|4718619_4719618_-|hypothetical-protein
MPEREHGRTRRRVGILLRAIGHAANILILLAALVYAFGAILWMHAPVVAALLNIATMAALPLGLAWLCRRIGILLQQPPSTVASSPARRRLLIGGGLAVAAACVTLVHTGVTVYRCNVDRSRNAAAHDIETRRNGYERVCPGDLGRFEMSFRPIESVTRKLAFQPIDLTHTPFARFEPLGGRVETVGDVASIVYRGFRLPDGHVLTLQEHDMSADGVSSWRDPKDEPERVNGLAARLFVMEAPSGAAVSHLSWVQGRRDIQLWIDANVVREPLRERLFALAASLPAAVPACPNERPPKPWRFDANGRRIEEPMPAMMSQADFDALSAPRPCK
>NZ_CP051685.1|WP_170204084.1|4719610_4720042_-|GNAT-family-N-acetyltransferase
MEILVYGIDRYDDVMALMRATPGVSIRDADARETTARYLARNPGLSFLAIDAGRVIGCALCGHDGRRGYLQHVIVAPDYRGRGIADALVGRCLDGLAALGIGKTHIDVFTSNDAANRYWTRRGWRRRDDIHRYSMIRTGGANA
>NZ_CP051685.1|WP_170204085.1|4720264_4720849_+|outer-membrane-beta-barrel-protein
MNKKILVAALLSAAFGAAQAQTAVVEPSPARFLVGMGLSGGGDKLVSARYTDGDTVNLHGGGLIYFTAGVDYRFTPEFSLQGTVNYHVDQANARNGDIKFQRFPVELIGYYHPNPSWRVGGGVRYAASPKLSSSGVASGLDAKFDDATSAVVEAEYFSSPNVGFKLRYVNEKYKSRGFEDVDGSHVGISANYYF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP051685_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP051685_6

5704734-5704929

Orphan

Consensus_repeat	Method
TCCTGCGTGGGCCGCTGGTCCTGCG	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP051685_6

>merge|NZ_CP051685|6|5704734-5704929|CRISPRCasFinder
GCCTGCGCGCGCTGGCGGACCTGCTCTTCCTGCTGCCGCTCCTGCTCCCGCCCATCGCCCGGCTCCTGCGTGGGCTCCCGCTCCTGCGTGGGTTTCCGCTCCTGCGTGGGTTCCCGCTCCTGCGTGCGCTGCCGGTCCTGCGTGGGCCGCTGGTCCTGCGCGGGCTGCTGTTCCTGCCTGCTCTGCTGTTCCTGAG

>NZ_CP051685|6|6|5704734-5704929|CRISPRCasFinder
GCCTGCGCGCGCTGGCGGACCTGCT	CTTCCTGCTGCCGCTCCTGCTCCCGCCCATCGCCCGGC
TCCTGCGTGGGCTCCCGCTCCTGCG	TGGGTTTCCGCTCCTGCGTGGGTTCCCGC
TCCTGCGTGCGCTGCCGGTCCTGCG	TGGGCCGCTGGTCCTGCGCGGGCTGCTGT
TCCTGCCTGCTCTGCTGTTCCTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP051685.1\|WP_170204758.1\|5699696_5701223_+\|FHA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238017
NZ_CP051685.1\|WP_170204753.1\|5688387_5689860_-\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|349879
NZ_CP051685.1\|WP_170204766.1\|5718116_5718941_+\|ribonuclease-HI-family-protein	unknown	unknown	gnl\|CDD\|260011
NZ_CP051685.1\|WP_170204754.1\|5692060_5693059_+\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP051685.1\|WP_170205656.1\|5718948_5719629_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|182251
NZ_CP051685.1\|WP_170204755.1\|5693055_5695665_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	unknown	unknown	gnl\|CDD\|223843
NZ_CP051685.1\|WP_170204759.1\|5701660_5703271_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
NZ_CP051685.1\|WP_170205655.1\|5713253_5716652_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223839
NZ_CP051685.1\|WP_170204767.1\|5719690_5720959_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340946
NZ_CP051685.1\|WP_170204752.1\|5687994_5688366_+\|DUF1566-domain-containing-protein	unknown	unknown	gnl\|CDD\|377878
NZ_CP051685.1\|WP_170204761.1\|5708841_5709864_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204764.1\|5717021_5717273_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170205653.1\|5698726_5699686_+\|protein-phosphatase	unknown	unknown	gnl\|CDD\|223704
NZ_CP051685.1\|WP_170204760.1\|5706534_5708769_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP051685.1\|WP_170204762.1\|5711101_5711764_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204756.1\|5695601_5697494_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235906
NZ_CP051685.1\|WP_170204763.1\|5711760_5713149_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204765.1\|5717495_5717999_+\|BcpO-related-WXXGXW-repeat-protein	unknown	unknown	unknown
NZ_CP051685.1\|WP_170204757.1\|5697954_5698593_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP051685.1\|WP_170204751.1\|5687086_5687764_+\|SOS-response-associated-peptidase	unknown	unknown	gnl\|CDD\|376837

Protein	Function_ID	Function_description	E-value
NZ_CP051685.1\|WP_170204758.1\|5699696_5701223_+\|FHA-domain-containing-protein	gnl\|CDD\|238017	cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins localize to the nucleus, where they participate in establishing or maintaining cell cycle checkpoints, DNA repair, or transcriptional regulation. Members of the FHA family include: Dun1, Rad53, Cds1, Mek1, KAPP(kinase-associated protein phosphatase),and Ki-67 (a human nuclear protein related to cell proliferation).	0.00135254
NZ_CP051685.1\|WP_170204753.1\|5688387_5689860_-\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|349879	cd03883, M28_Pgcp_like, M28 Zn-Peptidase Plasma glutamate carboxypeptidase. Peptidase M28 family; Plasma glutamate carboxypeptidase (PGCP; blood plasma glutamate carboxypeptidase; EC 3.4.17.21) subfamily. PGCP is a 56kDa glutamate carboxypeptidase that is mainly produced in mammalian placenta and kidney, the majority of which is thought to be secreted into the bloodstream. Similar proteins are also found in other species, including bacteria. These proteins contain protease-associated (PA) domain inserts between the first and second strands of the central beta sheet in the protease-like domain. The PA domains may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. The exact physiological substrates of PGCP are unknown, although this enzyme may play an important role in the hydrolysis of circulating peptides. Its closest homolog encodes an important brain glutamate carboxypeptidase II (NAALADase) identical to the prostate-specific membrane antigen (PSMA), which serves as a marker for prostatic cancer metastasis. Hypermethylation of PGCP gene has been associated with human bronchial epithelial (HBE) cell immortalization and lung cancer. PGCP also provides an attractive target for serological analysis in hepatitis C virus (HCV)-induced hepatocellular carcinoma (HCC) patients.	1.6059e-134
NZ_CP051685.1\|WP_170204766.1\|5718116_5718941_+\|ribonuclease-HI-family-protein	gnl\|CDD\|260011	cd09279, RNase_HI_like, RNAse HI family that includes archaeal, some bacterial as well as plant RNase HI. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties.	8.06368e-43
NZ_CP051685.1\|WP_170204754.1\|5692060_5693059_+\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	5.79165e-34
NZ_CP051685.1\|WP_170205656.1\|5718948_5719629_+\|HD-domain-containing-protein	gnl\|CDD\|182251	PRK10119, PRK10119, putative hydrolase; Provisional.	1.21778e-70
NZ_CP051685.1\|WP_170204755.1\|5693055_5695665_+\|FtsW/RodA/SpoVE-family-cell-cycle-protein	gnl\|CDD\|223843	COG0772, FtsW, Bacterial cell division membrane protein [Cell division and chromosome partitioning].	2.92513e-14
NZ_CP051685.1\|WP_170204759.1\|5701660_5703271_+\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	2.11991e-113
NZ_CP051685.1\|WP_170205655.1\|5713253_5716652_-\|hypothetical-protein	gnl\|CDD\|223839	COG0768, FtsI, Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane].	6.05914e-29
NZ_CP051685.1\|WP_170204767.1\|5719690_5720959_+\|MFS-transporter	gnl\|CDD\|340946	cd17388, MFS_TetA, Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of tetracycline resistance proteins similar to Escherichia coli TetA(A), TetA(B), and TetA(E), which are metal-tetracycline/H(+) antiporters that confer resistance to tetracycline by an active tetracycline efflux, which is an energy-dependent process that decreases the accumulation of the antibiotic in cells. TetA-like tetracycline resistance proteins belongs to the Eukaryotic Solute carrier 46 (SLC46)/Bacterial Tetracycline resistance (TetA) -like (SLC46/TetA-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.21416e-116
NZ_CP051685.1\|WP_170204752.1\|5687994_5688366_+\|DUF1566-domain-containing-protein	gnl\|CDD\|377878	pfam07603, DUF1566, Protein of unknown function (DUF1566). These proteins of unknown function are found in Leptospira interrogans and in several gamma proteobacteria.	1.20811e-06
NZ_CP051685.1\|WP_170205653.1\|5698726_5699686_+\|protein-phosphatase	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	2.39928e-12
NZ_CP051685.1\|WP_170204760.1\|5706534_5708769_-\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	1.59599e-09
NZ_CP051685.1\|WP_170204756.1\|5695601_5697494_+\|hypothetical-protein	gnl\|CDD\|235906	PRK07003, PRK07003, DNA polymerase III subunit gamma/tau.	1.62457e-08
NZ_CP051685.1\|WP_170204757.1\|5697954_5698593_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	3.97427e-33
NZ_CP051685.1\|WP_170204751.1\|5687086_5687764_+\|SOS-response-associated-peptidase	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	2.14937e-53

>NZ_CP051685.1|WP_170204759.1|5701660_5703271_+|HAMP-domain-containing-protein
MTSKLTLRIRLIATMALLGLIIVATGLIGIHGMRATQASLEEVYSSQLVSSIVLNNSKNFLSRARFVLDRAVLHPDAPDIDKTIARMQGFLADSDKTWKEYLAMPRDAEEQALVDALAARRKEYVDGAIATLTRAVQQRDGAAVETLFMKTLTTAFGDYNTASNKLDDYQVKSAKAAFEESLARSERLLKLAVGAVVLGALLIVVSSVSLLRAIMGPLDQALGHFEAMARGDLSTPVPAGRGDEMGKLLGGLADMQHNLAATVRSVRDSSASIASASSEIAAGNLNLSNRTEQQAGSLEETASSLEELTSTVRHNADNARQANQLAVSASQVALRGGQLVAEVVDTMGTINASSRRIVDIIAVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAHRSAAAAKEIKELITASVATVDSGAALVDKAGTTMDEIVTSVARVTDIMAEIMAAGAEQSAGIDQINQAVLHMDQATQQNAALVEEAAAATAALHEQAHALSGLVGTFRVEQDDRAADGAHALPGAGRLALPA
>NZ_CP051685.1|WP_170204758.1|5699696_5701223_+|FHA-domain-containing-protein
MKRCASPDHPHCTTWVMPGAPVCAHGHAQPADPGHEAAMTADAAAPALLPRALPQAVPALPVYAQPVPARPHLRVSGFDPRAAGGRQTIKLTLHAMAADAPARLEARLASELLAGSGARLAFTRDVHGGWLPLYIEFSSRGREHGQYRIDVELRGEPPRRHEAPAAADAGAPVAARAWVATLVLLVPRPDASLEEIHRTFLSTHKNVRISADDASIARVHGLDAGGPMDIEIAARNAGIARLDLAGLAGNGHGGGKIDLALPTIAWDEDLIEIDLAAASRAGAQVPARLAGAHPCPASSACLVAANGRAGVPRHLRLFALDECVLGRWESTQAGAGPALLHYGAHGPEADGLTRRLSARHALVRPRRDGFEIEDVSRYGLLLDGAWPGKRHAVPLRAGMRIEFTASIRGVVLLEVGALSAHGVLLRRADGGADDECFLLLAPERHPDAALTAAAMPPLFHRDGGFWHLDRASGRETALAPGGAAGSLAGLEGYGRFAATARPEDRRPG
>NZ_CP051685.1|WP_170205653.1|5698726_5699686_+|protein-phosphatase
MAAALRFGALDVAAFSCVGAGPRLREENQDNLVLIDTAGEAVFLRDGLPQRRRLPGWRAGHARVAVLDGMGGHGHGREAAEAVAAGLLALPPCDGAAELAQRLDGLHAGLQRHFAGAAFGHGARPGTTLTMLELPAGGAPLLYHAGDSRLYEITRTHAAPLSVDHVPATAFAMAGLLGEDDWWRQVHGEHRPQVSQAFILGNAFADPARLSDPLFELSAANLPAWLAPLADRRALALRPGASYLLATDGLWSCSDPDGWVGQWPQLLGGRAKAATMLAALFGAYDAHPAAFFYPDNVTAILLRTPDGAGREETALPDAR
>NZ_CP051685.1|WP_170204757.1|5697954_5698593_-|GNAT-family-N-acetyltransferase
MTSASTSTSTSANANAGAILIRPLAGADVPAAAGVLRRGAEAFILHESAPQDAADFLAQHGEDGIRAALAAGMAYHAALVDGQLAGFIGIRERSHVYHLFVDERWQRRGIARRLWECARAAALAPGHAGVFTVNSSNHAVPLYEALGFVRSAPMQVARVRYNPMRLDAALTRAVGGVAEVGAVVPDASLADAALPHARAGLAVSAAALVDPA
>NZ_CP051685.1|WP_170204756.1|5695601_5697494_+|hypothetical-protein
MHTVPRIAPRTAPTYVERQVLTGIADVFDPEALWQAPGLALFARRPLLRDLLERAPRERRGNAATRCFSHVTLVLPQEEVDDDRHLTRGARVRDLTQGLAALHQRDFGDLLGGDEVRYRVLGADGLAPGEVEVRFGHAVYLPAPGEAVQHTVGVSRDSAVWKTACAIYPNQRLTLIGQDEHGATCAAPGWPFGAEGAVLLVNDGPGLPLEVQVRPRDAFDCVYDAVQDYYVIRSRRGAVDGAGVPLRLLLRVTPAAGPAAAPSVQDARQAPAAVALPSVAARARLQQAGAPAAAPAHRAVPAAPPAAGATHAAGGTPAHATLQGQVAIAAQTAHMATLPGRPLPAQPAAGAPMDDASADAMPAAPAPASLRPAAVWKPRLAPDDQRTALPAAPGAQRQDARSPQAIDAEATYAPLARHRVALAALALPRLSRYRDTGAQALEIGLDRALAPAAAGNAVITFAVDQADGLHAITAAGREAIGVPSSFRPVDNGAVDLLAVAPGMADRYCALLRLPPTPALPAAPGARCVFGRAAPALAALRVLDSPRFLRHAAGSAASSADRLGLSRSAFSFDTAEDGFDIARLSPTQALYHLDERLAFVAAIDAATPEAPYRLPAGHHLVAGHYVLRFEA
>NZ_CP051685.1|WP_170204755.1|5693055_5695665_+|FtsW/RodA/SpoVE-family-cell-cycle-protein
MRPLRVFAGAGLLALCCLQLLALLRAPAAWMPAEVGIVLGRGDSMQIGRDALGAPEGDAAPFLLRRDAGGDWWIGATDGAAPPALERDGVRRRGGSVTLATGQRLRVGAATFAIESGGADAVGFSSATMPPVAPAAPAAALPYGTPLDAGRMDGAPQDAASAASPVVPARAGGAPAAVHWRYDGATLWRDGAVQPACPDTRAGARLAAAWNRVAPAALTLARPLVFGGNLDCGNRIALPGLAAPAASFARSADGIAASAGGAGVQAPPLMVEAGIETALAERALRLQAGDILLAGRTRLLVRPDGGLLRLRPASHVALYAEPQRRLPPGVTWSWQRRALWNPAPALAAVMAGSAGVLLAGFCAWRRQKRGRPRAARTDGRAVFQLLAGALLALAGLLLLWLQRSGAAAGAGVALPVAWAALWLALWAPRRLPLALAAALLLLATGLLAQLELGLAGPDSSWLRYVQKSAALLAVGLGGGAGWQGWRGWRMQHGSAAPRQARVEALLMLLAALALAALLLQVAFGDETGVFDLQPVEFAKLALTALSAHCLALAAGAQPAPGGALRQCLRLVFPALLFAVLLAVALVQVDDYSPLVLLGVWGGALALAYALATGQRLAAAALLGCACLAVLGIVGLRGAGPAALAQWNFYADRFLVWLDPGTHPHTGQQLLLGARAVMEGGWRGADGLFGLATATRGGEAALRIPAVQDDFAASFFLNRHGLAAALALWLLQAAFVAGLLAIALRCWLAQRHARDFRLAWLARLRCFVLCGGAAFVCGHFLLSWGTNLAIFPVMGQPMSFLSAGGSHLLFFICPLLAFAAASAQSLEENQPCPAASHSAATPPGPHPAPACTPSPALHPALRQPTSSARS
>NZ_CP051685.1|WP_170204754.1|5692060_5693059_+|serine/threonine-protein-kinase
MYAAGDIIALTGGAWRLRAPMAASSYGVLWRAEPCLGGAPAALKLVNLAQMALALPPQRACWTRDAAAEIGFLRALQPWDRRHIVRLLDSGVHLDQPAMALELLDGDLARHLECLRLRGERVSFAQALAWTAQVNAALAKVHQYGWRYLDLKPANLLVDKGGGNGGAALKLADFGTNRPLADARAHAYAGTASWQAPEQFFEHEDGGYRTDARTDYFALGALLYHLATGVQLRFGGACAGARRVHGSAAAAWLRERHGGAVPPPLAPDEAALFLRHALPHGAGCGEAALALLRALLAAHPDGRPRHALEISRLIERVRLGAGDAVQPLRSAA
>NZ_CP051685.1|WP_170204753.1|5688387_5689860_-|M20/M25/M40-family-metallo-hydrolase
MNRRSRLPALSLLAACLLGSAAHGATPGSDPAALARVRDTALANDYPYQRLEDLTDLVGPRLSGSAGAAAAVTQVAEELRKLGARVTLQPVKVPHWVRGVETGTVVDYRGRPAGVTQKVVLTALGGSGATPAAGLTAEVVVVRSFDELKARAAEVKGRIVLFDVPFDQDMADRGLAGTAYGQAVAFRGAGPRMAAEMGASAALVRAVGGAAYRIVHTGATNLADNARIPAAAITIEDSMLIARLAKRGPVKLHLTLTPQTLADADSYNVIADWPGTDKADEIVLVSGHLDSWDLATGANDDASGVVSAMGVIDTLRKLDYRPRRTIRVVAWMNEENGGRGGKGYNDAYRANAEKHFAAYEDDNGSGRPFGLRAGIGQAAAKLFAPLQAALYPMGAGAFRREDVVGSGDLRDLEISGVPSFEPWIDSSDYFNYHHTPADTFDKVIPENLRRHAAVMATTAWFLANMDQPIGRANVAVEAVEAKARATGAVK
>NZ_CP051685.1|WP_170204752.1|5687994_5688366_+|DUF1566-domain-containing-protein
MGDYLRIQEMLKEGESYAGLILGKNGEPDYHLVLLADTVSDISWPAAREWALEQDGELPTRRELALLFANQREGFDRVWYWSSEQHDTRPQLVWGQNFASGIQTVYGRPFRGHARAVRRVDGG
>NZ_CP051685.1|WP_170204751.1|5687086_5687764_+|SOS-response-associated-peptidase
MCGRFDQSQTARFYANIFGWTDAVFDSESAPTTNAAPGTYRPVLHVQDGQRRVDDVFWSYRAKWADGKVPICINARLEKLPNRYWARLLKNGRGIVPAEGWYEWTGEKGHKQPWHIHRKDRAPLFLVALANFGAFEENRAEAGFVLVTDDASGGMLDIHDRRPVVLDAEDAKLWLDPGLAPQQAVELLRHAALPSEAFEWHKVGTAVNRAGADGPQIALPLEEQE
>NZ_CP051685.1|WP_170204760.1|5706534_5708769_-|hypothetical-protein
MLKMFGFGGAACPRCAHKNAGEDGYCAGCGLMLGAPRHAPVLVDNRWMPGPDELAVFFGVRDLAGLFVKVLRVPATARAFILQGGEATEVQQGEYEIEGFFTRLNHLLRDQHAEILVTRSGALPVEFAFDDLASSEHLQLAARVTLSLRIENVPAFARHFMTMPGTIGAAQLRELLQAPLRQLAAEFSAARSLRDMAGNAELRPQLDQHLQGGLALLLAQYGLAVARVDTLALRHDKFDANRARIGSLWLAADEQRVAREHARHLDELYGEEEWQRIRRAEQDVRLDYRRAQLRQESALERAELSLENAERAHAVRAREIELYGRIVESRTRKQAIERGAVDVVREIEHELGEKRGARLDEQGQWEHLRAVAGIRMRTELEVAQQDTLEARTVARQRFSHALVQQQIRNKIEQAQAIEDAAQRRSELARLREAEQAGALQARAIDDEEHAARLKLLQLAHRARAREAERVLEWEETQFGARLREAARGESVEAEFTRQKLDELRRAGGRADAVAQRDKLLLTIELDAEQARREQALQLDAEEKRAALRAAEREAAWQQELRVLAQQAGRQEAAHAQALELARLELARAEALGAMDDGARVALAPAANAALLADVMKARVHAGMSAEQLGGLAGVAAAALPGAEALEAARQKADAARADERGQRARDADSERRHQLDLLALHNGAGRPVAAAGVPAAGAPAAVSPAAGSSAAVSPAPAAPACTHAQAGPADRFCAACGASLAARG
>NZ_CP051685.1|WP_170204761.1|5708841_5709864_-|hypothetical-protein
MSPAPTTAACRSLLPDGAVLTVSAVRRPRDGRAEVKSAACGDAALAARMTETVRLARHTETRFDSRDQVVLSLDRAPPAGWRDWELAAVLADRMVRGLWRPNGTPLANGWSDTWQLGRVDGHAIDDSVVAAEVLLGGPGALAHLGMLDGHPDPGAAVSSARAWFPLHSGGAGDSLCWVEVGLHPLAAGAAGAAEEEEQTIAVPGQDAARQAAVRQALAGARQFDGRGLGRWRTTVRFGGQPFQGRSFELALVLADRIARGREFVPRARLIASGCSDAWHTGRVDTVEAIDAKCALLLREAGAGDRILLPQAWQDALPAGFAEGVRALGASVACVARIGII
>NZ_CP051685.1|WP_170204762.1|5711101_5711764_-|hypothetical-protein
MNTRNTGGADQAAHQLQRRLGERALLGRRVEGDRLALADATLLAALDGSRPLTAGERAALQASPLTARRLRQLALERRARSAADANGADANGAGSVVREAAGGWRGSRGMLRAASSGAVAALATDDGCWTLHLLRQEGAWRAILQLSADAPFAAQLLAARTPLRVCDGAGAVLLQGCLDDDGECEAAWPFAAAPGAHLQAHGAGFSVEPCSAAPSAREPS
>NZ_CP051685.1|WP_170204763.1|5711760_5713149_-|hypothetical-protein
MRLPGTRYQEPGWEEVRKLLGQCSLAALRAGAPAHPDSDPQARADALERYVEAMAAALHALRRTARAQAPGNAYGDSVFELALSLLFELQARPADWHALCEALDGVDRGGADDGLLRKKVNDMYALLRDRVDADNYQAACGRPCSANRMYAYRMLDTAYGEIARLFADWERHRDQVGAILGRELAGVPIEVRQLRGIGGCRPEWVLRWSATRARFGPGPGPLHTRSKRFASLKDQPERIGAMLAEIGEYQVLSDNRDRDWLQDLDDAAVWMEDYWRVLQESVDAAVPGPDRILEARQDALDADACDADARDPAAAGVDPDDAQADCAAQDGLGAAGDGQALAAAARLEAIALAVALPPGYMQAAAHAEEAGGWVARALRDAGLPVRLAVYARVLGAADDAYPDAWRDPASGELPTMRQLAALAQVSLPTLRKRRDAAIDKLVAIERPAAIEQPGAAPIRRSG
>NZ_CP051685.1|WP_170205655.1|5713253_5716652_-|hypothetical-protein
MPPFAAALAWPGARLHAALLAWRASWPRSGAAVTLRRPGPLAVLAVAAIALAAAGAWTIAVHARWLDAAALESMAPDGGLAALQPLLPGAAFDVPSGPAVRLERRGGAALLVLSGLRPEPARRIDLCSQLADPGGGRLLTLRIGERFEDVAALAARRAAAGTPLALRNVVLADEAMPRIEIGGAVAGRGMANAALPDAAGAGAVLGAPPLMLRWQGDARWIGDGGAAAPAGGSGTAALHGQGWLLWGGTRALRVLRRPSAACAQTGELVLQLYRPAPGAAQGVAQTAAPAAAQRALVAAFALGTDFAPGAAGSAGSAPGPAEIRLAPGSYRVPQAAPARLEDRQLFEQLRAHGLVRLGAGGLAELAPPDLFAWRAAGPTAWDDVVLDDEARRLLQHVYGRADGDYVREQLRIFNGERRLLAWRVQDAAPADAGAAGADAVAALAATPLAAGAMAAAGMPALPWRADAGGMPAPLAHDMPAAAARLFARLPQGWTPWQRIGAWPAGRSATLRLPLAAPAQGGERLRLMLAGRLLDVRGALLAAAPVPACSGRACRTPDQVQVLDLRLAPGARELALDAASLGLDALAMPGDARYRHLALEHGRLAWQALPAHAGAPAAAPQSPVPAAPALRLEDRSGAPLWRDGAPVDAARGAGLAALLGVHAGQQSGLAGMLGRLPGGAHRARLTIDLDLQRAAQAALDCIGLRRGRWEGGACSGAQAAPDGRQAGLVLLDAETGDILAAAGSGGADLDRLDGARWRELRDFDRADPAASPLRLPAWQHDGGAERSPGSTFKIVSALGLERAARADRSLDALLDGLPLPAINALARARGFDFRTDAPSYPAAAGKAAARITNFRDQGLDRRAQDGRLGLSQALTYSLNTWFAWTGELADRSLLGLPSGGVPDLQPLAPGALDDVRPIVAMARRLGFGQALRLDGGLLPDDYTWSAWDALQATPAAIDPVHTRHELRQMAIGLRMQATPLQMALAAAAVGQGAVVRPRLLADLDGRAAVDAPQQPLGVRLDRVRAGLKGVVDSGTAAGAFGSPGGAGMEAIRRGLSGKTGTAPVGDGRLATVWFTGWLEPHSVPGQAHRLALALFVSRSEATGGEHAAPVAAALLRHLAARGAQKTQAHQAPK
>NZ_CP051685.1|WP_170204764.1|5717021_5717273_+|hypothetical-protein
MNIVKHMEAAFLVVLSVAGAASVAVDAIPEAQARVAPAGAALVQAAQPAAAAVPMAVVHVSAKRMTAAEKQASLARERAGQPI
>NZ_CP051685.1|WP_170204765.1|5717495_5717999_+|BcpO-related-WXXGXW-repeat-protein
MKSLTLAALIALGAATAPLPSLAAGQVNLFIDTAPPAPLVERIPAPRHGYVWAPGHWEWNGRRHTWARGYWIAERPGYVYSAPSWYARNGGWYMEPARWTPYGRDRNRDGIPDRYEYRGGPGRWDGHGPDRHDRPHGWRDGGPDRHDRDGDGVPNRYDHRPDNPYRR
>NZ_CP051685.1|WP_170204766.1|5718116_5718941_+|ribonuclease-HI-family-protein
MDETIDLHHLAFKSERAASRRLARTQGLSEEQALRRTLELNAGRAGLAALVASRTALRDGEEQRAAARDVARDAVRAAGAARREAARRLRHGEPPDGSDAATGLPVAAASGNGDAAIRPPTSAPTAGTTAWRAWFDGSARPNPGRCAIGAVLLGPDGRRVELAQDAGYGSSSDAEYRALIALLQAALAHGARALTVYGDSRVVIDDVNGPDALAARVLAGYRAQVRALAARFDPLYLRWVPRHRNTQADALAQQAGNRPAPAPTDTVHATDTDA
>NZ_CP051685.1|WP_170205656.1|5718948_5719629_+|HD-domain-containing-protein
MTPELDAWRTRLAALAAAVAQADAGASDGAHDANHLERVWRNARALLPDHPHADALTVLAACYLHDLVNVPKNDPRRSRASRLSAELARRELAALAFPPAKLDGVAHAIEAHSFSAAIPATTIEAQIVQDADRLDGLGAVGLARMFYIAGRMGSALAHGADPLAAARPLDDRAYALDHVPAKLALLPGMMQTAAGRRVAERRLALLEDFRSAFADEWAGGATAAPE
>NZ_CP051685.1|WP_170204767.1|5719690_5720959_+|MFS-transporter
MDTSATLAKAPAGNLKFVLICVFIDLLGVGLIVPVLPALVGEYAHGREQQALWFGILAAVWALMQFLCMPVIGMASDRLGRRPVLLYSMAGMCAAFLSTALAPNLAWLFLGRVLGGASSASMAVASAYAADVSAPEERAKNFGKVGAAFGLGFICGPVLGGLLGNVGLHLPFYVAAALAAANFVYGAVAVPESLPAERRAPFRLARLNPFAALLRLLRRRDVRGLVAVYTLVSFAQMTLQATFVLYSSFRFGWTPRENGVALCCVGLTSFLVQARLLGPLIRRFGERRLALAGMSSGACAFLLYGLATRGWMLYAIILCNLLSFAVVPTLQGILSKDAAPREQGELMGSLQSIASLGLIVMPLVGTRILGAVGHLPPQDWRIGSSFYLCAAMQAAAILAAWRVLRPGAPATPAAPPPASHRL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	996117-996152	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	3066387-3066422	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4327707-4327742	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4838638-4838673	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	5275168-5275203	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	54138-54173	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	957127-957162	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4327487-4327522	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4483090-4483125	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	5330299-5330334	0	1.0
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	1223943-1223978	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	3111940-3111975	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4207923-4207958	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	4319277-4319312	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	961713-961748	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	2836129-2836164	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	2990022-2990057	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	5024461-5024496	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	5056464-5056499	1	0.972
NZ_CP051685_3	3.1\|3659451\|36\|NZ_CP051685\|CRISPRCasFinder	3659451-3659486	36	NZ_CP051685.1	2424565-2424600	2	0.944

1. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 996117-996152, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

2. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 3066387-3066422, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

3. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4327707-4327742, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

4. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4838638-4838673, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

5. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 5275168-5275203, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

6. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 54138-54173, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

7. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 957127-957162, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

8. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4327487-4327522, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

9. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4483090-4483125, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

10. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 5330299-5330334, mismatch: 0, identity: 1.0

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgactccccgcga	Protospacer
************************************

11. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 1223943-1223978, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

12. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 3111940-3111975, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

13. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4207923-4207958, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgattccccgcga	Protospacer
**************************.*********

14. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 4319277-4319312, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

15. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 961713-961748, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgtttcaggcactgcctgaaacgactccccgcga	Protospacer
******.*****************************

16. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 2836129-2836164, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

17. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 2990022-2990057, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

18. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 5024461-5024496, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcactgcctgaaacgacgccccgcga	Protospacer
*************************** ********

19. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 5056464-5056499, mismatch: 1, identity: 0.972

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttccaggcattgcctgaaacgactccccgcga	Protospacer
*************.**********************

20. spacer 3.1|3659451|36|NZ_CP051685|CRISPRCasFinder matches to position: 2424565-2424600, mismatch: 2, identity: 0.944

gtcgttccaggcactgcctgaaacgactccccgcga	CRISPR spacer
gtcgttcccggcactgccggaaacgactccccgcga	Protospacer
******** ********* *****************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	LR743532	Xanthomonas phage Bosa genome assembly, chromosome: 1	47465-47495	3	0.903
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MG018224	Stenotrophomonas phage DLP4, complete genome	18979-19009	3	0.903
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MT664984	Xanthomonas phage Xp12, complete genome	48880-48910	3	0.903
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	KX898400	Pseudomonas phage JG054, complete genome	7427-7455	4	0.862
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	769334-769364	5	0.839
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	217718-217746	5	0.828
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	472773-472803	6	0.806
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP010860	Marinovum algicola DG 898 plasmid pMaD5, complete sequence	32504-32534	6	0.806
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MT740732	Ralstonia phage Darius, complete genome	43751-43781	6	0.806
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MT361768	Ralstonia phage RPZH6, complete genome	5221-5251	6	0.806
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MT740740	Ralstonia phage Gervaise, complete genome	5646-5676	6	0.806
NZ_CP051685_6	6.2\|5704822\|29\|NZ_CP051685\|CRISPRCasFinder	5704822-5704850	29	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1160438-1160466	6	0.793
NZ_CP051685_6	6.2\|5704822\|29\|NZ_CP051685\|CRISPRCasFinder	5704822-5704850	29	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	762165-762193	6	0.793
NZ_CP051685_6	6.2\|5704822\|29\|NZ_CP051685\|CRISPRCasFinder	5704822-5704850	29	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	289285-289313	6	0.793
NZ_CP051685_6	6.2\|5704822\|29\|NZ_CP051685\|CRISPRCasFinder	5704822-5704850	29	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	419424-419452	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040720	Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence	135408-135436	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	17780-17808	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP035092	Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence	43486-43514	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP039697	Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence	520363-520391	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_015146	Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence	48067-48095	6	0.793
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_008688	Paracoccus denitrificans PD1222 plasmid 1, complete sequence	290833-290861	6	0.793
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1666051-1666081	7	0.774
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	723108-723138	7	0.774
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	1409277-1409307	7	0.774
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP039454	Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence	64552-64580	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_020261	Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence	29101-29129	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	216809-216837	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	495352-495380	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP045780	Cronobacter sakazakii strain CFSAN068773 plasmid p2CFSAN068773, complete sequence	13867-13895	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034699	Salmonella enterica subsp. enterica serovar Karamoja strain RSE40 plasmid pRSE40, complete sequence	168780-168808	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_KY454639	Klebsiella pneumoniae strain INF167 plasmid INF167_p0001, complete sequence	140392-140420	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP012256	Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence	11025-11053	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	118209-118237	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP015754	Klebsiella pneumoniae strain W14 plasmid unnamed1, complete sequence	158632-158660	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034710	Salmonella enterica subsp. enterica serovar Karamoja strain RSE21 plasmid pRSE21, complete sequence	76317-76345	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_019957	Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence	376324-376352	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026161	Klebsiella pneumoniae strain F93-1 plasmid pF93-1_1, complete sequence	47178-47206	7	0.759
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016160	Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed1, complete sequence	21247-21275	7	0.759
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NC_022772	Salmonella phage Marshall, complete genome	73039-73069	8	0.742
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NC_049378	Salmonella phage ST-W77, complete genome	31754-31784	8	0.742
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	KF669654	Salmonella phage Maynard, complete genome	71286-71316	8	0.742
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1294808-1294838	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	431846-431876	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NC_008383	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence	47171-47201	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	486950-486980	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	1673873-1673903	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NC_023285	Streptomyces sp. F8 plasmid pFRL5, complete sequence	36198-36228	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP022670	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence	16839-16869	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MG757154	Streptomyces phage Bing, complete genome	55584-55614	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP009803	Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence	78926-78956	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	94890-94920	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP010825	Thermus aquaticus Y51MC23 plasmid pTA69, complete sequence	57599-57629	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	697334-697364	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	MN310541	Mycobacterium phage Jeeves, complete genome	9646-9676	8	0.742
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	KT898134	Aeromonas phage phiARM81mr, complete genome	11941-11971	8	0.742
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_KT282968	Escherichia coli strain EC012 plasmid pEC012, complete sequence	59392-59420	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP032991	Escherichia coli strain W2-5 plasmid p2_W2-5, complete sequence	37993-38021	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_KT990220	Escherichia coli strain 42-2 plasmid p42-2, complete sequence	25960-25988	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP025081	Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence	163177-163205	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052163	Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence	166140-166168	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP014011	Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence	59901-59929	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP037743	Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence	160797-160825	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052804	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S973 plasmid pN17S0973, complete sequence	138837-138865	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034201	Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence	216722-216750	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP038508	Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence	267852-267880	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052159	Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence	162968-162996	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MT035874	Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence	161425-161453	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP053733	Escherichia coli strain CP55_Sichuan plasmid pCP55-141k, complete sequence	30810-30838	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN543581	Klebsiella pneumoniae strain PM48TC plasmid pPM48TC_fusion, complete sequence	146784-146812	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN543585	Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence	139509-139537	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP033961	Klebsiella pneumoniae strain L482 plasmid p2_L382, complete sequence	77578-77606	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052788	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0611 plasmid pN19S0611, complete sequence	37923-37951	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN543575	Klebsiella pneumoniae strain GH44TC plasmid pGH44TC_fusion, complete sequence	155632-155660	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN543576	Klebsiella pneumoniae strain GH44TC plasmid pGH44TC_vir, complete sequence	150175-150203	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP033955	Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence	131354-131382	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052432	Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence	112990-113018	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052144	Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence	163468-163496	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052363	Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence	152338-152366	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052786	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0641 plasmid pN19S0641, complete sequence	49854-49882	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052838	Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S097 plasmid pN16S097, complete sequence	49100-49128	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP051676	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1234 plasmid pN16S1234, complete sequence	236294-236322	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347226	Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence	109744-109772	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347227	Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence	110026-110054	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347228	Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence	109716-109744	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347229	Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence	109372-109400	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347230	Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence	108910-108938	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347231	Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence	108514-108542	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347232	Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence	110091-110119	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347233	Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence	108966-108994	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347234	Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence	108735-108763	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347235	Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence	109192-109220	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347236	Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence	110036-110064	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347237	Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence	108908-108936	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK347238	Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence	109759-109787	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034776	Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence	169975-170003	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052357	Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence	165092-165120	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052781	Salmonella enterica strain CVM N19S0949 plasmid pN19S0949, complete sequence	30480-30508	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052834	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S041 plasmid pN17S0041, complete sequence	129016-129044	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP014009	Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence	218920-218948	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP053235	Escherichia coli strain SCU-106 plasmid pSCU-106-1, complete sequence	36159-36187	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052793	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0388 plasmid pN19S0388, complete sequence	150736-150764	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052832	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1040 plasmid pN17S1040, complete sequence	301352-301380	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	LR134211	Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2	129405-129433	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP041374	Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence	131354-131382	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052232	Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence	141815-141843	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052830	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1105 plasmid pN17S1105, complete sequence	28248-28276	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040546	Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence	128690-128718	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP028791	Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence	120882-120910	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP032241	Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence	168859-168887	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	LN735558	Escherichia coli plasmid pC193, complete sequence, strain C193	44262-44290	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	LN735559	Escherichia coli plasmid pM105, complete sequence, strain M105	43022-43050	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	LN735560	Escherichia coli plasmid pV408, complete sequence, strain V408	34681-34709	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	LN735561	Escherichia coli plasmid pC271, complete sequence, strain C271	45085-45113	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP039526	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence	180779-180807	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052563	Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence	162118-162146	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP047193	Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence	114532-114560	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MF943217	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence	101630-101658	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP032164	Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence	131761-131789	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034416	Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence	149889-149917	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052190	Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence	163511-163539	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP030270	Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence	161668-161696	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	291544-291572	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP023723	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence	147932-147960	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040540	Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence	109676-109704	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP045675	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence	111219-111247	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026166	Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence	157292-157320	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP025677	Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence	68232-68260	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052304	Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence	164853-164881	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052812	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S376 plasmid pN17S0376, complete sequence	129966-129994	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052204	Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence	163502-163530	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052810	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S535 plasmid pN17S0535, complete sequence	78608-78636	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052808	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S637 plasmid pN17S0637, complete sequence	140917-140945	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040595	Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence	31149-31177	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034124	Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence	131362-131390	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP050724	Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence	30903-30931	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052178	Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence	164561-164589	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052806	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S816 plasmid pN17S0816, complete sequence	21580-21608	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP047572	Escherichia coli strain 2EC1 plasmid p2EC1-1, complete sequence	47007-47035	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052791	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0552 plasmid pN17S0637, complete sequence	2615-2643	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052236	Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence	286923-286951	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052818	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1509 plasmid pN17S1509, complete sequence	25141-25169	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054751	Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence	127057-127085	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054781	Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence	127060-127088	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP028390	Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence	152862-152890	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034054	Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence	231677-231705	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP034083	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence	163209-163237	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054763	Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence	127065-127093	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP029383	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence	149897-149925	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	8360-8388	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	134977-135005	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026012	Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence	28331-28359	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026024	Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence	63115-63143	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054745	Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence	127059-127087	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054727	Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence	127057-127085	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054739	Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence	127063-127091	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054775	Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence	127060-127088	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054733	Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence	127056-127084	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054721	Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence	127059-127087	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054757	Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence	127055-127083	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054769	Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence	127063-127091	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP050276	Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence	154384-154412	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK649822	Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence	116262-116290	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK649823	Klebsiella pneumoniae strain BA6740 plasmid pBA6740_1, complete sequence	184703-184731	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK649825	Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence	139673-139701	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052259	Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence	169647-169675	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026587	Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence	85159-85187	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_LR745046	Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166	160652-160680	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_LR745043	Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154	149378-149406	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MK295820	Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence	106656-106684	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052495	Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence	165024-165052	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK413723	Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence	227326-227354	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK413721	Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence	226838-226866	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MN058044	Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence	2134-2162	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK673546	Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence	17157-17185	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP032356	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_Vir, complete sequence	148266-148294	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052799	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S990 plasmid pN17S0990-1, complete sequence	151268-151296	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MH263654	Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence	149902-149930	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MT090959	Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_KPC, complete sequence	118592-118620	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197498	Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence	47301-47329	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197503	Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence	50210-50238	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197495	Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence	50210-50238	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MF398271	Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence	172211-172239	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MF344575	Escherichia coli strain 140611011 plasmid p11011-CTXM, complete sequence	51846-51874	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197502	Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence	50210-50238	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG545910	Escherichia coli strain EC014 plasmid pEC014, complete sequence	38965-38993	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040534	Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence	109656-109684	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_KU321583	Escherichia coli strain E80 plasmid pE80, complete sequence	47767-47795	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052795	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence	130663-130691	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP010233	Escherichia coli strain S30 plasmid B, complete sequence	14902-14930	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP031258	Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence	112392-112420	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP030924	Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence	103791-103819	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP026022	Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence	132002-132030	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052802	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence	162116-162144	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP019272	Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence	46075-46103	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN200128	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence	47713-47741	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	47696-47724	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052840	Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S024 plasmid pN16S024, complete sequence	293107-293135	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP019049	Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence	180665-180693	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP019248	Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence	68164-68192	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052783	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0679 plasmid pN19S0679-1, complete sequence	47607-47635	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052784	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0679 plasmid pN19S0679-2, complete sequence	3534-3562	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052836	Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S103 plasmid pN16S103, complete sequence	183800-183828	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	64066-64094	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_LR134257	Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence	126572-126600	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP027063	Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence	54299-54327	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052779	Salmonella enterica strain 19TN07GT06K-S plasmid pN19S1233, complete sequence	114-142	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_005249	Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence	47386-47414	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052828	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1126 plasmid pN17S1126, complete sequence	292422-292450	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP036191	Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence	175579-175607	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_006625	Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence	195793-195821	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052826	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1245 plasmid pN17S0637, complete sequence	276422-276450	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP019161	Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence	233624-233652	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016409	Salmonella enterica subsp. enterica serovar Infantis strain FSIS1502916 plasmid pFSIS1502916, complete sequence	260373-260401	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP040726	Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence	170575-170603	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052822	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1349 plasmid pN17S1349, complete sequence	276354-276382	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP050380	Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence	252933-252961	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP035906	Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence	110429-110457	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP017633	Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence	37581-37609	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016407	Salmonella enterica subsp. enterica serovar Infantis strain FSIS1502169 plasmid pFSIS1502169, complete sequence	260373-260401	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052820	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1442 plasmid pN17S1442, complete sequence	260368-260396	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016413	Salmonella enterica subsp. enterica serovar Infantis strain CVM44454 plasmid pCVM44454, complete sequence	260373-260401	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP047578	Escherichia coli strain 94EC plasmid p94EC-2, complete sequence	38672-38700	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016411	Salmonella enterica subsp. enterica serovar Infantis strain N55391 plasmid pN55391, complete sequence	257986-258014	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052816	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1598 plasmid pN17S1598	20509-20537	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP047678	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence	200663-200691	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP052814	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S349 plasmid pN17S0349, complete sequence	264468-264496	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP047676	Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence	200663-200691	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP030283	Escherichia coli strain E308 plasmid pLKSZ02, complete sequence	60997-61025	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP052037	Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence	22154-22182	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP023135	Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence	115131-115159	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP031369	Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence	196503-196531	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP018338	Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence	26296-26324	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	CP050281	Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence	157753-157781	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_AP019549	Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence	47654-47682	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP041024	Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence	106026-106054	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP024140	Escherichia coli strain 14EC020 plasmid p14EC020b, complete sequence	23093-23121	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP054064	Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence	189678-189706	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK715436	Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence	73383-73411	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK413722	Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence	162369-162397	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NC_017541	Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence	7637-7665	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MH255829	Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-CTX-TEM, complete sequence	12938-12966	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK191024	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence	93986-94014	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MH580302	Escherichia coli strain 1107 plasmid p1107-118K, complete sequence	34317-34345	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MK079574	Escherichia coli strain TS62CTX plasmid pHNTS62, complete sequence	17958-17986	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197488	Escherichia coli strain 04NHB3 plasmid pHN04NHB3, complete sequence	14753-14781	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG197490	Escherichia coli strain FKD271 plasmid pHNFKD271, complete sequence	14753-14781	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP016815	Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence	184410-184438	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_MG053312	Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence	182582-182610	8	0.724
NZ_CP051685_6	6.3\|5704876\|29\|NZ_CP051685\|CRISPRCasFinder	5704876-5704904	29	NZ_CP025462	Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence	208168-208196	8	0.724
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	769328-769358	9	0.71
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	KX557278	Gordonia phage Ghobes, complete genome	39198-39228	9	0.71
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	750690-750720	9	0.71
NZ_CP051685_1	1.5\|2648536\|31\|NZ_CP051685\|CRISPRCasFinder	2648536-2648566	31	JQ691611	Cronobacter phage CR9, complete genome	74317-74347	9	0.71
NZ_CP051685_1	1.1\|2648272\|31\|NZ_CP051685\|CRISPRCasFinder	2648272-2648302	31	NZ_CP039965	Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence	678684-678714	10	0.677

1. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to LR743532 (Xanthomonas phage Bosa genome assembly, chromosome: 1) position: , mismatch: 3, identity: 0.903

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggccaaggccgaagccaaggccc	Protospacer
****************** * *********

2. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MG018224 (Stenotrophomonas phage DLP4, complete genome) position: , mismatch: 3, identity: 0.903

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggccaaggccgacgccaaggccc	Protospacer
****************** *.*********

3. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MT664984 (Xanthomonas phage Xp12, complete genome) position: , mismatch: 3, identity: 0.903

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggccaaggccgaagccaaggccc	Protospacer
****************** * *********

4. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to KX898400 (Pseudomonas phage JG054, complete genome) position: , mismatch: 4, identity: 0.862

-tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
cttggcc-ctggtcttgcgcgggctgctgc	Protospacer
 * **** ******.**************.

5. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

gccgaca-aggccaaggcccatgccaaggcca	CRISPR spacer
-ccggcgcaggccaaggccaaggccaaggcca	Protospacer
 ***.*. *********** * **********

6. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 5, identity: 0.828

tgggcc---gctggtcctgcgcgggctgctgt	CRISPR spacer
---gccggagctgggcctgcgcgggctgctgc	Protospacer
   ***   ***** ****************.

7. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 6, identity: 0.806

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
cgcgacaaggccaaggcccgcgccaaggacg	Protospacer
  *****************..******* *.

8. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP010860 (Marinovum algicola DG 898 plasmid pMaD5, complete sequence) position: , mismatch: 6, identity: 0.806

gccgac-aaggccaaggcccatgccaaggcca	CRISPR spacer
-ctggcggaggccaaggcccatgccaatgccg	Protospacer
 *.*.* .******************* ***.

9. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MT740732 (Ralstonia phage Darius, complete genome) position: , mismatch: 6, identity: 0.806

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggcccaggccgatgccgtcgccg	Protospacer
************ ***** *****.  ***.

10. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MT361768 (Ralstonia phage RPZH6, complete genome) position: , mismatch: 6, identity: 0.806

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggcccaggccgatgccgtcgccg	Protospacer
************ ***** *****.  ***.

11. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MT740740 (Ralstonia phage Gervaise, complete genome) position: , mismatch: 6, identity: 0.806

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggcccaggccgatgccgtcgccg	Protospacer
************ ***** *****.  ***.

12. spacer 6.2|5704822|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggtttccgctcctgcgtgggttcccgc	CRISPR spacer
tccggctccgctcctgcgtcggttcccac	Protospacer
*  * .************* *******.*

13. spacer 6.2|5704822|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggtttccgctcctgcgtgggttcccgc	CRISPR spacer
tccggctccgctcctgcgtcggttcccac	Protospacer
*  * .************* *******.*

14. spacer 6.2|5704822|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggtttccgctcctgcgtgggttcccgc	CRISPR spacer
tccggctccgctcctgcgtcggttcccac	Protospacer
*  * .************* *******.*

15. spacer 6.2|5704822|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 6, identity: 0.793

tgggtttccgctcctgcgtgggttcccgc	CRISPR spacer
tccggctccgctcctgcgtcggttcccac	Protospacer
*  * .************* *******.*

16. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040720 (Rhodococcus pyridinivorans strain YF3 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tgggctgctggtcctgctcgggctgggcg	Protospacer
*****.*********** *******

17. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
agggccgctggtcctgccctggctgcccg	Protospacer
 **************** * ******.

18. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP035092 (Paracoccus denitrificans strain ATCC 19367 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggcc---gctggtcctgcgcgggctgctgt	CRISPR spacer
---gcccgagctgggcctgcgcgggctgctca	Protospacer
   ***   ***** ***************

19. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039697 (Novosphingobium sp. ABRDHK2 plasmid pABRDHK22, complete sequence) position: , mismatch: 6, identity: 0.793

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
ggtgtcgctggtcctgcgcgcgctgatga	Protospacer
 * *.*************** **** **

20. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_015146 (Pseudarthrobacter phenanthrenivorans Sphe3 plasmid pASPHE301, complete sequence) position: , mismatch: 6, identity: 0.793

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
gcgacggctggtcctgctcgggatgctgt	Protospacer
  *.* *********** **** ******

21. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_008688 (Paracoccus denitrificans PD1222 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

tgggcc---gctggtcctgcgcgggctgctgt	CRISPR spacer
---gcccgagctgggcctgcgcgggctgctca	Protospacer
   ***   ***** ***************

22. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
ctgaaggaagccaaggccatggccgcgcgca	Protospacer
* ***.*********** *******  *. *

23. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.774

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
ctgaaggaagccaaggccatggccgcgcgca	Protospacer
* ***.*********** *******  *. *

24. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 7, identity: 0.774

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
ctgaaggaagccaaggccatggccgcgcgca	Protospacer
* ***.*********** *******  *. *

25. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039454 (Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttccccctggtcctgcgcgggctggact	Protospacer
*   ** ******************   *

26. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_020261 (Cronobacter sakazakii SP291 plasmid pSP291-2, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttcccgctggttctgcgcgggctggact	Protospacer
*   ********.************   *

27. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
gtggacgctggtcatgcgcgggctggagg	Protospacer
  ** ******** ***********  *

28. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
cgacgcgctgttcctgcgcgcgctgctga	Protospacer
.*.  ***** ********* *******

29. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP045780 (Cronobacter sakazakii strain CFSAN068773 plasmid p2CFSAN068773, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttcccgctggttctgcgcgggctggact	Protospacer
*   ********.************   *

30. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034699 (Salmonella enterica subsp. enterica serovar Karamoja strain RSE40 plasmid pRSE40, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
ctttccgctggttctgcgcgggctggagt	Protospacer
.   ********.************  **

31. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_KY454639 (Klebsiella pneumoniae strain INF167 plasmid INF167_p0001, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttccccctggtcctgcgcgggctggact	Protospacer
*   ** ******************   *

32. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP012256 (Cronobacter sakazakii strain NCTC 8155 plasmid pCS3, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttcccgctggttctgcgcgggctggact	Protospacer
*   ********.************   *

33. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
gaagccgatggtgctgcgcgggctgccgg	Protospacer
 ..**** **** *************.*

34. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP015754 (Klebsiella pneumoniae strain W14 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttccccctggtcctgcgcgggctggact	Protospacer
*   ** ******************   *

35. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034710 (Salmonella enterica subsp. enterica serovar Karamoja strain RSE21 plasmid pRSE21, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
ctttccgctggttctgcgcgggctggagt	Protospacer
.   ********.************  **

36. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_019957 (Mycobacterium sp. JS623 plasmid pMYCSM01, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
agccgcgctgggcctgctcgggctgctgc	Protospacer
 *   ****** ***** **********.

37. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026161 (Klebsiella pneumoniae strain F93-1 plasmid pF93-1_1, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttccccctggtcctgcgcgggctggact	Protospacer
*   ** ******************   *

38. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016160 (Klebsiella pneumoniae strain TH1 isolate TH1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
tttccccctggtcctgcgcgggctggact	Protospacer
*   ** ******************   *

39. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NC_022772 (Salmonella phage Marshall, complete genome) position: , mismatch: 8, identity: 0.742

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
tataaagaagccaaggcgatagccgaagcag	Protospacer
.* *****************.*****   ..

40. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NC_049378 (Salmonella phage ST-W77, complete genome) position: , mismatch: 8, identity: 0.742

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
tataaagaagccaaggcgatagccgaagcag	Protospacer
.* *****************.*****   ..

41. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to KF669654 (Salmonella phage Maynard, complete genome) position: , mismatch: 8, identity: 0.742

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
tataaagaagccaaggcgatagccgaagcag	Protospacer
.* *****************.*****   ..

42. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.742

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
accagcgaagcaaaggcgctggccgaccagc	Protospacer
   *. ***** ****** ***********

43. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacaaggccgatgcccatgcccgttcgc	Protospacer
************.* ********* .  *

44. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NC_008383 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ggcgacaagggcaaggcccatgcccgccata	Protospacer
* ******** ************* .   .*

45. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ggcgacaagggcaaggcccatgcccgccata	Protospacer
* ******** ************* .   .*

46. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
atcgacaagcccaagccccatgccaaccgcc	Protospacer
..******* ***** **********   *

47. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NC_023285 (Streptomyces sp. F8 plasmid pFRL5, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ctggccaaggccaaggccgaggccaaggcgg	Protospacer
 . * ************* * ******** .

48. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP022670 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR5, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ggcgacaagggcaaggcccatgcccgccata	Protospacer
* ******** ************* .   .*

49. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MG757154 (Streptomyces phage Bing, complete genome) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
aaagtcaaggccaaggcccttgccaatgcac	Protospacer
.  * ************** ****** **

50. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP009803 (Streptomyces sp. FR-008 plasmid pSSFR1, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
tgctccaaggccaaggccaaggccaaggtcg	Protospacer
  *  ************* * *******.*.

51. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ggatcaaagaccaaggcccgtgccaaggcga	Protospacer
*     ***.*********.********* *

52. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP010825 (Thermus aquaticus Y51MC23 plasmid pTA69, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
cccgagaaggccaaggcccaggccctggagg	Protospacer
 **** ************** ***  **  .

53. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgaccaggcccaggcccatgcacgcctca	Protospacer
****** ***** **********  .  .**

54. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to MN310541 (Mycobacterium phage Jeeves, complete genome) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgataaggcccaggcccatgctctgctct	Protospacer
*****.****** **********.  * .*

55. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to KT898134 (Aeromonas phage phiARM81mr, complete genome) position: , mismatch: 8, identity: 0.742

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
agccgcgaggccgaggccaatgccaaggccg	Protospacer
. * .*.*****.***** ***********.

56. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_KT282968 (Escherichia coli strain EC012 plasmid pEC012, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

57. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032991 (Escherichia coli strain W2-5 plasmid p2_W2-5, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

58. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_KT990220 (Escherichia coli strain 42-2 plasmid p42-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

59. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP025081 (Klebsiella pneumoniae strain SGH10 plasmid pSGH10, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

60. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052163 (Klebsiella pneumoniae strain F16KP0082 plasmid pF16KP0082-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

61. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP014011 (Klebsiella pneumoniae subsp. pneumoniae strain RJF999 plasmid pRJF999, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

62. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP037743 (Klebsiella pneumoniae strain ST23 plasmid pDHQP1701672_hv, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

63. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052804 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S973 plasmid pN17S0973, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

64. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034201 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST383_NDM_OXA-48 plasmid pKpvST383L, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

65. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP038508 (Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

66. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052159 (Klebsiella pneumoniae strain F16KP0084 plasmid pF16KP0084-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

67. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MT035874 (Klebsiella pneumoniae strain KP18-3-8 plasmid pKP18-3-8_KPC_vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

68. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP053733 (Escherichia coli strain CP55_Sichuan plasmid pCP55-141k, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

69. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN543581 (Klebsiella pneumoniae strain PM48TC plasmid pPM48TC_fusion, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

70. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN543585 (Klebsiella pneumoniae strain GH27TC plasmid pGH27TC_fusion, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

71. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP033961 (Klebsiella pneumoniae strain L482 plasmid p2_L382, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

72. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052788 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0611 plasmid pN19S0611, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

73. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN543575 (Klebsiella pneumoniae strain GH44TC plasmid pGH44TC_fusion, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

74. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN543576 (Klebsiella pneumoniae strain GH44TC plasmid pGH44TC_vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

75. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP033955 (Klebsiella pneumoniae strain L39_2 plasmid p2_L39, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

76. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052432 (Klebsiella pneumoniae strain C16KP0122 plasmid pC16KP0122-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

77. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052144 (Klebsiella pneumoniae strain F17KP0012 plasmid pF17KP0012-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

78. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052363 (Klebsiella pneumoniae strain D16KP0122 plasmid pD16KP0122-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

79. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052786 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0641 plasmid pN19S0641, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

80. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052838 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S097 plasmid pN16S097, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

81. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP051676 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1234 plasmid pN16S1234, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

82. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347226 (Klebsiella pneumoniae strain K185 plasmid pK185_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

83. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347227 (Klebsiella pneumoniae strain K187 plasmid pK187_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

84. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347228 (Klebsiella pneumoniae strain K195 plasmid pK195_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

85. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347229 (Klebsiella pneumoniae strain K199 plasmid pK199_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

86. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347230 (Klebsiella pneumoniae strain K202 plasmid pK202_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

87. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347231 (Klebsiella pneumoniae strain K204 plasmid pK204_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

88. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347232 (Klebsiella pneumoniae strain K211 plasmid pK211_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

89. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347233 (Klebsiella pneumoniae strain K214 plasmid pK214_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

90. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347234 (Klebsiella pneumoniae strain K230 plasmid pK230_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

91. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347235 (Klebsiella pneumoniae strain K232 plasmid pK232_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

92. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347236 (Klebsiella pneumoniae strain K234 plasmid pK234_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

93. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347237 (Klebsiella pneumoniae strain K235 plasmid pK235_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

94. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK347238 (Klebsiella pneumoniae strain K239 plasmid pK239_rmpA2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

95. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034776 (Klebsiella pneumoniae strain 18CPO060 plasmid phvKP060, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

96. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052357 (Klebsiella pneumoniae strain D16KP0144 plasmid pD16KP0144-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

97. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052781 (Salmonella enterica strain CVM N19S0949 plasmid pN19S0949, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

98. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052834 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S041 plasmid pN17S0041, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

99. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP014009 (Klebsiella pneumoniae subsp. pneumoniae strain RJF293 plasmid pRJF293, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

100. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP053235 (Escherichia coli strain SCU-106 plasmid pSCU-106-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

101. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052793 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0388 plasmid pN19S0388, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

102. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052832 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1040 plasmid pN17S1040, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

103. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to LR134211 (Klebsiella aerogenes strain NCTC418 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

104. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP041374 (Klebsiella pneumoniae strain KP58 plasmid pKP58-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

105. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052232 (Klebsiella pneumoniae strain E17KP0033 plasmid pE17KP0033-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

106. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052830 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1105 plasmid pN17S1105, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

107. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040546 (Klebsiella pneumoniae strain CR-HvKP5 plasmid pCR-HvKP5-VIR, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

108. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP028791 (Klebsiella pneumoniae strain WCHKP020030 plasmid pOXA1_020030, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

109. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032241 (Klebsiella pneumoniae strain XJ-K2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

110. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to LN735558 (Escherichia coli plasmid pC193, complete sequence, strain C193) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

111. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to LN735559 (Escherichia coli plasmid pM105, complete sequence, strain M105) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

112. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to LN735560 (Escherichia coli plasmid pV408, complete sequence, strain V408) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

113. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to LN735561 (Escherichia coli plasmid pC271, complete sequence, strain C271) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

114. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039526 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

115. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052563 (Klebsiella pneumoniae strain A16KP0135 plasmid pA16KP0135-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

116. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP047193 (Klebsiella pneumoniae strain Kp36 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

117. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MF943217 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_WCHKP13F2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

118. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032164 (Klebsiella pneumoniae strain XJ-K1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

119. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034416 (Klebsiella pneumoniae strain C789 plasmid pVir-CR-hvKP-C789, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

120. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052190 (Klebsiella pneumoniae strain F16KP0019 plasmid pF16KP0019-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

121. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP030270 (Klebsiella pneumoniae subsp. pneumoniae strain SC-7 plasmid pSC7-vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

122. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

123. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP023723 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

124. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040540 (Klebsiella pneumoniae strain CR-HvKP4 plasmid pCR-HvKP4-VIR, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

125. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP045675 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

126. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026166 (Klebsiella pneumoniae strain F81 plasmid pF81_2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

127. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP025677 (Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

128. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052304 (Klebsiella pneumoniae strain E16KP0172 plasmid pE16KP0172-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

129. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052812 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S376 plasmid pN17S0376, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

130. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052204 (Klebsiella pneumoniae strain F16KP0002 plasmid pF16KP0002-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

131. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052810 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S535 plasmid pN17S0535, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

132. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052808 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S637 plasmid pN17S0637, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

133. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040595 (Klebsiella pneumoniae subsp. pneumoniae strain KpvST15_NDM plasmid pKpvST15, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

134. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034124 (Klebsiella pneumoniae strain BJCFK909 plasmid p1b1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

135. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP050724 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

136. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052178 (Klebsiella pneumoniae strain F16KP0045 plasmid pF16KP0045-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

137. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052806 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S816 plasmid pN17S0816, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

138. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP047572 (Escherichia coli strain 2EC1 plasmid p2EC1-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

139. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052791 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0552 plasmid pN17S0637, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

140. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052236 (Klebsiella pneumoniae strain E17KP0029 plasmid pE17KP0029-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

141. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052818 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1509 plasmid pN17S1509, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

142. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054751 (Klebsiella pneumoniae strain KP20194c3 plasmid pKP20194c3-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

143. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054781 (Klebsiella pneumoniae strain KP20194a plasmid pKP20194a-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

144. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP028390 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pVir_095132, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

145. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034054 (Klebsiella pneumoniae strain KP_NORM_BLD_2015_112126 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

146. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP034083 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

147. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054763 (Klebsiella pneumoniae strain KP20194b2 plasmid pKP20194b2-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

148. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP029383 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020079 plasmid pVir_020079, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

149. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

150. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

151. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026012 (Klebsiella pneumoniae strain K2044 plasmid pK2044, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

152. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026024 (Klebsiella pneumoniae strain 11420 plasmid p11420-HVKP, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

153. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054745 (Klebsiella pneumoniae strain KP20194c4 plasmid pKP20194c4-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

154. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054727 (Klebsiella pneumoniae strain KP20194e plasmid pKP20194e-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

155. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054739 (Klebsiella pneumoniae strain KP20194c5 plasmid pKP20194c5-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

156. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054775 (Klebsiella pneumoniae strain KP20194a2 plasmid pKP20194a2-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

157. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054733 (Klebsiella pneumoniae strain KP20194d plasmid pKP20194d-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

158. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054721 (Klebsiella pneumoniae strain KP20194f plasmid pKP20194f-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

159. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054757 (Klebsiella pneumoniae strain KP20194c plasmid pKP20194c-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

160. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054769 (Klebsiella pneumoniae strain KP20194b plasmid pKP20194b-p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

161. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP050276 (Klebsiella pneumoniae strain 10553 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

162. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK649822 (Klebsiella pneumoniae strain 2579 plasmid p2579_1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

163. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK649823 (Klebsiella pneumoniae strain BA6740 plasmid pBA6740_1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

164. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK649825 (Klebsiella pneumoniae strain BA813 plasmid pBA813_1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

165. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052259 (Klebsiella pneumoniae strain E16KP0290 plasmid pE16KP0290-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

166. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026587 (Klebsiella pneumoniae strain NUHL30457 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

167. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_LR745046 (Klebsiella pneumoniae isolate Kpn2166 plasmid pVIR_Kpn2166) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

168. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_LR745043 (Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 plasmid pVIR_Kpn154) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

169. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MK295820 (Escherichia coli O25b:H4-ST131 strain B28 plasmid pB28, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

170. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052495 (Klebsiella pneumoniae strain B17KP0067 plasmid pB17KP0067-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

171. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK413723 (Klebsiella pneumoniae strain 130721005 plasmid p721005-HI3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

172. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK413721 (Klebsiella pneumoniae strain 130504051 plasmid p504051-HI3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

173. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MN058044 (Klebsiella pneumoniae strain KP1677 plasmid pKP1677, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

174. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK673546 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

175. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP032356 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_Vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

176. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052799 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S990 plasmid pN17S0990-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

177. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MH263654 (Klebsiella pneumoniae strain QL24 plasmid pKPN-QL24, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

178. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MT090959 (Klebsiella pneumoniae strain KP18-2079 plasmid pKP18-2079_KPC, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

179. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197498 (Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

180. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197503 (Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

181. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197495 (Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

182. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MF398271 (Klebsiella pneumoniae subsp. pneumoniae strain 70-2 plasmid pKP70-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

183. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MF344575 (Escherichia coli strain 140611011 plasmid p11011-CTXM, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

184. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197502 (Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

185. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG545910 (Escherichia coli strain EC014 plasmid pEC014, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

186. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040534 (Klebsiella pneumoniae strain CR-HvKP1 plasmid pCR-HvKP1-VIR, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

187. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_KU321583 (Escherichia coli strain E80 plasmid pE80, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

188. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052795 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

189. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP010233 (Escherichia coli strain S30 plasmid B, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

190. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP031258 (Klebsiella quasipneumoniae strain L22 plasmid pL22-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

191. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP030924 (Klebsiella pneumoniae subsp. pneumoniae strain KC-Pl-HB1 plasmid pKC-Pl-HB1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

192. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP026022 (Klebsiella pneumoniae strain 11492 plasmid p11492-CTXM, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

193. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052802 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

194. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP019272 (Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

195. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN200128 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-Vir-RC, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

196. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

197. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052840 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S024 plasmid pN16S024, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

198. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP019049 (Klebsiella pneumoniae subsp. pneumoniae strain RJA166 plasmid pRJA166b, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

199. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP019248 (Escherichia coli strain Combat13F7 plasmid pCombat13F7-3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

200. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052783 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0679 plasmid pN19S0679-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

201. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052784 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0679 plasmid pN19S0679-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

202. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052836 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N16S103 plasmid pN16S103, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

203. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP024708 (Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

204. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_LR134257 (Klebsiella aerogenes strain NCTC9644 plasmid 4, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

205. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP027063 (Klebsiella variicola strain WCHKV030666 plasmid pVir_030666, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

206. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052779 (Salmonella enterica strain 19TN07GT06K-S plasmid pN19S1233, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

207. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_005249 (Klebsiella pneumoniae CG43 plasmid pLVPK, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

208. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052828 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1126 plasmid pN17S1126, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

209. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP036191 (Klebsiella pneumoniae strain BA34918 plasmid pvirulence_VBA34918, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

210. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_006625 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 plasmid pK2044, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

211. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052826 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1245 plasmid pN17S0637, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

212. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP019161 (Klebsiella pneumoniae strain GN-2 plasmid pGN-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

213. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016409 (Salmonella enterica subsp. enterica serovar Infantis strain FSIS1502916 plasmid pFSIS1502916, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

214. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP040726 (Klebsiella pneumoniae strain KpvST147B_SE1_1_NDM plasmid pKpvST147B_virulence, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

215. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052822 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1349 plasmid pN17S1349, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

216. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP050380 (Klebsiella pneumoniae strain 51015 plasmid p51015_NDM_1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

217. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP035906 (Klebsiella pneumoniae strain BA4656 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

218. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP017633 (Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

219. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016407 (Salmonella enterica subsp. enterica serovar Infantis strain FSIS1502169 plasmid pFSIS1502169, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

220. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052820 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1442 plasmid pN17S1442, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

221. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016413 (Salmonella enterica subsp. enterica serovar Infantis strain CVM44454 plasmid pCVM44454, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

222. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP047578 (Escherichia coli strain 94EC plasmid p94EC-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

223. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016411 (Salmonella enterica subsp. enterica serovar Infantis strain N55391 plasmid pN55391, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

224. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052816 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S1598 plasmid pN17S1598) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

225. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP047678 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVF1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

226. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP052814 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S349 plasmid pN17S0349, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

227. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP047676 (Klebsiella pneumoniae subsp. pneumoniae strain KUH-KPNHVL1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

228. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP030283 (Escherichia coli strain E308 plasmid pLKSZ02, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

229. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP052037 (Klebsiella pneumoniae strain KPN41053 plasmid pKPN41953, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

230. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP023135 (Klebsiella pneumoniae subsp. pneumoniae strain KpvK54 plasmid pKpvK54, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

231. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP031369 (Klebsiella pneumoniae strain KpvST101_OXA-48 plasmid pKpvST101, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

232. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP018338 (Klebsiella pneumoniae isolate Kp_Goe_154414 plasmid pKp_Goe_414-2, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

233. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to CP050281 (Klebsiella pneumoniae strain 9949 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

234. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_AP019549 (Klebsiella pneumoniae strain THC11 plasmid pTHC11-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

235. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP041024 (Klebsiella pneumoniae strain KP1692 plasmid pKP1692, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

236. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP024140 (Escherichia coli strain 14EC020 plasmid p14EC020b, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

237. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP054064 (Klebsiella pneumoniae strain WSHvKP plasmid pSWHvKp, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

238. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK715436 (Klebsiella pneumoniae subsp. pneumoniae strain SCNJ1 plasmid pVir-SCNJ1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

239. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK413722 (Klebsiella pneumoniae strain 332306 plasmid p332306-HI3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

240. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NC_017541 (Klebsiella pneumoniae KCTC 2242 plasmid pKCTC2242, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

241. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MH255829 (Klebsiella pneumoniae subsp. pneumoniae strain SH9 plasmid pSH9-CTX-TEM, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

242. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK191024 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-vir, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

243. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MH580302 (Escherichia coli strain 1107 plasmid p1107-118K, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

244. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MK079574 (Escherichia coli strain TS62CTX plasmid pHNTS62, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

245. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197488 (Escherichia coli strain 04NHB3 plasmid pHN04NHB3, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

246. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG197490 (Escherichia coli strain FKD271 plasmid pHNFKD271, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
atttcccctggtcctgcgcgggctggact	Protospacer
    ** ******************   *

247. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP016815 (Klebsiella pneumoniae strain ED23 plasmid unamed, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

248. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_MG053312 (Klebsiella pneumoniae strain KP267 plasmid pVir-CR-HvKP267, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

249. spacer 6.3|5704876|29|NZ_CP051685|CRISPRCasFinder matches to NZ_CP025462 (Klebsiella pneumoniae strain F44 plasmid p44-1, complete sequence) position: , mismatch: 8, identity: 0.724

tgggccgctggtcctgcgcgggctgctgt	CRISPR spacer
attccctctggtcctgcgcgggctgggct	Protospacer
    ** ******************   *

250. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

gccgacaaggccaaggcccatgccaaggcca------	CRISPR spacer
------caggccaaggccaaggccaaggccaaggcgg	Protospacer
       *********** * **********

251. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to KX557278 (Gordonia phage Ghobes, complete genome) position: , mismatch: 9, identity: 0.71

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ctgggtctggccaaggcccaggccaaggccg	Protospacer
 . *..  ************ *********.

252. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 9, identity: 0.71

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
gccgacacggccaaggccaatgcgcgcactg	Protospacer
******* ********** ****  . .*..

253. spacer 1.5|2648536|31|NZ_CP051685|CRISPRCasFinder matches to JQ691611 (Cronobacter phage CR9, complete genome) position: , mismatch: 9, identity: 0.71

gccgacaaggccaaggcccatgccaaggcca	CRISPR spacer
ctcgacaaggccaaggccgatgacatgaagc	Protospacer
 .**************** *** ** *.

254. spacer 1.1|2648272|31|NZ_CP051685|CRISPRCasFinder matches to NZ_CP039965 (Pseudorhodobacter sp. S12M18 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.677

cagaaagaagccaaggcgatggccgaccaga	CRISPR spacer
accaaaaaagccaaggagatggccgaggcag	Protospacer
   ***.********* *********   ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

996211 : 1008472

Moumouvirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169434243.1\|996211_998893_-	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	3.1e-22	25.5
WP_169434244.1\|999160_999625_-	DUF494 family protein	NA	NA	NA	NA
WP_169434245.1\|999721_1001074_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	3.8e-29	41.9
WP_169434246.1\|1001081_1002230_-	LysM peptidoglycan-binding domain-containing protein	G3MBQ1	Bacillus_virus	4.0e-11	57.8
WP_169434247.1\|1002216_1002363_-	hypothetical protein	NA	NA	NA	NA
WP_169434248.1\|1002535_1003075_+	peptide deformylase	E3SLL2	Synechococcus_phage	2.4e-19	41.1
WP_169434249.1\|1003089_1004040_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.4e-09	42.9
WP_169434250.1\|1004135_1004369_-	BrnA antitoxin family protein	NA	NA	NA	NA
WP_169434251.1\|1004707_1008472_+	methionine synthase	A0A140XBC7	Dickeya_phage	8.5e-10	56.2

DBSCAN-SWA_2

1842503 : 1914412

Tupanvirus(28.57%)

plate,tRNA,transposase,integrase

attL 1840250:1840268|attR 1923074:1923092

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1840250:1840268	attL	NA	NA	NA	NA
WP_169434925.1\|1842503_1844441_-\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_169434926.1\|1845234_1846005_-	TSUP family transporter	NA	NA	NA	NA
WP_169434927.1\|1846110_1846956_-	alpha/beta fold hydrolase	A0A2K9L3Q7	Tupanvirus	3.2e-05	35.6
WP_169434928.1\|1846985_1847987_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_169434929.1\|1848012_1848897_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
WP_170205330.1\|1848913_1850119_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_169434930.1\|1850183_1850948_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_169434931.1\|1850944_1851739_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.0e-14	25.1
WP_169434932.1\|1851773_1853429_-	GMC family oxidoreductase N-terminal domain-containing protein	A0A1V0S9J5	Catovirus	5.7e-51	29.0
WP_169434933.1\|1854639_1855212_-	hypothetical protein	NA	NA	NA	NA
WP_169434934.1\|1855327_1856125_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_169434935.1\|1856094_1857210_-	alanine dehydrogenase	NA	NA	NA	NA
WP_169434936.1\|1857350_1861007_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_169434937.1\|1861005_1861149_+	hypothetical protein	NA	NA	NA	NA
WP_169434938.1\|1861253_1861709_+	Lrp/AsnC ligand binding domain-containing protein	NA	NA	NA	NA
WP_169434939.1\|1861826_1862807_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_169434940.1\|1862959_1863259_+	hypothetical protein	NA	NA	NA	NA
WP_170205331.1\|1864127_1864718_-	chalcone isomerase family protein	NA	NA	NA	NA
WP_169434941.1\|1864920_1865508_-	DUF1003 domain-containing protein	NA	NA	NA	NA
WP_169434942.1\|1865636_1865894_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	2.4e-17	52.8
WP_169434943.1\|1865923_1866424_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	1.1e-29	44.7
WP_169434944.1\|1866558_1867197_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_169434945.1\|1867361_1868255_-	hypothetical protein	NA	NA	NA	NA
WP_169434946.1\|1868291_1869671_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L821	Tupanvirus	1.6e-27	32.6
WP_169434947.1\|1869881_1870361_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_169434948.1\|1870556_1872386_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.1e-156	49.2
WP_169434949.1\|1872843_1873821_+	AAA family ATPase	NA	NA	NA	NA
WP_169434950.1\|1873874_1876406_+	S8 family serine peptidase	NA	NA	NA	NA
WP_169434951.1\|1876534_1878070_-	TniQ family protein	NA	NA	NA	NA
WP_169434952.1\|1878109_1879552_-	AAA family ATPase	NA	NA	NA	NA
WP_169434953.1\|1879544_1880801_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_169434954.1\|1880794_1881718_-	hypothetical protein	NA	NA	NA	NA
WP_169434955.1\|1881719_1882568_-	TnsA endonuclease N-terminal domain-containing protein	NA	NA	NA	NA
WP_169434956.1\|1882887_1883343_-	hypothetical protein	NA	NA	NA	NA
WP_169434957.1\|1883398_1884388_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_169434958.1\|1884384_1885467_-	TniQ family protein	NA	NA	NA	NA
WP_169434959.1\|1885704_1887285_+	hypothetical protein	NA	NA	NA	NA
WP_169434960.1\|1887480_1888515_+	AAA family ATPase	NA	NA	NA	NA
WP_169434961.1\|1889722_1891276_+	hypothetical protein	NA	NA	NA	NA
WP_169434962.1\|1891236_1892454_+	hypothetical protein	NA	NA	NA	NA
WP_169434963.1\|1892648_1893107_+	hypothetical protein	NA	NA	NA	NA
WP_169434964.1\|1893204_1894185_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_169434965.1\|1894436_1898891_+	ATP-binding protein	NA	NA	NA	NA
WP_169434966.1\|1899373_1900525_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_169434967.1\|1901026_1901512_+	hypothetical protein	NA	NA	NA	NA
WP_169434968.1\|1901670_1901976_-	hypothetical protein	NA	NA	NA	NA
WP_169434969.1\|1902120_1903008_-	peptidase	NA	NA	NA	NA
WP_169434970.1\|1903017_1903854_-	transglutaminase family protein	NA	NA	NA	NA
WP_170205332.1\|1903855_1904809_-	alpha-E domain-containing protein	NA	NA	NA	NA
WP_169434971.1\|1904808_1906221_-	circularly permuted type 2 ATP-grasp protein	NA	NA	NA	NA
WP_169434972.1\|1906658_1908893_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_169434973.1\|1909073_1910786_-	tyrosinase family protein	NA	NA	NA	NA
WP_169434974.1\|1911003_1912101_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_169434975.1\|1912064_1913906_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_169434976.1\|1913908_1914412_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
1923074:1923092	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2800348 : 2809759

Burkholderia_virus(16.67%)

tRNA,integrase

attL 2794619:2794637|attR 2805033:2805051

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2794619:2794637	attL	NA	NA	NA	NA
WP_170202710.1\|2800348_2801599_-\|integrase	tyrosine-type recombinase/integrase	Q6J1Q2	Burkholderia_virus	2.2e-127	56.8
WP_170202711.1\|2801982_2803020_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	8.1e-96	54.0
WP_170202712.1\|2803186_2804248_-	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	1.2e-81	47.1
WP_170202713.1\|2804415_2805417_+	DNA-binding protein YbiB	A0A2H4JBY5	uncultured_Caudovirales_phage	2.0e-22	31.1
2805033:2805051	attR	NA	NA	NA	NA
WP_170202714.1\|2805668_2806880_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005665410.1\|2807018_2807231_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_170202715.1\|2807362_2807812_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	1.0e-23	45.2
WP_170202716.1\|2807956_2809759_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.9e-69	37.7

DBSCAN-SWA_4

3593171 : 3605593

Bacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170203274.1\|3593171_3595253_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.8e-76	29.7
WP_170203275.1\|3595362_3595968_+	toll/interleukin-1 receptor domain-containing protein	NA	NA	NA	NA
WP_170203276.1\|3595976_3597230_+	hypothetical protein	NA	NA	NA	NA
WP_170203277.1\|3597360_3598098_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.3e-63	54.9
WP_170203278.1\|3598139_3598991_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.8e-33	47.1
WP_170203279.1\|3599025_3600015_+	peptidoglycan DD-metalloendopeptidase family protein	Q9AZ52	Lactococcus_phage	8.2e-05	48.4
WP_170203280.1\|3600024_3601053_+	RNA polymerase sigma factor RpoS	A0A2I7SAT0	Vibrio_phage	3.9e-34	36.6
WP_170203281.1\|3601315_3602722_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	1.1e-26	26.7
WP_170203282.1\|3602932_3605593_-	GAF domain-containing protein	W8CYF6	Bacillus_phage	4.5e-21	29.5

DBSCAN-SWA_5

3747071 : 3756656

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170203399.1\|3747071_3748331_-	histidine kinase	Q9EYF3	Enterobacteria_phage	9.5e-14	26.2
WP_170205478.1\|3748599_3750063_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	4.6e-20	27.4
WP_170203400.1\|3750136_3750784_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	7.2e-42	43.5
WP_170203401.1\|3750968_3753317_+	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	1.3e-21	33.5
WP_170203402.1\|3753435_3755589_-	EAL domain-containing protein	NA	NA	NA	NA
WP_170203403.1\|3755684_3756068_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-13	35.6
WP_170203404.1\|3756233_3756656_+	DUF1810 domain-containing protein	A0A2H4UVK5	Bodo_saltans_virus	5.8e-08	39.4

DBSCAN-SWA_6

6212383 : 6220675

Azospirillum_phage(28.57%)

portal,terminase,protease,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170205138.1\|6212383_6213613_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	8.6e-44	34.2
WP_170205719.1\|6213609_6214464_-\|protease	Clp protease ClpP	A0A1S7FZ23	Listeria_phage	7.8e-36	39.2
WP_170205139.1\|6214629_6215853_-\|portal	phage portal protein	B0VK31	Azospirillum_phage	1.4e-65	39.8
WP_170205140.1\|6215852_6216029_-	hypothetical protein	NA	NA	NA	NA
WP_170205141.1\|6216028_6217705_-\|terminase	terminase large subunit	Q8W631	Enterobacteria_phage	4.4e-168	52.3
WP_170205142.1\|6217707_6218112_-	hypothetical protein	NA	NA	NA	NA
WP_170205143.1\|6218368_6218746_-	HNH endonuclease	G3EN93	Psychrobacter_phage	1.4e-13	44.1
WP_170205144.1\|6218794_6219238_-	hypothetical protein	NA	NA	NA	NA
WP_170205145.1\|6219314_6219467_-	hypothetical protein	NA	NA	NA	NA
WP_170205146.1\|6219475_6219787_-	hypothetical protein	NA	NA	NA	NA
WP_170205147.1\|6219783_6219975_-	hypothetical protein	NA	NA	NA	NA
WP_170205148.1\|6220116_6220371_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5NR91	Burkholderia_phage	1.0e-31	76.2
WP_170205149.1\|6220354_6220675_+	helix-turn-helix transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	1.8e-33	71.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP051686

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP051685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection