CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP050432	Acinetobacter baumannii strain PM194229 chromosome, complete genome	3 crisprs	cas3,DEDDh,WYL,csa3	7
NZ_CP050435	Acinetobacter baumannii strain PM194229 plasmid pPM194229_3, complete sequence	0 crisprs	NA	0
NZ_CP050433	Acinetobacter baumannii strain PM194229 plasmid pPM194229_1, complete sequence	0 crisprs	WYL	6
NZ_CP050434	Acinetobacter baumannii strain PM194229 plasmid pPM194229_2, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP050432_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050432_1

705588-705672

Orphan

Consensus_repeat	Method
TTTTAACTTTGGCGCAAGACAAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050432_1

>merge|NZ_CP050432|1|705588-705672|CRISPRCasFinder
TTTTAACTTTGGCGCAAGACAAGCAGTGAAACTGCGCGTAGAGTAAAGAAGATTGATAATCTTTTAATTTTGGCGCAAGACAAGC

>NZ_CP050432|1|1|705588-705672|CRISPRCasFinder
TTTTAACTTTGGCGCAAGACAAGC	AGTGAAACTGCGCGTAGAGTAAAGAAGATTGATAATC
TTTTAATTTTGGCGCAAGACAAGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050432.1\|WP_000490937.1\|716749_716890_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050432.1\|WP_015451615.1\|702233_702662_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050432.1\|WP_001047593.1\|715148_715853_-\|nitroreductase	unknown	unknown	gnl\|CDD\|380313
NZ_CP050432.1\|WP_163071897.1\|704188_705109_-\|DUF1853-family-protein	unknown	unknown	gnl\|CDD\|378094
NZ_CP050432.1\|WP_002037080.1\|716363_716567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050432.1\|WP_000003701.1\|713906_715121_+\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP050432.1\|WP_001259501.1\|705213_705582_+\|YbaN-family-protein	unknown	unknown	gnl\|CDD\|377291
NZ_CP050432.1\|WP_001016575.1\|702697_703834_-\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
NZ_CP050432.1\|WP_000473032.1\|708224_710771_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|99797
NZ_CP050432.1\|WP_001198164.1\|707312_708098_-\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
NZ_CP050432.1\|WP_000125649.1\|710928_711504_-\|SdpI-family-protein	unknown	unknown	gnl\|CDD\|379303
NZ_CP050432.1\|WP_001984830.1\|711604_713779_-\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
NZ_CP050432.1\|WP_005119701.1\|697680_702201_+\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|223716
NZ_CP050432.1\|WP_001005337.1\|716989_718465_+\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP050432.1\|WP_000101096.1\|694449_694812_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP050432.1\|WP_001984826.1\|703959_704103_-\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|227797
NZ_CP050432.1\|WP_000505932.1\|695455_697534_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|214599
NZ_CP050432.1\|WP_000729762.1\|694872_695409_+\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
NZ_CP050432.1\|WP_000389061.1\|694042_694426_+\|response-regulator	unknown	unknown	gnl\|CDD\|381093
NZ_CP050432.1\|WP_000077301.1\|705732_706236_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130

Protein	Function_ID	Function_description	E-value
NZ_CP050432.1\|WP_000125649.1\|710928_711504_-\|SdpI-family-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	0.00838382
NZ_CP050432.1\|WP_001047593.1\|715148_715853_-\|nitroreductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.03168e-34
NZ_CP050432.1\|WP_163071897.1\|704188_705109_-\|DUF1853-family-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	6.27855e-40
NZ_CP050432.1\|WP_000003701.1\|713906_715121_+\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.41627e-94
NZ_CP050432.1\|WP_001259501.1\|705213_705582_+\|YbaN-family-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	4.46882e-39
NZ_CP050432.1\|WP_001016575.1\|702697_703834_-\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
NZ_CP050432.1\|WP_000473032.1\|708224_710771_-\|PepSY-domain-containing-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	4.52302e-132
NZ_CP050432.1\|WP_001198164.1\|707312_708098_-\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.40229e-39
NZ_CP050432.1\|WP_001984830.1\|711604_713779_-\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
NZ_CP050432.1\|WP_005119701.1\|697680_702201_+\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	1.23501e-116
NZ_CP050432.1\|WP_001005337.1\|716989_718465_+\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
NZ_CP050432.1\|WP_000101096.1\|694449_694812_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.79368e-36
NZ_CP050432.1\|WP_001984826.1\|703959_704103_-\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	4.44613e-07
NZ_CP050432.1\|WP_000505932.1\|695455_697534_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|214599	smart00283, MA, Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer). Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.	6.1217e-71
NZ_CP050432.1\|WP_000729762.1\|694872_695409_+\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	2.92747e-31
NZ_CP050432.1\|WP_000389061.1\|694042_694426_+\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.27194e-36
NZ_CP050432.1\|WP_000077301.1\|705732_706236_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	8.56335e-26

>NZ_CP050432.1|WP_001259501.1|705213_705582_+|YbaN-family-protein
MRTLFWRTLVVIFITLGIIGAILPGMPTTVFLILAAWAASKGWPQMDAWLLNHPKYGPTLRDWRANGTVPRKAKWIATIMMTASGILMLFTSAPFWVKVFTDTTMLVVAIWLWLRPEPKLKD
>NZ_CP050432.1|WP_163071897.1|704188_705109_-|DUF1853-family-protein
MNIASIKTSYFEPWLQFSHPMVRQLAFTIASPNLLSQLPCSLTIRHSFQLHTDKNWEQHFQNYLPRLKQLDEAPEPLLQFMSRLKSTRLGLRFENLLWFWLQEDQYHPYQLLGHSIQKIDGAKTLGELDFLVLNQNTQEIEHWEVALKYYLGEGQLNLEQWSGLNRQDTLSKKLYHFTDKQFQFSEALGFKVQQRFAVLKGQLYLPLNLPQEQPIPEWVNLKRRLGTWGTEIPKSDFYRLERHEWLCPHQKASSNTAYWWTDGLYCQNINETRFYMFRHPALLSLKPSLIKITVFYKRPRPYRNNL
>NZ_CP050432.1|WP_001984826.1|703959_704103_-|entericidin-A/B-family-lipoprotein
MMKKVLVASVMVAFVLTGCNTFKGFGQDVSKAGDAVTNTAQKTENKM
>NZ_CP050432.1|WP_001016575.1|702697_703834_-|succinyl-diaminopimelate-desuccinylase
MNHSDTLSLSLELLQQPSVTPIDHTCQTIMADRLAKVGFHIEPMRFGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKNPNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLAQ
>NZ_CP050432.1|WP_015451615.1|702233_702662_+|hypothetical-protein
MDQQELQHLITVSTGFIDAYIIECNDQVPMLLPQNIVLSAMDVKNGVKHIEWHDVKLPVYSVHNAIDQHAVALVIEGEDISQRFALICKTMPVSTRLRISEIVDEMDEHEAEQHPAVFKYVRMQHQRYYIPNLEYIEKTLGL
>NZ_CP050432.1|WP_005119701.1|697680_702201_+|hybrid-sensor-histidine-kinase/response-regulator
MKEILKTLTEAMTLPEDSYSEQDAEFLEIFIEEIEEIFVDLQPLINKWMQSENIATLTEIRRHFHTLKGSGRMIGAKSSAELAWAVEDTLNRVINQSLQLTPTIQSYVQLVFKFYFLKLVDNFKQKRAHTLDFRPLILLGQQLQQQQSLEPALEELLQLSNTLMAETVTGLELDYIEQDSLAEPIIQATHTEIEINLDETLTLFMEEAEEHLATIHQFLDQELHQYDSYNALIRALHTLRGSSAMAQVETIFEASTKVEHLFKILLQEELSSHSEEILLLQEYREFVRDSLELLSRYSSSEQLEARLQQFNQSWDAYVEQHGDRTDPLMPSHGLVSQLLQLDVSELLDAELDFEKGIRNEFPDYLERLSEQADLLLQHTHSQAMLGLHEYTSQLKESYEVLLDKPTLLQSDYIFEIYQKAHQQLIQLFDALAAGQRVGVVKQHQSILEELKLYTQYTPDLSNDLPQQDSTSFEPISNIEQEPEVVATVENFSDSVDWAVLGQSVQQDRQYISSTQVNRNFDADLLDIFLEEAEELLEGIDTDLNIWVGEQENFAALNNLMRYLHTLKGGANMVQATYLGLIAHELESIYERLIQKQLVATSDLIDFIRLVQDDLADRLQIMREQQLDYAAPYTINALKRAGQNSNFQPLPVVEAFDTESEIFSEQEVISEVIIDEIPVELEPALAELETHHDQVFDTAVTELATPVEMITTVTSQESEIAADEQDIEAVVEQTFLEEATELLEMAESLLKQWFEQRTNRSILLQLQRAVHSLKGGARMVGLEAVQAIAYQLENAFEQFALHHFNSNIYDHLLESAIAWLKDAIFNHNYQHFDGLQQSLENIQFFETTIQIPTKLTRADLFNSEPVMTFIQGDGTEPPPMMGAWEQTERLDQNNEMIRVSADLIEKMIDLSGENSINRSRIEMDLSQFSHTLVEMELAIQRLADQLRRMEGELETQIIAKHGIEHSRYTDFDPLEMDQYSSLNQLSKSLAESASDLVDFKNTLSDKIRDTESLLLQQSRIQAEIQEGLMRTRLVPFSRLLPRLQRIVRQTSTALNRPAELFVNNTEGELDRNILERLVTPLEHMLRNAIDHGLEDRMQRQQANKPETGRIELNIQRQGTDVVVVFSDDGQGIDVEKVRQKALLAGLIKPEQDLEQQDILQLIFHPGLSTAEQVTQISGRGVGLDVVQSDIKSLGGHVSVESIYGQGTTFTIRVPTTVAVSDALMVKVADQQFAIPLAQIDRIIRVSPASLEQYFESPQELFEYENKRYPLRYLSEFVGNQPIPRLNGVMYSLPVLMIKANNGQTVALLVDQLIGSRAQIVVKPIGQQFSSIGAIAGATILGDGQVCLILDGQNIARQIQSTQRHKQLSEAIYRQRESDERRLIMIVDDSVTVRKVTSRLLERQGYDVVTAKDGVDAIEQLENIKPDLMLLDIEMPRMDGFEVLNLVRHHDMHQYMPIIMITSRTGEKHRERAFSLGVSQYMGKPFQEEELLENIDALLVASDSEVKS
>NZ_CP050432.1|WP_000505932.1|695455_697534_+|methyl-accepting-chemotaxis-protein
MGFKLKKKSGNRGATGKSSVNFIAKIQSKIEQFASLFGESEKSKPILYAALLCLVCALISLAYLFYNVPRHNQLIRSLGELRLLSQTISKQATEATESGSQEAITKLQQSKKDFDENLLEIENIHGKSTDEYQKVEKIWGEVSKNIDLISSHQRVLNQLYDTNISISETVPEIQAEYNLMVDQMARQGLPSSQVIIAKNQVFIAERILRSINSVLSGTDGNVSTSDFSVDIETFGTYLNAELNGNAELGVDRIADPALRESLESIKSEYDKVLKSAAATVLKNGSQIVNVRQASSQIFSKSDVMLESLGHLSDVARKNWLTLFLGAVLILSLSGLIFSVFKLITLRSVMDKKRVARLQEEYDRNQNAILRLLDEIADLADGDLRSYATVSEDFTGAIADSINFAIDQLRDLVSRIHETSQEVARYTQDTQSITNQLAEASEHQAQEIAGASTAMNEMAQSIDQVSANASESAEVAQRSVQIASNGAQVVNRSIEGMDTIREQIQETSKRIKRLGESSQEIGNIVSLINDIADQTNILALNAAIQASMAGEAGRGFAVVADEVQRLAERSASATKQIETLVKTIQTDTNEAVISMEQTTTEVVRGANLAKDAGIALDEIQKVSGDLAKLIASISDAAKLQSASASHIATTMTVVQEITSQTTTATFDTARSVSELANMAESLRESVTDFKLPD
>NZ_CP050432.1|WP_000729762.1|694872_695409_+|purine-binding-chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKNYASVQNEAQRWSGIAFEMRGQYFVAPLGEVSEVIYPPKYTPVPNTQSWVKGLANIRGRLLSVSDLAHFISGQRSSFSSTQKVLCISHHDQYVGLVVDQVLGIQHFNKKSFFSQSSDLEENLKEYCQGYFHQHNQHWHVFLFSRLLQNPHYMNASTKFIN
>NZ_CP050432.1|WP_000101096.1|694449_694812_+|response-regulator
MARILIVDDSPTETFRFKEILTKHGYDVLEASNGADGVTLAKAEQPDLVLMDVVMPGVNGFQATRQITRDEDTKHIPVVIVSTKDQATDRVWGKRQGAIDYLIKPIEEKQLIDVIKQFLN
>NZ_CP050432.1|WP_000389061.1|694042_694426_+|response-regulator
MEDAFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALSKIAEANPDIVFVDIMMPRLDGYQTCALIKNSQNYQNIPVIMLSSKDGLFDQAKGRVVGSDEYLTKPFSKDELLNAIRNHVSS
>NZ_CP050432.1|WP_000077301.1|705732_706236_+|L,D-transpeptidase
MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTGKTPRGWHRVAKKFGMQSPKNAVFIARQPTGEVYSSELAAQFPERDWILSRILWLDGLEEGFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSEQSLT
>NZ_CP050432.1|WP_001198164.1|707312_708098_-|YdcF-family-protein
MQVSKWIRIFLAVIGSILFLDGLFLAFLNKIHVGTLVPLVLGAFFCLYALFYYHLERFFFYHYRLHTLWRFGWLCFWIWLIGLGYFFNFIKENKDASQNLPAVKAIIVLGSGVENGQPSAILAKRLDTAAPVALSQPQAKVILTGGLDFSEKEPEALVMSRYLEQHFHIAKDRMILEDKSTSTELNLKNSKPLLEQAHISINQPIAIVTSDFHTPRAAAIAKKQGYTQVYMVAAETPLITRYNVWLREYFAYASGWLLNEY
>NZ_CP050432.1|WP_000473032.1|708224_710771_-|PepSY-domain-containing-protein
MFKKFLFQIHWFLGISAGLILSIMGVTGAIYSYDQQILKWVNTDSYVVQAQSSPKLTPAQLYQHFTTIQPEIKINSITIAKDPTASSVVNIEKEGERRGYNMMVNPYTAQVLPEVQGRKLLLLIQQIHRNLTAGEFGKQITGACALMLIYFVLSGLYLRWPKKHSARQWLALKPKLKGRNFIWDLHAVVGTWVIVFYLLFACTGLYWSYDWWRSGMFKVLGVEQPKMQGHSGSGRNKDQLPKIQLDNAQLITALNQTWSGFNNQIGRDYSTLTVNLPKKDDGKIELSFVDATPQHERARNQAVYNYKTANIEKMELYEDKKLNQKIMSSMLPVHRGSFFGPVYQFVAMLASLAMPLFFVTGWMLYLKRRKQKKLTQAARQSLAGHYIDQNAKPWLITYATQTGVAEQLAWSTATSLQEAHQPVQVKSVQQLTEADLQQHEQILFVISTYGTGEAPDLASNFAKKLLKTNLELQHVKYAVLALGSKEYPDTYCSFGYTVDEWLKNNGAKALFDIIEVDNANPADIQNWNQALVKATKLDLHAVNIEKVFDNWTLQQRDLLNPNSLGQPAYNIELTASHEAVWQAGDIAEIQPGNSPERINKFLQHHHILKNAVVDSLQVSIEKALWNKDLTGEIEPFANLDHLLEQLPTLPTREYSIASIPSQQVLRLVVRQQYDESGDLGLGSGWLTQHTEINQNVALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLHTRTRHNYTENWLIFGERQRAHDFFYASTIEAWQTMGMLKRLDLAFSRDQEQRVYVQDIIRQNAAELVNWIERGAVLYVCGSIDGMASGVDQALIHILGEEQVDELRQQGRYRRDVY
>NZ_CP050432.1|WP_000125649.1|710928_711504_-|SdpI-family-protein
MTAKTLYAYTLQPVPYEVSEAEQRNAQLLIWRSTNKISTKIWAIMGVILALAILGLIFIKNYSTVICWVAIVCVVLYYLGRKYGLEWYVKRKMNEFPVQEIKGIRLGVQPHGIVMRQQMGLQEGVGTIGWKNIYEWYNTPDFILVNFKVKDPKGQEQQGAYILPKRMDSKNFSFNTIRKHLKESVGEPKTL
>NZ_CP050432.1|WP_001984830.1|711604_713779_-|TIGR01666-family-membrane-protein
MKSWFKRLKRATYNTSFMYNVRMLIAFSGTAFVPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFFITAASVQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFDQWYIQPALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMTPASYQQSMIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERADSAHIDYQKLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFENLRLSLVKLRDDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKDDDLKGWNDIVVRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFVSQPNFNATKRRLRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYAQATAFITILALINFNLDGSAVAAAIPRFVDTLIGCALAWFGVTFIWPDWKFRRLPRSIRRSLQAQCNYLAEVVKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRKSDIFEFLCLNHTFLSYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQNMLQTIRQRLSQNDEDDQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL
>NZ_CP050432.1|WP_000003701.1|713906_715121_+|multidrug-effflux-MFS-transporter
MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGVSTQMVANTLPAYFFGLAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSLIAARILQALGGCVGVVMARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIWFPWQAIFIALSIVGAICWLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPMFAGCLTGAALFCYISSAPAVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEITKRLKAGSMVQVTGASIVLIAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQGARAGTASAIMGSMQFACGLLGGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAKSQSLS
>NZ_CP050432.1|WP_001047593.1|715148_715853_-|nitroreductase
MNLEQVRLVDEAITSRHSVRAFLSTPIEPEVIKDILRVASRAPSGTNTQPWKVYVVTGHKRDEMVERVCAAQIEVSKNPELAEQYKETFAYYPEKWVSPFIDRRRENGWGLYGLLDIKKGEKEKMAAQQLRNFKLFDAPVGIFFTVNKAMGIGSKMDIAMMIQNVMVAAKARGLDTCPQAAWNHFHPLVLDILGAADDEELVCAIALGHADPEHIVNTFITPREPVENFAVFLD
>NZ_CP050432.1|WP_002037080.1|716363_716567_+|hypothetical-protein
MSLPLINKQFMKQGLAITIVTMKMNVTHATTEPQEIQQLGTDLNALFFNEKEKGTDSRVMTMACYSL
>NZ_CP050432.1|WP_000490937.1|716749_716890_+|hypothetical-protein
MFSGAMNLFYLKGAFSHVTFKGLVLGMMLLKLVTVIAIQVTLKVFP
>NZ_CP050432.1|WP_001005337.1|716989_718465_+|alanine:cation-symporter-family-protein
MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIRMFLQSIRVMKSSRTEGEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWMWVTAVLGMSSAFIESTLAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFTYGFVFNSVQINAIANASSHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIKRIAKFAEMFVPLKAGLYLSVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVSMAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIIILVSGVYQDAGFVGVELTQRALETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFINNNPKVMFIFRIFVLVMVYFGAIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLLKDYRAQLKQGIKEPVFKINKYPELKKKVDSDIW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050432_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050432_2

1688073-1688217

Orphan

Consensus_repeat	Method
CTAAAGCTTTGGCGAAGCGCAAGATGAACATAGTTATGGTTAATTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050432_2

>merge|NZ_CP050432|2|1688073-1688217|CRISPRCasFinder
CTAAAGCTTTGGCGAAGCGCAAGATGAACATAGTTATGGTTAATTTGTATTGAACTTTTTACAGGTATAAAAAAACGCCACCTGAGCAAGACAAAGCGGCTAAAGCTTTGGCGAAGCGCGAGATGAACATAGTTATGGTTAATTT

>NZ_CP050432|2|2|1688073-1688217|CRISPRCasFinder
CTAAAGCTTTGGCGAAGCGCAAGATGAACATAGTTATGGTTAATTT	GTATTGAACTTTTTACAGGTATAAAAAAACGCCACCTGAGCAAGACAAAGCGG
CTAAAGCTTTGGCGAAGCGCGAGATGAACATAGTTATGGTTAATTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050432.1\|WP_000270276.1\|1693308_1693410_-\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
NZ_CP050432.1\|WP_085916945.1\|1693008_1693308_-\|cyd-operon-YbgE-family-protein	unknown	unknown	gnl\|CDD\|370577
NZ_CP050432.1\|WP_000838061.1\|1679241_1679661_-\|heme-binding-protein	unknown	unknown	gnl\|CDD\|225734
NZ_CP050432.1\|WP_000575163.1\|1693423_1694569_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
NZ_CP050432.1\|WP_077163451.1\|1687457_1687790_-\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
NZ_CP050432.1\|WP_001187342.1\|1689610_1690717_+\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
NZ_CP050432.1\|WP_000138830.1\|1685057_1685399_-\|Grx4-family-monothiol-glutaredoxin	unknown	unknown	gnl\|CDD\|188046
NZ_CP050432.1\|WP_085947913.1\|1681239_1682330_+\|IS4-family-transposase-ISAba1	unknown	unknown	gnl\|CDD\|376573
NZ_CP050432.1\|WP_000593796.1\|1692471_1692996_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP050432.1\|WP_000622643.1\|1694565_1696152_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|185052
NZ_CP050432.1\|WP_000102943.1\|1690905_1691502_+\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|226090
NZ_CP050432.1\|WP_000954523.1\|1683541_1684444_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
NZ_CP050432.1\|WP_000955081.1\|1689176_1689503_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050432.1\|WP_000121851.1\|1684687_1685011_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273177
NZ_CP050432.1\|WP_000156920.1\|1686885_1687317_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391
NZ_CP050432.1\|WP_001202783.1\|1682695_1683490_+\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
NZ_CP050432.1\|WP_000616034.1\|1688267_1688501_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP050432.1\|WP_163071910.1\|1679852_1681154_-\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331
NZ_CP050432.1\|WP_000129939.1\|1685626_1686835_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056
NZ_CP050432.1\|WP_000185571.1\|1688716_1689076_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP050432.1\|WP_085916945.1\|1693008_1693308_-\|cyd-operon-YbgE-family-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
NZ_CP050432.1\|WP_000838061.1\|1679241_1679661_-\|heme-binding-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	2.71548e-31
NZ_CP050432.1\|WP_000575163.1\|1693423_1694569_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	3.94189e-149
NZ_CP050432.1\|WP_000593796.1\|1692471_1692996_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.08011e-05
NZ_CP050432.1\|WP_001187342.1\|1689610_1690717_+\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	8.49853e-180
NZ_CP050432.1\|WP_000138830.1\|1685057_1685399_-\|Grx4-family-monothiol-glutaredoxin	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
NZ_CP050432.1\|WP_085947913.1\|1681239_1682330_+\|IS4-family-transposase-ISAba1	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	4.70622e-10
NZ_CP050432.1\|WP_000622643.1\|1694565_1696152_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|185052	PRK15097, PRK15097, cytochrome bd-I ubiquinol oxidase subunit CydA.	0
NZ_CP050432.1\|WP_000102943.1\|1690905_1691502_+\|nitroreductase-family-protein	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
NZ_CP050432.1\|WP_000954523.1\|1683541_1684444_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.44498e-97
NZ_CP050432.1\|WP_000121851.1\|1684687_1685011_+\|hypothetical-protein	gnl\|CDD\|273177	TIGR00617, Replication_protein_A_70_kDa_DNA-binding_subunit, replication factor-a protein 1 (rpa1). All proteins in this family for which functions are known are part of a multiprotein complex made up of homologs of RPA1, RPA2 and RPA3 that bind ssDNA and function in the recognition of DNA damage for nucleotide excision repairThis family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair].	0.00742828
NZ_CP050432.1\|WP_000156920.1\|1686885_1687317_-\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56
NZ_CP050432.1\|WP_001202783.1\|1682695_1683490_+\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	4.40373e-150
NZ_CP050432.1\|WP_077163451.1\|1687457_1687790_-\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	1.42209e-20
NZ_CP050432.1\|WP_163071910.1\|1679852_1681154_-\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	4.59766e-170
NZ_CP050432.1\|WP_000129939.1\|1685626_1686835_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0
NZ_CP050432.1\|WP_000270276.1\|1693308_1693410_-\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06

>NZ_CP050432.1|WP_077163451.1|1687457_1687790_-|DUF2750-domain-containing-protein
MIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>NZ_CP050432.1|WP_000156920.1|1686885_1687317_-|CBS-domain-containing-protein
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>NZ_CP050432.1|WP_000129939.1|1685626_1686835_+|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYAQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTQQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEGFIRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQNCNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENAAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGIQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>NZ_CP050432.1|WP_000138830.1|1685057_1685399_-|Grx4-family-monothiol-glutaredoxin
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>NZ_CP050432.1|WP_000121851.1|1684687_1685011_+|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEQVMNQNVDELHEDPNMNIFDAITTTPYKNLTILKADLGVDGLFRYVGISVC
>NZ_CP050432.1|WP_000954523.1|1683541_1684444_-|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVRLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>NZ_CP050432.1|WP_001202783.1|1682695_1683490_+|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHVVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>NZ_CP050432.1|WP_085947913.1|1681239_1682330_+|IS4-family-transposase-ISAba1
MTHLNELYLILNKSLKWNKSHLKCFALIMLVIILKQTCNLSSASKALPIKCLPQSFYRRMQRFFAGQYFDYRQISQLIFNMFSFDQVQLTLDRTNWKWGKRNINILMLAIVYRGIAIPILWTLLNKRGNSDTKERIALIQRFIAIFGKDRIVNVFADREFIGEQWFTWLIEQDINFCIRVKKNFIVTNHLGKNHKISDLFRHLKVGQIECRKRRILVGRVKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLFSCLKGRGFNLENTRLTDPRRVKKLIAVLAISFCWCYLTGEWQHDQKKAIKIKKHGRLSMSLFRYGLDYVQMAIQRLIGFGKKEEFKEILAILRRQNPDRIRVL
>NZ_CP050432.1|WP_163071910.1|1679852_1681154_-|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFTTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPTPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACIVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>NZ_CP050432.1|WP_000838061.1|1679241_1679661_-|heme-binding-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQCS
>NZ_CP050432.1|WP_000616034.1|1688267_1688501_-|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>NZ_CP050432.1|WP_000185571.1|1688716_1689076_+|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>NZ_CP050432.1|WP_000955081.1|1689176_1689503_+|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLGPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHNHIKQYPALAQEDTQ
>NZ_CP050432.1|WP_001187342.1|1689610_1690717_+|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEAAPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETEK
>NZ_CP050432.1|WP_000102943.1|1690905_1691502_+|nitroreductase-family-protein
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>NZ_CP050432.1|WP_000593796.1|1692471_1692996_+|GNAT-family-N-acetyltransferase
MIKLNFRLAEFSDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRCVLEYAEQFALHKVPELDSAIMYVLNVRSELIAYYERRGYIKTGNHEPYPLDANVGLPLIPIKLIEMKKDLK
>NZ_CP050432.1|WP_085916945.1|1693008_1693308_-|cyd-operon-YbgE-family-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>NZ_CP050432.1|WP_000270276.1|1693308_1693410_-|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>NZ_CP050432.1|WP_000575163.1|1693423_1694569_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYSVAFSGMYWALLLVLFALFLRPVGFDYRSKLENTQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFFALLNPFALVCGIVSLSMLCAHGGAWLMLRTDGALKQRSAKATQIMAAIFLVCFLVIGAWLYFGQVPGYSYAAAVDPNAALNPLAKEVVTNNNPGWMNNYSSYPITKVAPVLAILGAIIAFFTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>NZ_CP050432.1|WP_000622643.1|1694565_1696152_-|cytochrome-ubiquinol-oxidase-subunit-I
MISESVVDLSRFQFAMTAMYHFLFVPLTLGLAFILAIMETTYVISGKEIYKDMTKFWGKLFGINFALGVTTGLTMEFQFGTNWAYYSHYVGDIFGAPLAIEGLMAFFLESTFIGLFFFGWDRLSKVQHLGVTWLVALGSNMSALWILVANGWMQNPVGAAFNFETMRMELVDFGALIFNPVAQVKFVHTVSAGYVTGAIFVLAISSYYLLKKRDLPFARRSFAIAAIFGLASTLSVILLGDESGYELGDVQKTKLAAIEAEWDTHPAPAPFTLFGVPNHEEMRTDYAVKIPYALGLIATRSTTKEVTGLKDLMQQHEVRIRNGMLAYAELEKLRAGDRSPELLASFEKNQKDLGYGLLLKKYAPNVVDASEQHIQAAVKDTIPNVTALFFSFRAMVASGFLMLLLFILATWAVAKRNAENKPWLLKYALFALPLPWIAAQTGWYVAEGGRQPWSIGEILPTHLSASSLITGDVWGSILALAAFYTVLLIIEMYLMIKFARLGPSSLHTGKYHFEKQEPKAAVNGEALS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP050432_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP050432_3

1957999-1958100

Orphan

Consensus_repeat	Method
CAAACCATTGCTTTGTTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP050432_3

>merge|NZ_CP050432|3|1957999-1958100|CRISPRCasFinder
CAAACCATTGCTTTGTTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAGTCGCTTCTCAGGACAAAGCATTGCTTTGTTTATCCTC

>NZ_CP050432|3|3|1957999-1958100|CRISPRCasFinder
CAAACCATTGCTTTGTTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAGTCGCTTCTCAGGA
CAAAGCATTGCTTTGTTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP050432.1\|WP_000637000.1\|1961985_1962897_+\|bestrophin	unknown	unknown	gnl\|CDD\|376448
NZ_CP050432.1\|WP_000448778.1\|1948745_1950479_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|181346
NZ_CP050432.1\|WP_001177517.1\|1968828_1969791_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
NZ_CP050432.1\|WP_000331400.1\|1954021_1954876_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
NZ_CP050432.1\|WP_000080821.1\|1950507_1951251_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
NZ_CP050432.1\|WP_163071866.1\|1959757_1960453_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
NZ_CP050432.1\|WP_001271394.1\|1964844_1966248_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
NZ_CP050432.1\|WP_000238436.1\|1964032_1964818_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
NZ_CP050432.1\|WP_001133053.1\|1967795_1968815_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
NZ_CP050432.1\|WP_000925651.1\|1957106_1957898_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP050432.1\|WP_001023744.1\|1955042_1955960_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP050432.1\|WP_001096433.1\|1960644_1961916_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP050432.1\|WP_000364551.1\|1970155_1971142_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
NZ_CP050432.1\|WP_004835232.1\|1953629_1954025_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP050432.1\|WP_000771644.1\|1952925_1953534_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|234675
NZ_CP050432.1\|WP_000822394.1\|1955992_1956997_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|168683
NZ_CP050432.1\|WP_001289733.1\|1966258_1967794_-\|2-oxo-acid-dehydrogenase-subunit-E2	unknown	unknown	gnl\|CDD\|273567
NZ_CP050432.1\|WP_163071867.1\|1951492_1952842_+\|chromate-efflux-transporter	unknown	unknown	gnl\|CDD\|273350
NZ_CP050432.1\|WP_000642319.1\|1962944_1964003_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
NZ_CP050432.1\|WP_000864074.1\|1948479_1948725_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|224069

Protein	Function_ID	Function_description	E-value
NZ_CP050432.1\|WP_000637000.1\|1961985_1962897_+\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	4.15884e-82
NZ_CP050432.1\|WP_000448778.1\|1948745_1950479_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|181346	PRK08275, PRK08275, putative oxidoreductase; Provisional.	0
NZ_CP050432.1\|WP_001177517.1\|1968828_1969791_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
NZ_CP050432.1\|WP_000331400.1\|1954021_1954876_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
NZ_CP050432.1\|WP_000080821.1\|1950507_1951251_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.17942e-74
NZ_CP050432.1\|WP_163071866.1\|1959757_1960453_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	8.76232e-87
NZ_CP050432.1\|WP_001271394.1\|1964844_1966248_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
NZ_CP050432.1\|WP_000238436.1\|1964032_1964818_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.14898e-114
NZ_CP050432.1\|WP_001133053.1\|1967795_1968815_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	3.26675e-168
NZ_CP050432.1\|WP_000925651.1\|1957106_1957898_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.27594e-23
NZ_CP050432.1\|WP_001023744.1\|1955042_1955960_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.54094e-15
NZ_CP050432.1\|WP_001096433.1\|1960644_1961916_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	5.80166e-122
NZ_CP050432.1\|WP_000364551.1\|1970155_1971142_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
NZ_CP050432.1\|WP_004835232.1\|1953629_1954025_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	9.44811e-39
NZ_CP050432.1\|WP_000771644.1\|1952925_1953534_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	5.24919e-86
NZ_CP050432.1\|WP_000822394.1\|1955992_1956997_-\|hypothetical-protein	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	7.04313e-77
NZ_CP050432.1\|WP_001289733.1\|1966258_1967794_-\|2-oxo-acid-dehydrogenase-subunit-E2	gnl\|CDD\|273567	TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model represents one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria. Sequences from Gram-positive bacteria are not included. The non-enzymatic homolog protein X, which serves as an E3 component binding protein, falls within the clade phylogenetically but is rejected by its low score. [Energy metabolism, Pyruvate dehydrogenase].	3.67023e-121
NZ_CP050432.1\|WP_163071867.1\|1951492_1952842_+\|chromate-efflux-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	6.84419e-60
NZ_CP050432.1\|WP_000642319.1\|1962944_1964003_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
NZ_CP050432.1\|WP_000864074.1\|1948479_1948725_-\|ferredoxin-family-protein	gnl\|CDD\|224069	COG1146, COG1146, Ferredoxin [Energy production and conversion].	8.24428e-10

>NZ_CP050432.1|WP_000925651.1|1957106_1957898_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLINNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFQYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>NZ_CP050432.1|WP_000822394.1|1955992_1956997_-|hypothetical-protein
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLKQVQADVIIETGPSDYVTGGKGLFYLNYALTHSMNAIAVSKGALVVEGKKLINLAHQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIESVFTGTTNFILNDMLQHECAFTESLEKAQARGIAEPNSSFDVDGWDTAAKITILANTVLGVDVKIQDIPRQGISHVTTEHIRDWKKENIIPRLVGFIHIKNQQIQTGVELRLVPANHPFAHLQGSNKCIRVLTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>NZ_CP050432.1|WP_001023744.1|1955042_1955960_+|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKNCEKQA
>NZ_CP050432.1|WP_000331400.1|1954021_1954876_-|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>NZ_CP050432.1|WP_004835232.1|1953629_1954025_+|helix-turn-helix-transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPSHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>NZ_CP050432.1|WP_000771644.1|1952925_1953534_-|NAD(P)H-dependent-oxidoreductase
MKLLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEIAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQTALDNAAAQIAQLAG
>NZ_CP050432.1|WP_163071867.1|1951492_1952842_+|chromate-efflux-transporter
MQQKQLNTPDDSVEQVTFWQAILFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTTGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVITGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWFVAIAAFFAIFFLKLPFPLIVLSAGIAGYLASKKYPELFSSAAGHKASQKDYGPAIIDDDTPTPEHAKFHWLRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAALITVAAFIALFRFNINVLYVIFASALVGLAVTFF
>NZ_CP050432.1|WP_000080821.1|1950507_1951251_-|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQVPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLSEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>NZ_CP050432.1|WP_000448778.1|1948745_1950479_-|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
METKYFEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAVIPGYATPEQYTKEITIANDGVVNQTTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKKVHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSGDFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQINPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKVDHLAEETIQTIEEILHTNERPSRGRFHEGRGINYRQDMVEMHISEIGFCSGHSASGVWVNEKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVNAVEDSELNQSEIEAEKARIFAPLDCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNPHELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEHGNMVSFKKPIEPYVVPINQDEAVSYDRLRIQKDVALAD
>NZ_CP050432.1|WP_000864074.1|1948479_1948725_-|ferredoxin-family-protein
MAFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTDAVKVNIPYLLK
>NZ_CP050432.1|WP_163071866.1|1959757_1960453_-|MBL-fold-metallo-hydrolase
MFFKQFFEKESSTYTYMLGCEETRVAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSDVSCGDILITDGCMLKVGNLSIETRYTPGHTNACTSYLVGNMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSSTIGYERLNNSRLGQNRSREDFIELMNNLNLPYPKQIDKALPANQACGSISQL
>NZ_CP050432.1|WP_001096433.1|1960644_1961916_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFELEQDFYILFEQLKALFPNAILFLVDTSTQAIHYKFNTDDISVESMAALTQDHHNQYLEINTPKMRRRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIVDGVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPIIVDQILKESSTQLYTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLNADDYIKLPETNAELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>NZ_CP050432.1|WP_000637000.1|1961985_1962897_+|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEQREHLIHQVLIFCNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYGTLTRHIVELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>NZ_CP050432.1|WP_000642319.1|1962944_1964003_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>NZ_CP050432.1|WP_000238436.1|1964032_1964818_-|acetoin-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>NZ_CP050432.1|WP_001271394.1|1964844_1966248_-|dihydrolipoyl-dehydrogenase
MSAAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDVQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAKEKIEVTDAQGNSQVLSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVITDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICIEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>NZ_CP050432.1|WP_001289733.1|1966258_1967794_-|2-oxo-acid-dehydrogenase-subunit-E2
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTAQPQTAAASASAPAKVAKDDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQASGGQWPDVRQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPVSVSEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>NZ_CP050432.1|WP_001133053.1|1967795_1968815_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENQLEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>NZ_CP050432.1|WP_001177517.1|1968828_1969791_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>NZ_CP050432.1|WP_000364551.1|1970155_1971142_+|lipoyl-synthase
MDLKRQIETGIKLRGIDKVSRIPIKILPTEELPKKPEWIRAKITDFEEIQRIKNLLRQQKLHSVCEEAACPNLPECFAGGTATFMIMGDICTRRCPFCDVAHGRPMPLDENEPKHLAETVANLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRNRCPDTLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLNLLKRFKKYCPDIKTKCGLMVGLGEIEAEVIALLNDLKDHDVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTQHGQRLGFKNIWSAPMVRSSYFADRQYFGESAPKPFSREDVLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1141005 : 1155803

Acinetobacter_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001187844.1\|1141005_1141554_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	1.7e-97	100.0
WP_000893694.1\|1141816_1143316_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.1e-278	97.0
WP_001076827.1\|1143317_1145693_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	97.9
WP_001164242.1\|1145699_1146683_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.9e-183	96.3
WP_000066126.1\|1146693_1147389_-	Smr/MutS family protein	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
WP_000608310.1\|1147398_1148205_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.9e-146	99.3
WP_001982145.1\|1148214_1149264_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
WP_000281148.1\|1149619_1152352_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.2
WP_000566785.1\|1155227_1155803_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A0P0IKJ1	Acinetobacter_phage	1.2e-109	99.5

DBSCAN-SWA_2

1200561 : 1220507

Acinetobacter_phage(43.75%)

tail,integrase,head

attL 1192289:1192302|attR 1210491:1210504

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1192289:1192302	attL	NA	NA	NA	NA
WP_000110166.1\|1200561_1201374_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A126HHM5	Vibrio_phage	5.0e-40	37.2
WP_001010537.1\|1201370_1202144_-	ABC transporter permease	NA	NA	NA	NA
WP_000128669.1\|1202140_1203076_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.3e-23	30.0
WP_031965270.1\|1203373_1204360_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	2.0e-184	98.8
WP_000123993.1\|1204356_1204626_-	hypothetical protein	A0A1B1P9G0	Acinetobacter_phage	3.4e-46	95.5
WP_115596520.1\|1204627_1204807_-	hypothetical protein	NA	NA	NA	NA
WP_163071820.1\|1204803_1205193_-	hypothetical protein	J7HXR6	Acinetobacter_phage	3.5e-44	72.7
WP_001056664.1\|1205202_1206099_-	hypothetical protein	NA	NA	NA	NA
WP_163071819.1\|1206101_1206953_-	PD-(D/E)XK nuclease-like domain-containing protein	G8CLD3	Synechococcus_phage	1.2e-33	31.6
WP_151819293.1\|1206962_1207298_-	hypothetical protein	G4W935	Tetrasphaera_phage	1.5e-14	42.6
WP_032027781.1\|1207297_1207564_-	hypothetical protein	NA	NA	NA	NA
WP_000508120.1\|1207583_1207931_-	hypothetical protein	NA	NA	NA	NA
WP_104129277.1\|1208150_1208690_-	hypothetical protein	NA	NA	NA	NA
WP_033856362.1\|1208694_1209438_-	helix-turn-helix transcriptional regulator	A0A0R6PKV4	Moraxella_phage	4.5e-32	36.1
WP_104129276.1\|1209770_1210106_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_033854343.1\|1210120_1210588_+	HNH endonuclease	NA	NA	NA	NA
1210491:1210504	attR	NA	NA	NA	NA
WP_104129275.1\|1210584_1211475_+	hypothetical protein	NA	NA	NA	NA
WP_032002891.1\|1211471_1212206_+	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	4.4e-64	52.4
WP_163071818.1\|1212202_1212391_+	hypothetical protein	NA	NA	NA	NA
WP_169057937.1\|1212402_1212540_+	hypothetical protein	NA	NA	NA	NA
WP_032002892.1\|1212536_1212956_+	hypothetical protein	H2DE79	Erwinia_phage	4.2e-27	51.6
WP_001261846.1\|1212973_1213378_+	hypothetical protein	NA	NA	NA	NA
WP_032002893.1\|1213374_1213692_+	hypothetical protein	A0A1J0MGQ3	Acinetobacter_phage	4.9e-52	96.2
WP_032002895.1\|1213684_1213900_+	hypothetical protein	NA	NA	NA	NA
WP_032002897.1\|1213892_1214195_+	hypothetical protein	A0A1B1P9J7	Acinetobacter_phage	3.9e-14	59.3
WP_163071823.1\|1214226_1214514_+	hypothetical protein	A0A0P0IY41	Acinetobacter_phage	1.3e-16	69.0
WP_032002899.1\|1214510_1214735_+	hypothetical protein	NA	NA	NA	NA
WP_032002901.1\|1214829_1215009_+	hypothetical protein	NA	NA	NA	NA
WP_032002902.1\|1215075_1215399_+	hypothetical protein	NA	NA	NA	NA
WP_032002903.1\|1215398_1215629_+	hypothetical protein	NA	NA	NA	NA
WP_032002905.1\|1215630_1217274_+\|head,tail	head-tail connector protein	A0A2H4J3N6	uncultured_Caudovirales_phage	1.5e-123	45.0
WP_032002907.1\|1217270_1217756_+	hypothetical protein	NA	NA	NA	NA
WP_032002909.1\|1217748_1218372_+	hypothetical protein	NA	NA	NA	NA
WP_032002910.1\|1218383_1219283_+	hypothetical protein	NA	NA	NA	NA
WP_032002912.1\|1219358_1219886_+	DUF2829 domain-containing protein	A0A1B0VMG3	Pseudomonas_phage	4.1e-35	47.9
WP_032002913.1\|1219946_1220507_+	hypothetical protein	A0A1B1IRI7	uncultured_Mediterranean_phage	2.0e-24	36.8

DBSCAN-SWA_3

1523050 : 1592770

Acinetobacter_phage(80.39%)

holin,transposase,terminase,tail,protease,integrase,capsid

attL 1543323:1543340|attR 1596320:1596337

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000739695.1\|1523050_1523665_+\|protease	metalloprotease secretion chaperone CpaB	NA	NA	NA	NA
WP_071212334.1\|1523788_1525885_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.8e-41	31.6
WP_000632984.1\|1526208_1528437_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
WP_000165805.1\|1528485_1528920_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_000017865.1\|1528919_1530077_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
WP_086225914.1\|1530308_1531547_+	lactonase family protein	NA	NA	NA	NA
WP_000388070.1\|1531847_1532351_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_005119988.1\|1532370_1533405_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_163071885.1\|1533409_1534540_+	YdcF family protein	NA	NA	NA	NA
WP_001290023.1\|1534539_1535568_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_086225912.1\|1535628_1536132_-	hypothetical protein	NA	NA	NA	NA
WP_000474098.1\|1536188_1537244_-	linear amide C-N hydrolase	NA	NA	NA	NA
WP_000509752.1\|1537454_1538873_-	glutamate synthase	NA	NA	NA	NA
WP_000075452.1\|1539290_1540631_-	PepSY domain-containing protein	NA	NA	NA	NA
WP_163071886.1\|1541242_1541815_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_000037347.1\|1542138_1543002_+	iron-containing redox enzyme family protein	NA	NA	NA	NA
1543323:1543340	attL	NA	NA	NA	NA
WP_000773629.1\|1543500_1544763_+\|integrase	integrase family protein	A0A0P0IKP2	Acinetobacter_phage	7.3e-248	99.5
WP_002055027.1\|1544768_1545038_-	hypothetical protein	A0A0N7IRE8	Acinetobacter_phage	1.1e-41	97.8
WP_000043827.1\|1545038_1545335_-	hypothetical protein	NA	NA	NA	NA
WP_163050161.1\|1545334_1546297_-	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	2.4e-142	81.2
WP_001207471.1\|1546293_1547415_-	ATP-binding protein	A0A0N7IRE0	Acinetobacter_phage	5.2e-213	100.0
WP_000064469.1\|1547426_1547750_-	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	1.5e-43	79.4
WP_002053030.1\|1547742_1548192_-	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	1.0e-74	97.9
WP_001049346.1\|1548396_1549146_-	helix-turn-helix transcriptional regulator	H1ZZB6	Pseudomonas_virus	8.4e-10	30.7
WP_000451536.1\|1549279_1549543_+	lambdoid prophage e14 transcriptional regulatory protein	NA	NA	NA	NA
WP_001289843.1\|1549603_1550104_+	hypothetical protein	NA	NA	NA	NA
WP_002009763.1\|1550153_1550441_+	hypothetical protein	NA	NA	NA	NA
WP_001091618.1\|1550437_1551991_+	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	2.4e-136	41.8
WP_169057940.1\|1551987_1552938_+	DUF1376 domain-containing protein	A0A0P0I481	Acinetobacter_phage	3.2e-99	63.9
WP_032024182.1\|1552930_1553680_+	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	2.4e-134	96.4
WP_002048053.1\|1553676_1553793_+	putative phage replication protein	A0A0P0IR92	Acinetobacter_phage	9.8e-11	91.7
WP_002048056.1\|1553792_1554191_+	hypothetical protein	NA	NA	NA	NA
WP_000017820.1\|1554187_1554595_+	hypothetical protein	NA	NA	NA	NA
WP_000778999.1\|1554591_1554990_+	HNH endonuclease	A0A2R2Z2X9	Escherichia_phage	5.8e-26	48.5
WP_001039748.1\|1554986_1555166_+	hypothetical protein	NA	NA	NA	NA
WP_000343018.1\|1555285_1556494_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
WP_169057953.1\|1556529_1556805_+	hypothetical protein	NA	NA	NA	NA
WP_169057941.1\|1556804_1557200_+	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	1.5e-66	96.2
WP_000783471.1\|1557196_1557697_+	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	2.9e-91	97.6
WP_000508252.1\|1557779_1558544_+	hypothetical protein	A0A0P0IKQ5	Acinetobacter_phage	7.3e-86	91.8
WP_000715267.1\|1558774_1559533_+	hypothetical protein	A0A0P0J0C5	Acinetobacter_phage	5.2e-116	80.2
WP_000787531.1\|1559628_1560276_+	hypothetical protein	A0A0N7IRF1	Acinetobacter_phage	4.7e-126	97.7
WP_000113273.1\|1560323_1560803_+	DUF2280 domain-containing protein	A0A0P0HSK4	Acinetobacter_phage	7.1e-71	95.8
WP_169057942.1\|1560792_1562220_+\|terminase	phage terminase large subunit	J7I460	Acinetobacter_phage	4.1e-263	96.2
WP_169057943.1\|1562216_1563668_+	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	3.7e-264	91.9
WP_005135094.1\|1563669_1564773_+\|capsid	minor capsid protein	A0A0D4DBL9	Acinetobacter_phage	8.1e-203	97.8
WP_000965232.1\|1564781_1565210_+	hypothetical protein	A0A0D4DBV9	Acinetobacter_phage	5.2e-73	100.0
WP_000004367.1\|1565308_1565545_+	hypothetical protein	A0A0D4DC19	Acinetobacter_phage	1.1e-35	93.6
WP_001139861.1\|1565768_1565960_+	hypothetical protein	A0A0P0IKM2	Acinetobacter_phage	1.7e-28	100.0
WP_005135097.1\|1566073_1566841_+	hypothetical protein	A0A0D4DCP5	Acinetobacter_phage	2.0e-115	89.8
WP_000214194.1\|1566868_1567822_+	Ig domain-containing protein	A0A0D4DBM4	Acinetobacter_phage	1.2e-167	94.0
WP_064987512.1\|1567886_1568552_+	stress-responsive nuclear envelope protein	J7I4P7	Acinetobacter_phage	8.7e-59	58.4
WP_140991217.1\|1568556_1568946_+	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	2.6e-63	93.8
WP_140991247.1\|1568947_1569316_+	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	6.7e-61	93.4
WP_140991219.1\|1569354_1570017_+	hypothetical protein	NA	NA	NA	NA
WP_169057944.1\|1570080_1570488_+	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.8e-62	88.8
WP_002037239.1\|1570459_1570828_+	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	5.5e-55	83.6
WP_000178914.1\|1570829_1571228_+	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	4.2e-69	95.5
WP_015451444.1\|1571296_1571650_+	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	9.3e-60	100.0
WP_169057945.1\|1571649_1572798_+\|tail	phage tail protein	J7I0X3	Acinetobacter_phage	7.7e-164	88.5
WP_140991233.1\|1572850_1573768_+	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	1.5e-165	97.4
WP_169057946.1\|1573837_1574353_+	hypothetical protein	A0A0D4DBX8	Acinetobacter_phage	2.1e-76	96.6
WP_118978614.1\|1574962_1575694_+	DUF4760 domain-containing protein	A0A1B1P9E5	Acinetobacter_phage	8.2e-119	88.8
WP_114229316.1\|1576133_1576322_+	hypothetical protein	NA	NA	NA	NA
WP_169057947.1\|1576485_1580823_+	tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	87.3
WP_000937385.1\|1580897_1581650_+	hypothetical protein	J7HXF9	Acinetobacter_phage	1.3e-34	35.2
WP_000246070.1\|1581653_1582046_+	hypothetical protein	NA	NA	NA	NA
WP_000277440.1\|1582110_1582509_+	hypothetical protein	A0A0P0IY66	Acinetobacter_phage	2.7e-71	97.0
WP_057049478.1\|1582508_1583015_+	DUF1833 family protein	A0A0P0IKN4	Acinetobacter_phage	4.1e-93	99.4
WP_000835171.1\|1583011_1583374_+	hypothetical protein	A0A0D4DCJ1	Acinetobacter_phage	2.3e-66	100.0
WP_169057948.1\|1583366_1586813_+	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	97.0
WP_002061588.1\|1586881_1587271_+	hypothetical protein	J7I481	Acinetobacter_phage	1.4e-64	96.1
WP_002045818.1\|1587312_1587891_+	chitinase class I domain protein	A0A2H4JDB4	uncultured_Caudovirales_phage	3.9e-79	78.8
WP_005070343.1\|1587994_1588411_-	hypothetical protein	NA	NA	NA	NA
WP_002045824.1\|1588852_1590016_+	glutathione-dependent formaldehyde dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	5.5e-08	26.5
WP_032061820.1\|1590153_1590900_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	1.8e-12	33.3
WP_032061822.1\|1590977_1592276_-	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	3.7e-154	60.8
WP_163050210.1\|1592272_1592770_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	2.9e-43	57.7
1596320:1596337	attR	NA	NA	NA	NA

DBSCAN-SWA_4

2593797 : 2600684

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001136753.1\|2593797_2594253_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	2.2e-53	68.9
WP_000991091.1\|2594708_2595242_-	hypothetical protein	NA	NA	NA	NA
WP_006581303.1\|2595238_2596003_-	ATP-binding protein	A0A0D4DBZ2	Acinetobacter_phage	2.3e-63	47.7
WP_000124477.1\|2595999_2597043_-	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	4.3e-28	52.8
WP_049581661.1\|2597046_2598525_-	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	1.4e-133	53.1
WP_004708298.1\|2598521_2598908_-	hypothetical protein	NA	NA	NA	NA
WP_006581306.1\|2598913_2599474_-	hypothetical protein	NA	NA	NA	NA
WP_000817336.1\|2599518_2600058_-	HNH endonuclease	Q94MV4	Myxococcus_phage	8.1e-31	55.7
WP_000218441.1\|2600054_2600684_-	hypothetical protein	R9VWB9	Serratia_phage	1.0e-29	37.8

DBSCAN-SWA_5

2791034 : 2798614

Acinetobacter_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001019745.1\|2791034_2791580_-	N-acetylmuramidase	A0A0B5L5G7	Acinetobacter_phage	2.1e-95	92.3
WP_001076396.1\|2791678_2791861_-	hypothetical protein	NA	NA	NA	NA
WP_001138125.1\|2792224_2792503_-	hypothetical protein	J7I481	Acinetobacter_phage	9.9e-49	100.0
WP_005120390.1\|2792522_2793038_-	hypothetical protein	A0A0P0J095	Acinetobacter_phage	1.3e-70	94.9
WP_163071893.1\|2793466_2793982_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	1.6e-44	60.7
WP_000435241.1\|2794040_2794682_-	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	1.1e-122	96.2
WP_000378525.1\|2794650_2795085_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	6.0e-69	88.2
WP_001136775.1\|2795144_2795600_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
WP_000152665.1\|2796261_2796498_-	hypothetical protein	NA	NA	NA	NA
WP_001039309.1\|2796706_2797051_-	hypothetical protein	NA	NA	NA	NA
WP_000861102.1\|2797513_2797768_-	hypothetical protein	NA	NA	NA	NA
WP_001277128.1\|2797739_2798216_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
WP_000100169.1\|2798212_2798614_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	2.6e-66	95.4

DBSCAN-SWA_6

2845639 : 2916169

uncultured_virus(15.38%)

transposase,protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000195944.1\|2845639_2846449_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_000343018.1\|2848526_2849735_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
WP_001136091.1\|2850239_2850932_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-11	30.4
WP_002036590.1\|2850976_2851600_+	arylesterase	NA	NA	NA	NA
WP_001987747.1\|2851632_2852271_-	carbonic anhydrase	NA	NA	NA	NA
WP_000197530.1\|2852531_2853557_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000107250.1\|2853583_2854591_+	hypothetical protein	NA	NA	NA	NA
WP_000044175.1\|2854613_2856878_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_000102721.1\|2857047_2857686_-	Fe-S biogenesis protein NfuA	NA	NA	NA	NA
WP_000902942.1\|2857843_2858461_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_000875356.1\|2858631_2860308_+	arylsulfatase	NA	NA	NA	NA
WP_086225841.1\|2860412_2861312_+	formylglycine-generating enzyme family protein	NA	NA	NA	NA
WP_000854552.1\|2861421_2861586_+	hypothetical protein	NA	NA	NA	NA
WP_000098361.1\|2862124_2863672_+	hypothetical protein	NA	NA	NA	NA
WP_000859892.1\|2863715_2865050_-	D-serine ammonia-lyase	NA	NA	NA	NA
WP_115423553.1\|2865212_2866742_-	inorganic phosphate transporter	NA	NA	NA	NA
WP_000105327.1\|2867306_2870993_+	methionine synthase	A0A140XBC7	Dickeya_phage	3.3e-14	60.0
WP_000350748.1\|2871038_2872547_-	SIR2 family protein	Q38324	Lactococcus_phage	1.1e-32	26.7
WP_001016325.1\|2873132_2873579_-	hypothetical protein	NA	NA	NA	NA
WP_000731762.1\|2873770_2874916_+	galactose mutarotase	NA	NA	NA	NA
WP_170357983.1\|2874983_2876186_-	MFS transporter	NA	NA	NA	NA
WP_001285122.1\|2876310_2877099_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000856719.1\|2877093_2878389_-	glutaminase	NA	NA	NA	NA
WP_000117817.1\|2878567_2879050_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.9e-19	44.4
WP_000371873.1\|2879284_2880583_+	MFS transporter	NA	NA	NA	NA
WP_086225840.1\|2880645_2881821_-	hypothetical protein	NA	NA	NA	NA
WP_000140236.1\|2881997_2883638_-	thiamine pyrophosphate-binding protein	E5EQ70	Micromonas_sp._RCC1109_virus	9.1e-25	23.9
WP_001040550.1\|2883676_2885143_-	aldehyde dehydrogenase	NA	NA	NA	NA
WP_000735779.1\|2885156_2885948_-	aspartate dehydrogenase	NA	NA	NA	NA
WP_000009973.1\|2885963_2886758_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.6e-13	28.6
WP_000988617.1\|2886773_2887598_-	alpha/beta hydrolase	A0A249XPN5	Mycobacterium_phage	6.2e-14	31.7
WP_000211626.1\|2887634_2888156_-	cupin domain-containing protein	NA	NA	NA	NA
WP_000064049.1\|2888179_2889403_-	MFS transporter	NA	NA	NA	NA
WP_000411885.1\|2889445_2890657_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_000627772.1\|2890686_2891616_-	VOC family protein	NA	NA	NA	NA
WP_000991785.1\|2892384_2893452_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
WP_000847099.1\|2893468_2893768_-	hypothetical protein	NA	NA	NA	NA
WP_000118514.1\|2893795_2894101_-	non-heme iron oxygenase ferredoxin subunit	NA	NA	NA	NA
WP_000051057.1\|2894374_2895187_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_000927114.1\|2895233_2895533_-	hypothetical protein	NA	NA	NA	NA
WP_000074694.1\|2895547_2896129_-	nicotinamide mononucleotide transporter	A0A2H4YHF9	Raoultella_phage	8.0e-08	29.1
WP_000070467.1\|2896375_2897164_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
WP_002000370.1\|2897265_2897670_-	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
WP_000151613.1\|2897766_2899026_-	poly-beta-1,6 N-acetyl-D-glucosamine synthase	NA	NA	NA	NA
WP_000632828.1\|2899039_2901034_-	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB	NA	NA	NA	NA
WP_000627259.1\|2901270_2901612_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_001185269.1\|2901698_2902229_-	YaeQ family protein	NA	NA	NA	NA
WP_000267730.1\|2902417_2903680_+	C4-dicarboxylate transporter DctA	NA	NA	NA	NA
WP_000343018.1\|2903777_2904986_+\|transposase	IS256-like element ISAba26 family transposase	A0A218MNI5	uncultured_virus	3.1e-46	46.5
WP_000766466.1\|2905043_2906042_-	GTP-binding protein	NA	NA	NA	NA
WP_000761577.1\|2906540_2906741_+	hypothetical protein	NA	NA	NA	NA
WP_001142469.1\|2906851_2907367_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_000254582.1\|2907628_2908243_-	MarC family protein	NA	NA	NA	NA
WP_000179784.1\|2908254_2910321_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	2.0e-16	25.1
WP_000243381.1\|2910438_2912061_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.8e-20	26.6
WP_001985959.1\|2912314_2912950_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_163071900.1\|2912942_2914415_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_001021935.1\|2914510_2916169_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	3.5e-56	31.1

DBSCAN-SWA_7

2944663 : 2995454

Acinetobacter_phage(75.51%)

terminase,tail,integrase,capsid

attL 2946067:2946091|attR 2995629:2995653

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000831314.1\|2944663_2945890_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JAT5	uncultured_Caudovirales_phage	7.2e-75	40.2
2946067:2946091	attL	NA	NA	NA	NA
WP_001050362.1\|2946262_2946928_-	hypothetical protein	NA	NA	NA	NA
WP_000332605.1\|2947074_2947710_+	SOS response-associated peptidase family protein	A0A218MNF5	uncultured_virus	3.0e-69	57.9
WP_031975544.1\|2947851_2948346_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	3.3e-47	60.4
WP_163071901.1\|2948349_2949648_+	DUF4113 domain-containing protein	A0A2H4JBL5	uncultured_Caudovirales_phage	1.7e-159	61.9
WP_163071902.1\|2949730_2949952_+	hypothetical protein	NA	NA	NA	NA
WP_032049971.1\|2949951_2950626_+	hypothetical protein	NA	NA	NA	NA
WP_130089740.1\|2950721_2951564_+	restriction endonuclease	NA	NA	NA	NA
WP_032049969.1\|2951623_2951806_-	hypothetical protein	NA	NA	NA	NA
WP_163071903.1\|2952008_2952587_-	glycoside hydrolase	A0A2H4JDB4	uncultured_Caudovirales_phage	1.1e-78	77.2
WP_000433907.1\|2952628_2953018_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
WP_163071904.1\|2953085_2956511_-	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	93.1
WP_000835159.1\|2956503_2956866_-	hypothetical protein	A0A0P0J0A2	Acinetobacter_phage	6.2e-51	79.2
WP_000368371.1\|2956862_2957369_-	DUF1833 family protein	J7HXQ5	Acinetobacter_phage	1.5e-90	97.6
WP_032018975.1\|2957368_2957767_-	hypothetical protein	J7I0X8	Acinetobacter_phage	6.3e-73	99.2
WP_163071905.1\|2957903_2958611_-	hypothetical protein	NA	NA	NA	NA
WP_000959543.1\|2958637_2959282_-	hypothetical protein	NA	NA	NA	NA
WP_000134295.1\|2959271_2960003_-	hypothetical protein	NA	NA	NA	NA
WP_169057951.1\|2960470_2964808_-	tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	87.1
WP_001275792.1\|2964938_2965202_-	hypothetical protein	NA	NA	NA	NA
WP_000721572.1\|2965203_2965884_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.5e-53	49.3
WP_169057952.1\|2966365_2966881_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	1.9e-77	97.3
WP_151283321.1\|2966950_2967868_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.0e-166	97.4
WP_163071933.1\|2967920_2969069_-\|tail	phage tail protein	J7I0X3	Acinetobacter_phage	2.9e-155	86.9
WP_015451444.1\|2969068_2969422_-	hypothetical protein	A0A0D4DCF7	Acinetobacter_phage	9.3e-60	100.0
WP_000178914.1\|2969490_2969889_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	4.2e-69	95.5
WP_002037239.1\|2969890_2970259_-	hypothetical protein	A0A0D4DBN1	Acinetobacter_phage	5.5e-55	83.6
WP_001276385.1\|2970230_2970668_-	hypothetical protein	J7I0W8	Acinetobacter_phage	2.7e-69	91.7
WP_032063630.1\|2970646_2971015_-	hypothetical protein	A0A0D4DCF3	Acinetobacter_phage	1.9e-63	96.7
WP_005135101.1\|2971016_2971406_-	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	2.6e-63	94.6
WP_163050235.1\|2971410_2972076_-	stress-responsive nuclear envelope protein	J7I4P7	Acinetobacter_phage	5.3e-64	62.4
WP_000214194.1\|2972140_2973094_-	Ig domain-containing protein	A0A0D4DBM4	Acinetobacter_phage	1.2e-167	94.0
WP_005135097.1\|2973121_2973889_-	hypothetical protein	A0A0D4DCP5	Acinetobacter_phage	2.0e-115	89.8
WP_001139861.1\|2974002_2974194_-	hypothetical protein	A0A0P0IKM2	Acinetobacter_phage	1.7e-28	100.0
WP_000004367.1\|2974417_2974654_-	hypothetical protein	A0A0D4DC19	Acinetobacter_phage	1.1e-35	93.6
WP_000965232.1\|2974752_2975181_-	hypothetical protein	A0A0D4DBV9	Acinetobacter_phage	5.2e-73	100.0
WP_005135094.1\|2975189_2976293_-\|capsid	minor capsid protein	A0A0D4DBL9	Acinetobacter_phage	8.1e-203	97.8
WP_104073951.1\|2976294_2977746_-	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	1.8e-282	98.3
WP_000102072.1\|2977742_2979170_-\|terminase	phage terminase large subunit	A0A0D4DCE6	Acinetobacter_phage	7.9e-259	90.5
WP_000729376.1\|2979159_2979630_-	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	4.4e-73	89.1
WP_163071928.1\|2979688_2980330_-	hypothetical protein	J7I4N9	Acinetobacter_phage	3.0e-125	98.6
WP_163071929.1\|2980298_2980766_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	9.1e-71	85.8
WP_002120855.1\|2980804_2981215_-	hypothetical protein	NA	NA	NA	NA
WP_109847109.1\|2981340_2981559_-	hypothetical protein	NA	NA	NA	NA
WP_000752807.1\|2982022_2982796_-	hypothetical protein	NA	NA	NA	NA
WP_001019813.1\|2982819_2983218_-	hypothetical protein	NA	NA	NA	NA
WP_166470234.1\|2983217_2983622_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	4.0e-67	96.9
WP_000378368.1\|2983621_2983945_-	hypothetical protein	NA	NA	NA	NA
WP_001039748.1\|2983934_2984114_-	hypothetical protein	NA	NA	NA	NA
WP_057048842.1\|2984106_2984508_-	HNH endonuclease	K7P7B7	Enterobacteria_phage	1.0e-25	48.4
WP_000017854.1\|2984504_2984912_-	hypothetical protein	NA	NA	NA	NA
WP_078177514.1\|2984908_2985658_-	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	9.9e-136	97.6
WP_163071936.1\|2985650_2986601_-	DUF1376 domain-containing protein	A0A0P0I481	Acinetobacter_phage	5.0e-100	64.2
WP_044696543.1\|2986597_2988151_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	7.1e-136	41.7
WP_044696544.1\|2988147_2988468_-	hypothetical protein	NA	NA	NA	NA
WP_001289843.1\|2988517_2989018_-	hypothetical protein	NA	NA	NA	NA
WP_151000694.1\|2989072_2989321_-	helix-turn-helix domain-containing protein	A0A0R6PH31	Moraxella_phage	8.0e-18	58.6
WP_000187985.1\|2989323_2990115_+	helix-turn-helix domain-containing protein	A0A0R6PH50	Moraxella_phage	1.4e-10	52.1
WP_001101442.1\|2990343_2990784_+	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	6.3e-74	95.9
WP_094319079.1\|2990985_2991183_+	hypothetical protein	A0A0D4DBX7	Acinetobacter_phage	1.5e-27	96.9
WP_001061223.1\|2991179_2992256_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	1.1e-143	76.5
WP_000654851.1\|2992257_2992503_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	7.4e-40	98.8
WP_000566258.1\|2992506_2992956_+	DUF551 domain-containing protein	A0A0P0HSE1	Acinetobacter_phage	3.4e-83	97.2
WP_000028956.1\|2992952_2993162_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	9.1e-31	91.3
WP_000048756.1\|2993158_2993443_+	hypothetical protein	A0A0P0HSI5	Acinetobacter_phage	4.4e-44	96.8
WP_000119263.1\|2993453_2993624_+	hypothetical protein	A0A2H4JBW6	uncultured_Caudovirales_phage	1.2e-12	71.4
WP_000240807.1\|2993634_2994318_-	hypothetical protein	NA	NA	NA	NA
WP_000947481.1\|2994302_2995454_-\|integrase	site-specific integrase	A0A2H4J339	uncultured_Caudovirales_phage	4.1e-133	62.0
2995629:2995653	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP050433

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 115926

108

Escherichia_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004896925.1\|894_1437_+	hypothetical protein	NA	NA	NA	NA
WP_000155092.1\|1795_2680_-	Mph(E) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_000052512.1\|2735_4211_-	ABC-F type ribosomal protection protein Msr(E)	A0A1B0RXA0	Streptococcus_phage	2.3e-160	59.0
WP_002001451.1\|4609_5794_-\|transposase	IS4-like element ISEc29 family transposase	A0A0F7LAS3	uncultured_marine_virus	4.5e-50	35.4
WP_002026779.1\|5842_6028_+	hypothetical protein	NA	NA	NA	NA
WP_077252464.1\|6247_6529_+	hypothetical protein	NA	NA	NA	NA
WP_000359986.1\|6509_7283_-	ArmA family 16S rRNA (guanine(1405)-N(7))-methyltransferase	NA	NA	NA	NA
WP_001206290.1\|7524_8733_-\|transposase	IS4-like element IS10A family transposase	Q9E8P4	Bluetongue_virus	3.1e-171	71.4
WP_000050481.1\|10018_11560_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|11964_12804_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_001176353.1\|14069_14645_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_032495440.1\|14718_15645_-	class A extended-spectrum beta-lactamase PER-7	NA	NA	NA	NA
WP_000050481.1\|15969_17511_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000259031.1\|17915_18755_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_000679427.1\|18748_19096_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_012300772.1\|19287_20547_-	chloramphenicol efflux MFS transporter CmlA5	S4TR35	Salmonella_phage	1.7e-26	31.7
WP_000237816.1\|20867_21320_-	NAD(+)--rifampin ADP-ribosyltransferase Arr-2	NA	NA	NA	NA
WP_001067855.1\|22342_23047_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000647189.1\|24472_24973_-	hypothetical protein	I3UMJ0	Colwellia_phage	1.7e-19	43.3
WP_002210541.1\|24981_25293_-	hypothetical protein	NA	NA	NA	NA
WP_005507681.1\|25298_25730_-	hypothetical protein	NA	NA	NA	NA
WP_000344151.1\|25797_26472_-	thymidylate kinase	NA	NA	NA	NA
WP_014342216.1\|26458_26578_+	hypothetical protein	NA	NA	NA	NA
WP_001125905.1\|26720_27098_-	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	2.2e-22	49.6
WP_000939033.1\|27416_27560_+	hypothetical protein	NA	NA	NA	NA
WP_000074431.1\|27651_28287_+	N-6 DNA methylase	NA	NA	NA	NA
WP_000703827.1\|28339_28612_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_001207227.1\|28660_29842_-	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	2.4e-11	28.7
WP_045544682.1\|29845_30631_-	ParA family protein	A0A1X9IGI7	Lactococcus_phage	2.1e-11	26.8
WP_014342215.1\|30658_30790_+	hypothetical protein	NA	NA	NA	NA
WP_000338945.1\|30804_31116_-	hypothetical protein	NA	NA	NA	NA
WP_001043260.1\|31422_32238_+	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
WP_000251875.1\|32324_32627_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_001445143.1\|32520_32772_-	hypothetical protein	NA	NA	NA	NA
WP_001120888.1\|32802_34296_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_049581834.1\|36207_36702_-	dihydrofolate reductase	A0A076GDN3	Bacillus_phage	5.3e-29	37.1
WP_049581831.1\|36701_37526_-	thymidylate synthase	A0A2R4A1R4	Microbacterium_phage	1.8e-98	63.9
WP_101458100.1\|37529_37967_-	bifunctional nuclease family protein	NA	NA	NA	NA
WP_001120888.1\|38130_39624_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_000743213.1\|39834_40059_-	hypothetical protein	NA	NA	NA	NA
WP_000480968.1\|40178_41015_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
WP_001082319.1\|41014_41818_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
WP_001144971.1\|42200_43988_-	hypothetical protein	NA	NA	NA	NA
WP_000386247.1\|44197_44602_+	hypothetical protein	NA	NA	NA	NA
WP_000131185.1\|45054_47316_-	type I DNA topoisomerase	E3T4K4	Cafeteria_roenbergensis_virus	4.0e-63	32.5
WP_001101323.1\|47489_48593_+	hypothetical protein	NA	NA	NA	NA
WP_002015149.1\|48908_49820_+	hypothetical protein	NA	NA	NA	NA
WP_000038505.1\|49851_50187_-	hypothetical protein	NA	NA	NA	NA
WP_002015113.1\|50227_50443_-	hypothetical protein	NA	NA	NA	NA
WP_000420425.1\|50486_50816_-	DUF1456 family protein	NA	NA	NA	NA
WP_000941930.1\|50796_51624_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_000913724.1\|51610_52342_-	hypothetical protein	NA	NA	NA	NA
WP_001090439.1\|52685_53180_+	hypothetical protein	NA	NA	NA	NA
WP_000504197.1\|53259_53685_+	hypothetical protein	NA	NA	NA	NA
WP_045544691.1\|53805_55656_+	hypothetical protein	A0A193GYG9	Enterobacter_phage	1.3e-08	26.1
WP_001024681.1\|55670_56018_-	hypothetical protein	NA	NA	NA	NA
WP_001046277.1\|56040_56292_-	hypothetical protein	NA	NA	NA	NA
WP_000644490.1\|56517_56958_+	hypothetical protein	NA	NA	NA	NA
WP_001067790.1\|57086_57791_+\|transposase	IS6-like element IS1008 family transposase	A0A077SL39	Escherichia_phage	5.1e-118	84.5
WP_000212598.1\|58394_59402_+	allantoicase	NA	NA	NA	NA
WP_000250866.1\|59498_59999_+	ureidoglycolate lyase	NA	NA	NA	NA
WP_005115148.1\|60138_61071_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	5.1e-65	44.1
WP_000139429.1\|61140_62502_-	purine permease	Q9KX94	Enterobacteria_phage	1.6e-22	27.3
WP_000625767.1\|62537_62858_-	hydroxyisourate hydrolase	NA	NA	NA	NA
WP_001177702.1\|62854_63358_-	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase	NA	NA	NA	NA
WP_000127611.1\|63501_64464_-	allantoinase PuuE	NA	NA	NA	NA
WP_009520243.1\|64584_64821_+	hypothetical protein	NA	NA	NA	NA
WP_000908082.1\|64823_65111_+	hypothetical protein	NA	NA	NA	NA
WP_000993245.1\|66497_66710_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_001277464.1\|66740_67025_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
WP_000209293.1\|67042_68728_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	7.9e-40	28.2
WP_000522997.1\|68766_69192_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_004178136.1\|69219_69495_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294659.1\|69508_69859_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_001166628.1\|69930_70386_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_001067793.1\|70508_71213_-\|transposase	IS6-like element IS1007 family transposase	A0A077SL39	Escherichia_phage	1.2e-114	83.6
WP_029642002.1\|71150_71669_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	6.4e-25	50.4
WP_000073963.1\|72045_73434_-	hypothetical protein	NA	NA	NA	NA
WP_005115107.1\|73426_78475_-	AAA family ATPase	NA	NA	NA	NA
WP_000950632.1\|79145_80600_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.2e-183	71.0
WP_001067794.1\|80710_81415_+\|transposase	IS6-like element IS1007 family transposase	A0A077SL39	Escherichia_phage	6.9e-115	84.1
WP_153561859.1\|81453_81621_+	hypothetical protein	NA	NA	NA	NA
WP_005115110.1\|82031_84071_-\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_005115111.1\|84100_86725_-	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_005115114.1\|86721_88659_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_005115115.1\|88658_92207_-	BREX-1 system adenine-specific DNA-methyltransferase PglX	A0A2R2ZGH5	Clostridioides_phage	2.9e-07	21.1
WP_045544683.1\|92253_95934_-	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_005115117.1\|95975_96551_-	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_005115118.1\|96567_97179_-	DUF1819 family protein	NA	NA	NA	NA
WP_005115119.1\|97189_98056_-	WYL domain-containing protein	NA	NA	NA	NA
WP_000506885.1\|98264_98594_+	DUF4236 domain-containing protein	NA	NA	NA	NA
WP_001255534.1\|98865_100098_-	ATP-binding protein	NA	NA	NA	NA
WP_004726718.1\|101150_101759_-	recombinase family protein	A0A219Y9V9	Aeromonas_phage	2.7e-14	36.8
WP_004726714.1\|101853_104820_+\|transposase	Tn3-like element ISAcsp1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	68.4
WP_075315314.1\|104874_104994_+	Hin recombinase	NA	NA	NA	NA
WP_000029507.1\|105085_105505_-	PaaI family thioesterase	NA	NA	NA	NA
WP_000378064.1\|105506_105971_-	PaaI family thioesterase	NA	NA	NA	NA
WP_045544684.1\|106027_106999_-	BtrH N-terminal domain-containing protein	NA	NA	NA	NA
WP_000952904.1\|106995_107622_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_000149466.1\|107705_108575_-	metal-dependent hydrolase	NA	NA	NA	NA
WP_004656998.1\|109231_109462_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_001193555.1\|109500_110715_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_029749908.1\|110801_112169_-	cytochrome P450	NA	NA	NA	NA
WP_000078398.1\|112371_112692_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_000284949.1\|112831_113893_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_079267004.1\|114133_114451_-	recombinase family protein	A0A286S1P7	Klebsiella_phage	5.9e-05	34.5
WP_009516416.1\|114604_114838_-	ATP-binding protein	A0A059NT77	Lactococcus_phage	3.0e-06	40.6
WP_001067789.1\|115221_115926_+\|transposase	IS6-like element IS1008 family transposase	A0A077SL39	Escherichia_phage	2.5e-117	84.1

DBSCAN-SWA_2

149820 : 160023

Acinetobacter_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000998564.1\|149820_150705_+	AAA family ATPase	A0A1X9I765	Streptococcus_phage	5.4e-08	27.0
WP_000062236.1\|150708_151587_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_001016937.1\|151654_152950_-	Y-family DNA polymerase	A0A0P0I4F0	Acinetobacter_phage	2.7e-141	59.2
WP_001077961.1\|152946_153444_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A2H4J538	uncultured_Caudovirales_phage	4.8e-38	57.7
WP_001144533.1\|153632_154679_-	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_000271057.1\|154668_155319_-	hypothetical protein	NA	NA	NA	NA
WP_002011569.1\|155427_156708_-	hypothetical protein	A0A0N7C080	Escherichia_phage	6.6e-31	33.8
WP_002011623.1\|157109_157334_-	hypothetical protein	NA	NA	NA	NA
WP_000733607.1\|157380_157776_-	hypothetical protein	NA	NA	NA	NA
WP_000956387.1\|157789_158131_-	hypothetical protein	NA	NA	NA	NA
WP_002011509.1\|158145_160023_-	M23 family metallopeptidase	A0A1X9SFE0	Acinetobacter_phage	1.9e-34	50.8

DBSCAN-SWA_3

168526 : 172261

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000871698.1\|168526_172261_-	hypothetical protein	V5UQK6	Shigella_phage	9.3e-25	45.3

DBSCAN-SWA_4

207660 : 207993

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001049486.1\|207660_207993_+	hypothetical protein	A0A1W6DXA8	Sphingobium_phage	1.0e-15	38.9

DBSCAN-SWA_5

211726 : 212659

Escherichia_phage(100.0%)

integrase

attL 203736:203748|attR 214609:214621

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
203736:203748	attL	NA	NA	NA	NA
WP_000886982.1\|211726_212659_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	7.5e-16	36.2
WP_000886982.1\|211726_212659_+\|integrase	tyrosine-type recombinase/integrase	A0A2L1IV36	Escherichia_phage	7.5e-16	36.2
214609:214621	attR	NA	NA	NA	NA

DBSCAN-SWA_6

218445 : 219261

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001043260.1\|218445_219261_+	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP050432

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP050433

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection