CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP052858	Pseudomonas sp. ADAK20 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,WYL,DinG,PD-DExK	3	2	6	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP052858_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP052858_1

4583065-4583322

Orphan

Consensus_repeat	Method
TGGNACTGGCGGCGGCAC	CRT

6 spacers

The CRISPR arrays of NZ_CP052858_1

>merge|NZ_CP052858|1|4583065-4583322|CRT
TGGTGACGGCGGCGGCACGGGTGGCGGCGACGGTGGTGGTACTGGCGGTGGCACGGGTGGCGGCGACGGTGGTGGCACTGGCGGCGGCACAGGTGGCGGCACCGGCGGTGGCACTGGCGGCGGCACAGGTGGCGGCACAGGTGGCGGCACCGGCGGTGGCACTGGCGGCGGCACGGGTGGCGGCACCGGCGGTGGTACTGGCGGCGGCACAGGTGGCGGCACAGGCGGCGGCACAGGTGGCGGCACTGGCGGCGGCAC

>NZ_CP052858|1|1|4583065-4583322|CRT
TGGTGACGGCGGCGGCAC	GGGTGGCGGCGACGGTGG
TGGTACTGGCGGTGGCAC	GGGTGGCGGCGACGGTGG
TGGCACTGGCGGCGGCAC	AGGTGGCGGCACCGGCGG
TGGCACTGGCGGCGGCAC	AGGTGGCGGCACAGGTGGCGGCACCGGCGG
TGGCACTGGCGGCGGCAC	GGGTGGCGGCACCGGCGG
TGGTACTGGCGGCGGCAC	AGGTGGCGGCACAGGCGGCGGCACAGGTGG
CGGCACTGGCGGCGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP052858.1\|WP_029297585.1\|4586671_4586860_-\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366
NZ_CP052858.1\|WP_169390239.1\|4579018_4580296_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|236440
NZ_CP052858.1\|WP_070994311.1\|4591224_4592496_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP052858.1\|WP_029297567.1\|4574610_4574991_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052858.1\|WP_169390238.1\|4581757_4582606_+\|acyl-dehydratase	unknown	unknown	gnl\|CDD\|366711
NZ_CP052858.1\|WP_029297569.1\|4575195_4577397_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP052858.1\|WP_029297593.1\|4588835_4590038_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NZ_CP052858.1\|WP_029297577.1\|4580402_4581755_+\|3-oxoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|236207
NZ_CP052858.1\|WP_169390236.1\|4587868_4588816_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP052858.1\|WP_029297573.1\|4577947_4578844_-\|serine-protein-kinase-RIO	unknown	unknown	gnl\|CDD\|224632
NZ_CP052858.1\|WP_029297587.1\|4586904_4587297_-\|response-regulator	unknown	unknown	gnl\|CDD\|381085
NZ_CP052858.1\|WP_169390237.1\|4584808_4586491_+\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	unknown	unknown	gnl\|CDD\|225387
NZ_CP052858.1\|WP_029297595.1\|4590034_4591228_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|374910
NZ_CP052858.1\|WP_029297561.1\|4572799_4572979_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP052858.1\|WP_029297589.1\|4587352_4587541_-\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366
NZ_CP052858.1\|WP_169390235.1\|4592506_4593388_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP052858.1\|WP_032867218.1\|4583368_4584640_+\|collagen-like-triple-helix-repeat-containing-protein	unknown	unknown	gnl\|CDD\|374271
NZ_CP052858.1\|WP_029297563.1\|4572987_4574181_-\|multidrug-effflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340878
NZ_CP052858.1\|WP_029297571.1\|4577393_4577801_+\|Cu(I)-responsive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133383
NZ_CP052858.1\|WP_029297565.1\|4574267_4574465_-\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|238219

Protein	Function_ID	Function_description	E-value
NZ_CP052858.1\|WP_029297585.1\|4586671_4586860_-\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	9.03083e-07
NZ_CP052858.1\|WP_169390239.1\|4579018_4580296_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|236440	PRK09268, PRK09268, acetyl-CoA C-acetyltransferase.	0
NZ_CP052858.1\|WP_070994311.1\|4591224_4592496_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	2.05022e-157
NZ_CP052858.1\|WP_169390237.1\|4584808_4586491_+\|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein	gnl\|CDD\|225387	COG2831, FhaC, Hemolysin activation/secretion protein [Intracellular trafficking and secretion].	1.768e-63
NZ_CP052858.1\|WP_169390238.1\|4581757_4582606_+\|acyl-dehydratase	gnl\|CDD\|366711	pfam01575, MaoC_dehydratas, MaoC like domain. The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase. The MaoC protein is found to share similarity with a wide variety of enzymes; estradiol 17 beta-dehydrogenase 4, peroxisomal hydratase-dehydrogenase-epimerase, fatty acid synthase beta subunit. Several bacterial proteins that are composed solely of this domain have (R)-specific enoyl-CoA hydratase activity. This domain is also present in the NodN nodulation protein N.	5.34096e-15
NZ_CP052858.1\|WP_029297569.1\|4575195_4577397_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP052858.1\|WP_029297593.1\|4588835_4590038_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	3.0144e-95
NZ_CP052858.1\|WP_029297577.1\|4580402_4581755_+\|3-oxoacyl-ACP-reductase	gnl\|CDD\|236207	PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	0
NZ_CP052858.1\|WP_169390236.1\|4587868_4588816_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	9.36765e-52
NZ_CP052858.1\|WP_029297573.1\|4577947_4578844_-\|serine-protein-kinase-RIO	gnl\|CDD\|224632	COG1718, RIO1, Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning].	1.4481e-78
NZ_CP052858.1\|WP_029297587.1\|4586904_4587297_-\|response-regulator	gnl\|CDD\|381085	cd00156, REC, phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.	1.10122e-21
NZ_CP052858.1\|WP_029297595.1\|4590034_4591228_+\|pilus-assembly-protein	gnl\|CDD\|374910	pfam16968, TadZ_N, Pilus assembly protein TadZ N-terminal. TadZ_N is the N-terminal region of the Flp pilus assembly protein TadZ, which carries an AAA, ATPase domain immediately downstream, AAA_31, pfam13614. The domain is an example of a signal-transduction-response receiver. It is localized to the cytoplasmic side of the inner bacterial cell-membrane, contacting also with both tadA and RcpC.	7.01278e-43
NZ_CP052858.1\|WP_029297589.1\|4587352_4587541_-\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	2.02603e-05
NZ_CP052858.1\|WP_169390235.1\|4592506_4593388_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	1.82717e-54
NZ_CP052858.1\|WP_032867218.1\|4583368_4584640_+\|collagen-like-triple-helix-repeat-containing-protein	gnl\|CDD\|374271	pfam15984, Collagen_mid, Bacterial collagen, middle region. Collagen_mid is the conserved central region of bacterial collagen triple helix repeat proteins.	1.29869e-10
NZ_CP052858.1\|WP_029297563.1\|4572987_4574181_-\|multidrug-effflux-MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.22873e-108
NZ_CP052858.1\|WP_029297571.1\|4577393_4577801_+\|Cu(I)-responsive-transcriptional-regulator	gnl\|CDD\|133383	cd01108, HTH_CueR, Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators. Helix-turn-helix (HTH) transcription regulators CueR and ActP, copper efflux regulators. In Bacillus subtilis, copper induced CueR regulates the copZA operon, preventing copper toxicity. In Rhizobium leguminosarum, ActP controls copper homeostasis; it detects cytoplasmic copper stress and activates transcription in response to increasing copper concentrations. These proteins are comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain winged HTH motifs that mediate DNA binding, while the C-terminal domains have two conserved cysteines that define a monovalent copper ion binding site. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	8.94285e-76
NZ_CP052858.1\|WP_029297565.1\|4574267_4574465_-\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|238219	cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain contains two cysteine residues that are important in binding and transfer of metal ions, such as copper, cadmium, cobalt and zinc. In the case of copper, stoichiometry of binding is one Cu+ ion per binding domain. Repeats of the HMA domain in copper chaperone has been associated with Menkes/Wilson disease due to binding of multiple copper ions.	1.86821e-10

>NZ_CP052858.1|WP_169390238.1|4581757_4582606_+|acyl-dehydratase
MLWYTLPRSPALPPLYWRAALKRKITGTTLPDSGLHCRVQVNPAAVTAYRKVCGSAESPMLPATYPHIMAFGLQLQLLTAPQFPFPLLGLVHLSNRIRVFRPMGGVSDVRVSVHTRNLQPHAKGATFNLITTVEDSLGLLWEGESQMLCRGVKLDGEVPEQSLPAPSTVSELTRWKAPSDIGRRYARVSGDYNPIHLSALTAKLFGFPQAIAHGLWNKARTVAALHEHLPAANIEIYVEFKKPVRLPGEVILLSSAPGSSGELQLKGAGDIEHMLGKWQPIA
>NZ_CP052858.1|WP_029297577.1|4580402_4581755_+|3-oxoacyl-ACP-reductase
MSDRYIDFANSSLGHRVVSAIGLPSPVRLERWQAGRLRPVEGALLLGGGPLAAQVLGFANKLTEAIYSYGAEPLKATPWIPGHGPKLKAVLFDASHLQHTDQLKQLREFFQPLLKNLDHSAHLVILGRAPESLSDPFAASAQRALEGFSRSLAKELRNGGTLQLLYVGEGAEAQLEGALRFFLSPKSAYISGQVLRLSACPTQVHDWTRPLAGLKALVTGAARGIGASIAETLARDGAEIVLLDVPQAKADLDALAARLGGRGIALDICADDAATQLIEQLPDGIDIVVHNAGITRDKTLANMTPEYWDAVLAVNLNAPQVLTKALLDSGTLHDNGRVVLLASISGIAGNRGQTNYAASKAGLIGLAQAWAPLLAQRGISINAVAPGFIETQMTAHIPFALREAGRRMSSLGQGGLPQDVAEAVAWLGQPGSGAVSGQALRVCGQSLLGA
>NZ_CP052858.1|WP_169390239.1|4579018_4580296_-|acetyl-CoA-C-acetyltransferase
MTQLRRVAIIGGNRIPFARSNGPYATASNQAMLTAALEGLIERYNLHGLRMGEVAAGAVLKHSRDFNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVANKIALGQIECGIAGGVDTTSDAPIGVNEGLRKILLQANRSKSMADKLKVLLQLRPQHLKPELPRNGEPRTGLSMGQHCELMAQTWQIPRAEQDQLALESHQKMAASYAEGWHSDLLTPFLGLTRDNNLRPDLTLEKLASLKPAFERSEKGTLTAGNSTPLTDGASLVLLGSEAWARERGLPILAYLRDGEAAAVDFVNGAEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCKTRLGLDAPLGSIDRSRLNVKGSSLAAGHPFAATGGRIVANLAKLLDAAGKGRGLISICAAGGQGVTAIIER
>NZ_CP052858.1|WP_029297573.1|4577947_4578844_-|serine-protein-kinase-RIO
MKTPKRIEPLIEDGLVDEVLRPLMSGKEAAVYVVRCGNELRCAKVYKEANKRSFRQAAEYQEGRKVRNSRQARAMAKGSKFGKKETEDAWQNAEVAALFRLAGAGVRVPQPYDFLEGVLLMELVADEYGDAAPRLNDVVLEPDQAREYHAFLISQIVLMLCTGLVHGDLSEFNVLLTPTGPVIIDLPQAVDAAGNNHAFTMLERDVGNMASYFGRFAPELKTTKYAKEMWALYEAGTLHPASVLTGEFDEPEELADVGGVMREIEAARLDEERRQAIRAADDAPPGKPAEEPPPPWMQ
>NZ_CP052858.1|WP_029297571.1|4577393_4577801_+|Cu(I)-responsive-transcriptional-regulator
MNIGQAARQSGLSAKMIRYYESINLLKPAHRSDSGYRLYNDDDLHTLGFIKRSRDLGFSLEEVGKLLELWQDRQRASADVKALARQHIEELDHKIRELGQLRDTLQDLVEHCQGDHRPDCPILKELASGSCCGSN
>NZ_CP052858.1|WP_029297569.1|4575195_4577397_+|copper-translocating-P-type-ATPase
MNGSTTFDLPISGMTCASCVGRVERALNKVPGVQSVSVNLANERAHVEVAGQMDPAVLIAAVEKAGYTATLPQSETATQASQEQRLKRERWSLVMAIALALPLVLPMLVQPFGLHWMLPAWVQFLLATPVQFIFGARFYVAAWKAVRAGAGNMDLLVAIGTSAGYGLSIYQWLIAPAGVEPHLYFEASAVVIALVLLGKYLESRAKRQTASAIRALEALRPERAIQLIDGREQEVAISALRLNDLVLVKPGERFPVDGEVVEGQSHADEALITGESLPVPKQPGDKVTGGAINGEGRLLVRTLALGAESVLARIIRLVEDAQAAKAPIQKLVDKVSQVFVPTVLVIALATLIGWWLYGAPLETALINAVAVLVIACPCALGLATPTAIMAGTGVAARHGILIKDAEALERAHEVSAVVFDKTGTLTSGAPKIAHLRAVDGNEALLLQQAGALQRGSEHPLAKAVLDACNDQGLPVADVSASQSLTGRGIAGTLDGRQLALGNRRMLDETGLKPGDLAANASAWEAEGRTLSWLIEQSPQLRVLGLFAFGDTLKEGALQAVQQLKARHISSHLLTGDNRGSARVVAQALGIDDVHAEVLPADKAATVAELKKTGVVAMVGDGINDAPALAAADIGIAMGGGTDVAMHAAGITLMRGDPRLVPAALEISRKTYAKIRQNLFWAFVYNLIGIPLAVFGLLNPVLAGAAMALSSVSVVSNALLLKTWKPKDLEDHRQ
>NZ_CP052858.1|WP_029297567.1|4574610_4574991_+|hypothetical-protein
MRWSFFGLASLLSLFAAVPQASAAEDYAVLIVSRERLEVPTNCEIGLYVNDQLAGRLFQEQATSFNFPEGKVSLRLKLLPGQAPGCLPGLLAPKAQEITLKAGDVRKLRIAQGADGMYLKAAKLGY
>NZ_CP052858.1|WP_029297565.1|4574267_4574465_-|heavy-metal-associated-domain-containing-protein
MQIFSVEGMTCGHCVRAVTQAVQAKDPAASVNVNLAAKEVGVESRLSPDEVISLISEEGYSAKLA
>NZ_CP052858.1|WP_029297563.1|4572987_4574181_-|multidrug-effflux-MFS-transporter
MNLRIILILGALSAFAPLAIDFYLPGFPAMAVAFGTDEKHIQLTLAVYFTGLAIGQLIYGPLADRFGRRIPLLSGVTLFTVASLACAYAPSLEWLIGARFVQALGGCAGMVISRAVVSDKCDAVGSAKVFSQLMLVVGLAPILAPMLGGVMVSLWGWQSIFLALTVFSVGAGVAVAVGLPESFPAHQPRQPLSGALRQYGRLLADRVYLGYAVTGGIAIGGMFAYIAGSPFVFIKLYGVPAEHYGWLFGTNAAGFILVAQVNARLLSKRGPAFLLTRTVWVYLAAALALLAVSALHTEALWPLLVPLFLCIASLGCIMPNTSACAMNGQGARAGSASALLGCIQFGVAAGAASLVGALHDGTAMPMSIVISLCGVLAVVVAMLTQRLQRQRALQAQV
>NZ_CP052858.1|WP_029297561.1|4572799_4572979_+|hypothetical-protein
MKILIKALAKSQGNKWQVRLDHDAFTFRTEAEARAFANTLQNRIQAPHRFPESQQRATG
>NZ_CP052858.1|WP_032867218.1|4583368_4584640_+|collagen-like-triple-helix-repeat-containing-protein
MGSTLGNVGTAIGGIGTTVGGVPVVGTAAGGLVTSVGTAVGSVGTGVGTGLGSLGTNSNSVGVTVAGVANGVADLGTGVSNTGKTLSTTLGGIPVVGGLTGGVGGAAGGLVDKVGQAVTMLGDTLSTASTTGPLGSVTNTLGGKVLVPVVSLVENTTGNLGKATGLGNPVNGLLDKVGSTVTGLGTQVAGAGGAGNPVTGAVGSVLSGVGAVAGTAGGYVAPSAGTGSGSAPASGLPELVGGLVANVGNGLNAGNTNGTVSAGGVAGGALGNTVASLGTVIGGNGVANTAATAPVAGLATNVGAALNPVTSGVSSLTQNIGTTTGIGAPVNGLVTQVGGAVSSLGGNITAANANPITNTVGQTVNTVGGVVSSVGGLVTGGTSGSGGGLLGGLNINANANATASGSATANTGVGGLLKGLTGK
>NZ_CP052858.1|WP_169390237.1|4584808_4586491_+|ShlB/FhaC/HecB-family-hemolysin-secretion/activation-protein
MRVLTPLLLLTLSAYVHAETLPSFLNSNDTIRNLPVPNLPADAYRPVTPQTQLPETPAAQAQPLLMDTKVTIRKLQIEGGTVYPLQEVAQVFEPLIGHETNLAQLIEATRSITRRYQQDGYLLSYAFLPDQRFEQGLVRVVLVEGYIKDYQVQGDIGSVSGYVDKLAQKLQAERPLTRKTFERYTTLMGRIPGVTLQAQVPPPGTTDGAAHMNIQASRKPFTSSMSMTDDSRGGLQALIAGTSNSHTAMGEQVSLSGLFPPGEDKERYYRLDYSQFINAEGTQLSLYGARYRSDPSTRIRLDGGFSLKPHRENDRFSIGLSHPLIASPSESLTLGTRFYGVNDRTRYQLVGYPQRFDVETDLRALAFEGDWRKADDRQLRILSAGLYQGIDGLGAKTRSDLEGIKSDLDFFRLRLSGVQSDKFFDNWQGVLSAALYWSDATLPDSERAVFGGQNFGRGYPDDQGSGDKGWGVAYEVNYSYNRSGDWVRIVQPYIVLDRAKAWFNNLPVKDSDMSSAAIGLRFGDAKYYNIALEAAKPMSDMALDSFNRRPRYTLSFSYQL
>NZ_CP052858.1|WP_029297585.1|4586671_4586860_-|Flp-family-type-IVb-pilin
MLPALLLRICTWWMLLVRRRDGATAIEYVILIVVIALVVLAAGKLLGPQIATFFGKVGDALT
>NZ_CP052858.1|WP_029297587.1|4586904_4587297_-|response-regulator
MNAVVTSRQQILLVDDEEDALVELAESLGNEGFVCFCASSVTDALQELTLHPDIALVITDLRMPEESGISLIKRLREHTSRQHLPVIVMSGHAEMDDVSDMLRLQVLDLFRKPIYLVRLIDTLNNLFPRA
>NZ_CP052858.1|WP_029297589.1|4587352_4587541_-|Flp-family-type-IVb-pilin
MFLTFMMKLYLQLQLLFHRKEGATAIEYVILVAVIALVVLAAGKLLGPQIAAMFAKVGAALT
>NZ_CP052858.1|WP_169390236.1|4587868_4588816_+|Flp-pilus-assembly-protein-CpaB
MNSRVSMILAGLLLIGALFAGYWGLVLSRPPEPVVEPSPSGVSVEKTVAAVEDQTRQSVVVLAHDVPPYIALTAADLTLERLRTAPAGSLTSLDQAIGRTPLRALPAGTWLDDSSFNAGGPLARMIRPDERALAVAVDEVIGAAGQLSPGDFVDVLLFLRPEGTNPEATAQVILPALRLLSVGDNLGPTNDGKPAVAPPTTDEEKARQAQRQASPPRTVVLAVPQQLMSRLMLATSAGTLRLAVRSADEQLLSQYWAGNNEAPANLQSANRELYQFTQLAMLGAPKRVAQAGGANETRRSGIEVIRGNQATQQNP
>NZ_CP052858.1|WP_029297593.1|4588835_4590038_+|type-II-and-III-secretion-system-protein-family-protein
MRQRFAPAFTQMAWALMLSSLPVGLAFGASDTCSNLGALPAVVEVGEGLQQNLQSPVAITRLAIGDPKIADVHLNGDRAFLLTGVASGATSLMVWTRCSSAPRQSMVFVKGKASSSLTSMALSPSDDPSLPSQVQTDIRFVEVSRTKLKEASTSIFGGTRNFLFGSPRTAGMSLPLDNESFNIGIGGGRFSAVINALERSGFAYTLARPSLVAMSGHSATFLAGGEVPIPVPSAGSDTISIEYKEFGIRLTLTPTVIDRTRISLKVAPEVSELDYANALQVEGIQVPALTVRRTDTTVSLADGESFVISGLISNNNRSTISKFPGLGDIPILGAFFRDSNVSREEKELLMIVTPHLVQPLAANARLPSLPGEKLRTYDPNWYRLYFLENGNFDRRTGLSQ
>NZ_CP052858.1|WP_029297595.1|4590034_4591228_+|pilus-assembly-protein
MSDSLSQTFLAITRNTTDLEWLQGALAPLGQVVSAGGGSLDELLALVDVTFANLVFVGLDREHVVAQSALIEGALEAKPMLAIVALGDGMDNQLVLNAMRAGARDFVAYGSRSSEVAGLVRRLSKRLPPVAHNAHLGGLTVLYGTQGNADGALLASHLAMVVQKSGQQTLLLDLGLPRGDSLALLGLESSFNFGDALRHLRRLDTTLINSAFTATEGGLRILAYTESDEPLEMTSAAELYMLLSALRQHFQHIVVNLTGQRDSEALRTFVSHCDKLLWCTDQNVLDCRRNLAVLNQWREKGMKLDHAKLLVDRYLKGAAPDTDALEKSFGLEAIAVLPFSPEVRLNAKNQGQTLFSLAPRETLTQNLKTLGERLAKRSEGLEKPSTRWFDRLLGTPK
>NZ_CP052858.1|WP_070994311.1|4591224_4592496_+|CpaF-family-protein
MSSEKLFGAPARGLNSAVDHDGLKLVLHRYIIDAIEESGKNLLEGSRQSLAQFVIDKVSEYITRMHLAISRYEMERLAEEIVDELTGFGPLEVLLRDPSVTEILVNGPHRVFVERDGLLHQSDLRFIDAHHVERVMQRILAPLGRRLDESSPMVDARLPDGSRVNAIIPPIALDGPCLSIRKFRKDMLKSSDLVAMQTIDQAIFEFFQEAVGKRCNILISGGTGTGKTTLLNILSQLINPHERLVTIEDVAELQLGHPHVVRLETRPPNAEGHGEVKASDLIRNALRMRPDRIILGEIRGVEVLDVMTAMNTGHDGSMSTVHANNAQDALLRLETLVGLTGRVVAEKTLRQMICAALDVVIQLTRMPDGRRCVSEVVEVVGVRDDVYVTNTLFRHDRRTGFGFLREAVNPAGDKLRRESALPL
>NZ_CP052858.1|WP_169390235.1|4592506_4593388_+|type-II-secretion-system-F-family-protein
MTGAILMFSCVILIGVSLHLFLSGLRQAETDRVLERLAEGQPLLAEERGRWVGLERMFQRAGLGKPTDSLGLWVTCWVLGALLGLLVWSWVGLAAMLVLPPLILRLYIAWRYRRRVKRMVEQLPQVLDHTVRSLKSGRTLADALLGAIDSTEAPLKPAMERIQRNVQLGVSLPEAASDFAEFYEQDEFRMLALGLKVNHRYGGNASDLLENLIKVIREREQGARQLRAMTGETRVTAFVLAGMPIAMVGYFMLINPGYLLTMWNDDSGRYMLLAALTMQVLGCLTMWRMLRSI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP052858_1	1.1\|4583083\|18\|NZ_CP052858\|CRT	4583083-4583100	18	NZ_CP052858.1	5454532-5454549	1	0.944
NZ_CP052858_1	1.1\|4583083\|18\|NZ_CP052858\|CRT	4583083-4583100	18	NZ_CP052858.1	2255143-2255160	1	0.944
NZ_CP052858_1	1.2\|4583119\|18\|NZ_CP052858\|CRT	4583119-4583136	18	NZ_CP052858.1	5454532-5454549	1	0.944
NZ_CP052858_1	1.2\|4583119\|18\|NZ_CP052858\|CRT	4583119-4583136	18	NZ_CP052858.1	2255143-2255160	1	0.944
NZ_CP052858_1	1.5\|4583239\|18\|NZ_CP052858\|CRT	4583239-4583256	18	NZ_CP052858.1	3893457-3893474	1	0.944

1. spacer 1.1|4583083|18|NZ_CP052858|CRT matches to position: 5454532-5454549, mismatch: 1, identity: 0.944

gggtggcggcgacggtgg	CRISPR spacer
gggtggcggcgacgttgg	Protospacer
************** ***

2. spacer 1.1|4583083|18|NZ_CP052858|CRT matches to position: 2255143-2255160, mismatch: 1, identity: 0.944

gggtggcggcgacggtgg	CRISPR spacer
gggtggcggcgagggtgg	Protospacer
************ *****

3. spacer 1.2|4583119|18|NZ_CP052858|CRT matches to position: 5454532-5454549, mismatch: 1, identity: 0.944

gggtggcggcgacggtgg	CRISPR spacer
gggtggcggcgacgttgg	Protospacer
************** ***

4. spacer 1.2|4583119|18|NZ_CP052858|CRT matches to position: 2255143-2255160, mismatch: 1, identity: 0.944

gggtggcggcgacggtgg	CRISPR spacer
gggtggcggcgagggtgg	Protospacer
************ *****

5. spacer 1.5|4583239|18|NZ_CP052858|CRT matches to position: 3893457-3893474, mismatch: 1, identity: 0.944

gggtggcggcaccggcgg	CRISPR spacer
ggttggcggcaccggcgg	Protospacer
** ***************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	MT939492	Xanthomonas phage Xoo-sp14, complete genome	88867-88896	5	0.833
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	254553-254582	5	0.833
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	379146-379175	5	0.833
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP013069	Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence	41556-41585	5	0.833
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP032313	Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence	238273-238302	5	0.833
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	MK977695	Gordonia phage Pupper, complete genome	74990-75019	5	0.833
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2135091-2135120	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	370395-370424	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	500175-500204	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	AP018707	Uncultured bacterium plasmid pSN1104-11 DNA, complete sequence	11203-11232	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	AP018708	Uncultured bacterium plasmid pSN1104-34 DNA, complete sequence	11287-11316	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP033227	Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence	361613-361642	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	KJ019121	Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome	44591-44620	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	AP013981	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S32-C55, * SEQUENCING IN PROGRESS *	14400-14429	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	AP014064	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C13-MedDCM-OCT-S35-C47, * SEQUENCING IN PROGRESS *	20170-20199	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1008634-1008663	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1321650-1321679	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	MF668280	Mycobacterium phage Phabba, complete genome	151022-151051	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	KR935213	Rhodobacter phage RcTitan, complete genome	15996-16025	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	447941-447970	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP006989	Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence	462404-462433	6	0.8
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_017643	Escherichia coli UMNK88 plasmid pUMNK88_Hly, complete sequence	29487-29516	6	0.8
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2135103-2135132	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	533646-533675	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	MN234174	Mycobacterium phage Efra2, complete genome	23074-23103	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	MN234165	Mycobacterium phage Yunkel11, complete genome	23090-23119	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	MN234201	Mycobacterium phage Guanica15, complete genome	23090-23119	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	543078-543107	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	MN234172	Mycobacterium phage ThulaThula, complete genome	24169-24198	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	KR080195	Mycobacterium phage Phayonce, complete genome	24163-24192	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP045385	Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence	394771-394800	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP041045	Paracoccus sp. AK26 plasmid pAK1, complete sequence	65980-66009	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2135103-2135132	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP020539	Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence	318084-318113	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	407872-407901	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1810451-1810480	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP025613	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence	784028-784057	7	0.767
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	193488-193517	7	0.767
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	878084-878113	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP023450	Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence	135678-135707	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP010956	Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence	177912-177941	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP005190	Sphingobium sp. MI1205 plasmid pMI1, complete sequence	44646-44675	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP041018	Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence	161172-161201	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	169112-169141	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	799371-799400	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP040822	Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence	48177-48206	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP040822	Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence	48333-48362	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP018865	Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence	197004-197033	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP004396	Celeribacter indicus strain P73 plasmid pP73C, complete sequence	25484-25513	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	226644-226673	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP021407	Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence	74926-74955	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP041766	Tomitella sp. HY188 plasmid unnamed, complete sequence	7094-7123	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP025614	Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence	71086-71115	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	149756-149785	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP031599	Roseovarius indicus strain DSM 26383 plasmid pRIdsm_01, complete sequence	386272-386301	8	0.733
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	118846-118875	8	0.733
NZ_CP052858_1	1.4\|4583191\|30\|NZ_CP052858\|CRT	4583191-4583220	30	NZ_CP032835	Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence	67770-67799	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP018466	Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence	22722-22751	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	AP018698	Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome	50096-50125	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_019959	Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence	77829-77858	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP018727	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence	12991-13020	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	MK977705	Gordonia Phage Mollymur, complete genome	25653-25682	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	44796-44825	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	234280-234309	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	MH651171	Mycobacterium phage Collard, complete genome	53489-53518	9	0.7
NZ_CP052858_1	1.6\|4583275\|30\|NZ_CP052858\|CRT	4583275-4583304	30	NZ_CP044991	Deinococcus sp. AJ005 plasmid p115k, complete sequence	3712-3741	10	0.667

1. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to MT939492 (Xanthomonas phage Xoo-sp14, complete genome) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
caacggcggcaccggtggcggcaccggcgg	Protospacer
 ...******** *****************

2. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
ggggtgcggcaaaggtgccggcaccggcgg	Protospacer
.**  ****** ***** ************

3. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
acggggcggcgcaggtggtggcaccggccg	Protospacer
* * ******.*******.********* *

4. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP013069 (Pannonibacter phragmitetus strain 31801 plasmid p.p-1, complete sequence) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aggcttcggcacaggtggaggcaacggcgg	Protospacer
***.  ************ **** ******

5. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP032313 (Pannonibacter phragmitetus BB plasmid p.BB_1, complete sequence) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aggcttcggcacaggtggaggcaacggcgg	Protospacer
***.  ************ **** ******

6. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to MK977695 (Gordonia phage Pupper, complete genome) position: , mismatch: 5, identity: 0.833

aggtggcggcacaggcggcggcacaggtgg-	CRISPR spacer
cagtggcggcaccggcggcggca-agatgga	Protospacer
 .********** ********** **.***

7. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgatccgggcacgggtggcggcaccggcgg	Protospacer
 *.*   *****.*****************

8. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cagggagggcacaggtggcggcagcggcgg	Protospacer
 .* *. **************** ******

9. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cggtggcggcaaaggtggcggcagcctccg	Protospacer
 ********** *********** *  * *

10. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to AP018707 (Uncultured bacterium plasmid pSN1104-11 DNA, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgatggcggcaccgatggcggcaccgatgg	Protospacer
 *.********* *.***********..**

11. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to AP018708 (Uncultured bacterium plasmid pSN1104-34 DNA, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgatggcggcaccgatggcggcaccgatgg	Protospacer
 *.********* *.***********..**

12. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP033227 (Sphingobium yanoikuyae strain SJTF8 plasmid pF1, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aggcaacggcacaggtggcggcgcaggcgc	Protospacer
***...****************.* ****

13. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to KJ019121 (Synechococcus phage ACG-2014d isolate Syn7803US78, complete genome) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aggtggcggtacaggtggcggtgatggtgg	Protospacer
*********.***********.. .**.**

14. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to AP013981 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C7-MedDCM-OCT-S32-C55, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
tggtggcggcaaaggtggcggcggtggtgg	Protospacer
 ********** **********. .**.**

15. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to AP014064 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C13-MedDCM-OCT-S35-C47, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
tggtggcggcaaaggtggcggcggtggtgg	Protospacer
 ********** **********. .**.**

16. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gggtcgcggcccaggcggcggcacagcgtg	Protospacer
.*** ***** ***************   *

17. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gggtcgcggcccaggcggcggcacagcgtg	Protospacer
.*** ***** ***************   *

18. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to MF668280 (Mycobacterium phage Phabba, complete genome) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
aacgggcggcacaggctgcggcacaggcgc	Protospacer
*.  ************ **********.*

19. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to KR935213 (Rhodobacter phage RcTitan, complete genome) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
aacgggcggcgcaggcggcggcaaaggtgc	Protospacer
*.  ******.************ *****

20. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
agacggcggcacagccggcggcacagacgt	Protospacer
**..********** ***********..*

21. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP006989 (Rhizobium sp. IE4771 plasmid pRetIE4771c, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cggtggcggcaaaggcgggggcaccgcttg	Protospacer
 ********** ****** ***** * * *

22. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_017643 (Escherichia coli UMNK88 plasmid pUMNK88_Hly, complete sequence) position: , mismatch: 6, identity: 0.8

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
aagaggcggcacaggcgcaggcacaggccg	Protospacer
*.* *************  ********. *

23. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
gggtggcggcaccggcggcggcaccccgcg	Protospacer
.*********** **.*********    *

24. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aggtggcggcatcggtggcggcataggact	Protospacer
***********. **********. **

25. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to MN234174 (Mycobacterium phage Efra2, complete genome) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
gggtggcggcgcaggtggcggcgccgcatc	Protospacer
.*********.***********.***

26. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to MN234165 (Mycobacterium phage Yunkel11, complete genome) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
gggtggcggcgcaggtggcggcgccgcatc	Protospacer
.*********.***********.***

27. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to MN234201 (Mycobacterium phage Guanica15, complete genome) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
gggtggcggcgcaggtggcggcgccgcatc	Protospacer
.*********.***********.***

28. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
ggtccggggcacgggtggccgcaccggcgg	Protospacer
.* . * *****.****** **********

29. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to MN234172 (Mycobacterium phage ThulaThula, complete genome) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
acgcggcggcaccggtggcggcaccacccc	Protospacer
* *.******** ************. *

30. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to KR080195 (Mycobacterium phage Phayonce, complete genome) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
acgcggcggcaccggtggcggcaccacccc	Protospacer
* *.******** ************. *

31. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP045385 (Ruegeria sp. THAF33 plasmid pTHAF33_a, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aaattccggcaaaggcggcggcaccggcgt	Protospacer
*..*  ***** ***.*************

32. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP041045 (Paracoccus sp. AK26 plasmid pAK1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggtggcggcaccggcgg--	CRISPR spacer
acctggcggcacgggtggcggcac--gccatc	Protospacer
*  *********.***********  ** .

33. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gggtggcggcaccggcggcggcaccccgcg	Protospacer
.*********** ***********     *

34. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP020539 (Sphingobium herbicidovorans strain MH plasmid pMSHV, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ctcaggcggcactggcggcggcacaggcgc	Protospacer
    ******** **************.*

35. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
acagcacggcccaggcggcggcccaggtgg	Protospacer
* .  .**** *********** *******

36. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cggtggcggcagaggcggcggcggcagagg	Protospacer
 ********** **********.  .* **

37. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP025613 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcgg-cacaggtgg	CRISPR spacer
tgggggcggcacaggcggcggccatgaatg-	Protospacer
 ** ***************** **....**

38. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

aggtggcggcacaggcggcggc-acaggtgg	CRISPR spacer
cggtggcggcgcaggcggcggctatgagcg-	Protospacer
 *********.*********** *...*.*

39. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
aactggcggcagaggtggcggcacgctcct	Protospacer
*. ******** ************   *

40. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP023450 (Rhizorhabdus dicambivorans strain Ndbn-20 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgctggcagcactggtggcggcaccgcttt	Protospacer
 * ****.**** ************* .

41. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP010956 (Sphingobium sp. YBL2 plasmid 2pYBL2-2, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgctggcagcactggtggcggcaccgcttt	Protospacer
 * ****.**** ************* .

42. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP005190 (Sphingobium sp. MI1205 plasmid pMI1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgctggcagcactggtggcggcaccgcttt	Protospacer
 * ****.**** ************* .

43. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP041018 (Sphingobium fuliginis ATCC 27551 plasmid pSF1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgctggcagcactggtggcggcaccgcttt	Protospacer
 * ****.**** ************* .

44. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
cgctggcagcactggtggcggcaccgcttt	Protospacer
 * ****.**** ************* .

45. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
tataggcggcacaggtggcggcataggtcc	Protospacer
 .  ***********.*******.****

46. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP040822 (Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gtccgctggcactggcggcggcacgggtgg	Protospacer
.  .* .***** ***********.*****

47. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP040822 (Paraoceanicella profunda strain D4M1 plasmid pD4M1D, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gtccgctggcactggcggcggcacgggtgg	Protospacer
.  .* .***** ***********.*****

48. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP018865 (Arthrobacter crystallopoietes strain DSM 20117 plasmid pLDW-10, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
tggtggcggcataggcggcggcctttgcga	Protospacer
 **********.********** .  *.*.

49. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP004396 (Celeribacter indicus strain P73 plasmid pP73C, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gactggcggcactggcggcagcacagatca	Protospacer
.. ********* ******.******.* .

50. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cggtggcggcaccgacggcggcacctcaga	Protospacer
 *********** *.*********    *.

51. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP021407 (Celeribacter manganoxidans strain DY25 plasmid pDY25-C, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cgcgcccggcgcaggcggcggcataggtga	Protospacer
 *    ****.************.*****.

52. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP041766 (Tomitella sp. HY188 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cgctggcggcatcggcggcggcacagtgct	Protospacer
 * ********. *************

53. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP025614 (Niveispirillum cyanobacteriorum strain TH16 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
aggtggcggcactggcggcggtattccggc	Protospacer
************ ********.*.    *

54. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cctgggcggcgctggcggcggcacaggccg	Protospacer
    ******.* **************. *

55. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP031599 (Roseovarius indicus strain DSM 26383 plasmid pRIdsm_01, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gactggcggcactggcggcagcacagatca	Protospacer
.. ********* ******.******.* .

56. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 8, identity: 0.733

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ccgaggcggcccaggcggcggcccaggccc	Protospacer
  * ****** *********** ****.

57. spacer 1.4|4583191|30|NZ_CP052858|CRT matches to NZ_CP032835 (Klebsiella pneumoniae strain INF237 plasmid pINF237_02, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggtggcggcaccggcgg	CRISPR spacer
attgtctggcgcaggtggcggcaccggccc	Protospacer
*     .***.*****************

58. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP018466 (Xanthomonas euvesicatoria strain LMG930 plasmid pLMG930.3, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ctccggcggcacaggcggcgccacataggc	Protospacer
   .**************** **** . *

59. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to AP018698 (Arthrobacter sp. MN05-02 plasmid plasmid1 DNA, complete genome) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ctccaccggcactgccggcggcacaggtgc	Protospacer
   .. ****** * **************

60. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_019959 (Mycobacterium sp. JS623 plasmid pMYCSM03, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
aggtggcggcaagggcggcggcagccccat	Protospacer
*********** .**********    ..

61. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP018727 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.2, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ctccggcggcacaggcggcgccacataggc	Protospacer
   .**************** **** . *

62. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to MK977705 (Gordonia Phage Mollymur, complete genome) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cggcggcggcacaggcggcggcgcgacgta	Protospacer
 **.******************.*..   .

63. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
cggtggcggcacaggcggccacacctaccc	Protospacer
 ****************** .***  ..

64. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
ctccggcagcacgggcggcggcacaggatc	Protospacer
   .***.****.**************

65. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to MH651171 (Mycobacterium phage Collard, complete genome) position: , mismatch: 9, identity: 0.7

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
tggtggcggcacaggccgcgggaccacacc	Protospacer
 *************** **** ** .

66. spacer 1.6|4583275|30|NZ_CP052858|CRT matches to NZ_CP044991 (Deinococcus sp. AJ005 plasmid p115k, complete sequence) position: , mismatch: 10, identity: 0.667

aggtggcggcacaggcggcggcacaggtgg	CRISPR spacer
gcccggcggcacaggcggcggcgcactcaa	Protospacer
.  .******************.**  ...

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

579026 : 585222

uncultured_Mediterranean_phage(28.57%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029297237.1\|579026_579776_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.4e-65	51.4
WP_017529674.1\|579775_580453_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.1e-43	53.1
WP_169389795.1\|580664_581498_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	8.2e-06	33.3
WP_025855149.1\|581603_582608_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	1.3e-34	36.2
WP_002554837.1\|582803_583013_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.2e-16	66.7
WP_003219273.1\|583405_583972_+	dCTP deaminase	S5VM63	Pseudomonas_phage	3.3e-75	74.2
WP_029297182.1\|584079_584277_+	hypothetical protein	NA	NA	NA	NA
WP_169389794.1\|584457_585222_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.8e-15	28.4

DBSCAN-SWA_2

1734792 : 1794483

Pseudomonas_phage(73.91%)

bacteriocin,holin,capsid,terminase,integrase,tail,transposase

attL 1731940:1731955|attR 1757850:1757865

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1731940:1731955	attL	NA	NA	NA	NA
WP_169391071.1\|1734792_1735827_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	1.6e-91	53.5
WP_029294919.1\|1735827_1736043_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_169391070.1\|1736045_1736267_-	hypothetical protein	A0A2H4J1L2	uncultured_Caudovirales_phage	2.6e-12	52.1
WP_169391069.1\|1736699_1736888_+	hypothetical protein	NA	NA	NA	NA
WP_169391068.1\|1737215_1738082_-	hypothetical protein	Q5QF30	Pseudomonas_virus	1.1e-34	43.7
WP_169391067.1\|1739103_1739517_+	hypothetical protein	NA	NA	NA	NA
WP_169391066.1\|1740204_1740456_-	hypothetical protein	NA	NA	NA	NA
WP_169391065.1\|1740479_1742525_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	8.7e-235	60.5
WP_169391064.1\|1742604_1742790_+	hypothetical protein	NA	NA	NA	NA
WP_169391063.1\|1742838_1743465_+	hypothetical protein	NA	NA	NA	NA
WP_169391062.1\|1743479_1743842_-	hypothetical protein	NA	NA	NA	NA
WP_169391061.1\|1743954_1744731_-	hypothetical protein	A0A2K9VHE7	Pseudomonas_phage	1.6e-27	35.5
WP_169391060.1\|1744832_1745396_-	siphovirus Gp157 family protein	A0A2H4IZG3	uncultured_Caudovirales_phage	2.1e-61	66.3
WP_169391059.1\|1745392_1746118_-	hypothetical protein	A0A2H4J2D5	uncultured_Caudovirales_phage	3.5e-85	67.9
WP_074851756.1\|1746191_1746383_-	hypothetical protein	NA	NA	NA	NA
WP_057959985.1\|1746379_1746571_-	hypothetical protein	NA	NA	NA	NA
WP_089042277.1\|1746567_1746990_-	hypothetical protein	A0A2H4J9E7	uncultured_Caudovirales_phage	2.5e-35	60.0
WP_169391058.1\|1747080_1747512_+	hypothetical protein	NA	NA	NA	NA
WP_169391057.1\|1747561_1747945_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	1.1e-24	59.4
WP_090291391.1\|1748008_1748302_-	hypothetical protein	NA	NA	NA	NA
WP_169391056.1\|1749002_1749254_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_090291389.1\|1749615_1749849_-	hypothetical protein	NA	NA	NA	NA
WP_169391055.1\|1749949_1750381_-	hypothetical protein	NA	NA	NA	NA
WP_169391054.1\|1750632_1751061_-	hypothetical protein	NA	NA	NA	NA
WP_169391053.1\|1751057_1752914_-	DEAD/DEAH box helicase family protein	A0A097BY72	Enterococcus_phage	2.9e-11	21.7
WP_169391052.1\|1753264_1753573_-	hypothetical protein	NA	NA	NA	NA
WP_169391051.1\|1753650_1753878_-	hypothetical protein	NA	NA	NA	NA
WP_169391050.1\|1753919_1754438_-	DUF4823 domain-containing protein	NA	NA	NA	NA
WP_169391049.1\|1754486_1755194_-	LexA family transcriptional regulator	K7PH71	Enterobacterial_phage	2.9e-52	51.4
WP_029294980.1\|1755237_1755465_+	helix-turn-helix transcriptional regulator	A0A127KNT2	Pseudomonas_phage	2.4e-08	43.9
WP_169391048.1\|1755772_1756753_+	phage replication protein	A0A1B0VME0	Pseudomonas_phage	3.9e-116	73.6
WP_169391047.1\|1756739_1757537_+	hypothetical protein	A0A1B0VMD9	Pseudomonas_phage	2.4e-95	68.5
WP_169391046.1\|1757533_1758049_+	hypothetical protein	NA	NA	NA	NA
1757850:1757865	attR	NA	NA	NA	NA
WP_169391045.1\|1758045_1758657_+	recombination protein NinG	A0A059VA66	Pseudomonas_phage	2.8e-64	66.0
WP_169391044.1\|1758653_1759235_+	hypothetical protein	A0A059VF83	Pseudomonas_phage	4.1e-73	67.4
WP_044288146.1\|1759399_1759633_+	hypothetical protein	NA	NA	NA	NA
WP_169391043.1\|1759710_1759908_+	Com family DNA-binding transcriptional regulator	B5TK59	Pseudomonas_phage	8.9e-12	86.8
WP_169391042.1\|1759904_1760723_+\|bacteriocin	lipid II-degrading bacteriocin	B5TK62	Pseudomonas_phage	2.4e-98	64.3
WP_169391041.1\|1760817_1761342_+	hypothetical protein	B5TK63	Pseudomonas_phage	6.3e-12	38.7
WP_029294997.1\|1761657_1761993_+\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	2.0e-40	75.2
WP_169389806.1\|1762132_1763308_+\|transposase	transposase	NA	NA	NA	NA
WP_169391257.1\|1763348_1763555_+	hypothetical protein	NA	NA	NA	NA
WP_169391040.1\|1763856_1764294_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_169391039.1\|1764368_1764983_+	hypothetical protein	A0A1B0VRJ1	Pseudomonas_phage	2.6e-110	94.2
WP_169391038.1\|1765014_1765491_+	DUF2280 domain-containing protein	A0A1B0VMH2	Pseudomonas_phage	1.2e-81	98.1
WP_169391037.1\|1765465_1766788_+\|terminase	terminase	A0A1B0VP58	Pseudomonas_phage	3.6e-266	99.3
WP_169391036.1\|1766784_1768203_+	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	1.2e-262	93.4
WP_169391035.1\|1768177_1769263_+\|capsid	minor capsid protein	A0A1B0VMF3	Pseudomonas_phage	7.0e-183	92.2
WP_169391034.1\|1769352_1769664_+	hypothetical protein	NA	NA	NA	NA
WP_169391033.1\|1769746_1770475_+	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	5.3e-118	91.7
WP_057959953.1\|1770487_1771453_+	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	4.7e-162	90.2
WP_169391032.1\|1771500_1772085_+	hypothetical protein	A0A1B0VMF7	Pseudomonas_phage	1.2e-59	66.8
WP_169391031.1\|1772144_1772648_+	hypothetical protein	A0A1B0VND3	Pseudomonas_phage	2.4e-77	85.6
WP_169391030.1\|1772644_1772935_-	hypothetical protein	NA	NA	NA	NA
WP_169391256.1\|1772954_1773323_+	hypothetical protein	A0A1B0VRJ4	Pseudomonas_phage	3.8e-56	88.3
WP_169391029.1\|1773319_1773916_+	hypothetical protein	A0A1B0VMI1	Pseudomonas_phage	2.9e-53	52.8
WP_169391028.1\|1773912_1774341_+	hypothetical protein	A0A2H4J5P1	uncultured_Caudovirales_phage	5.6e-51	72.5
WP_169391027.1\|1774380_1775040_+\|tail	phage tail protein	A0A0S2SYG8	Pseudomonas_phage	2.6e-79	68.7
WP_169391026.1\|1775049_1775430_+	hypothetical protein	NA	NA	NA	NA
WP_133714842.1\|1775447_1775753_+	DUF1799 domain-containing protein	A0A1B0VMG9	Pseudomonas_phage	5.8e-26	59.4
WP_169391025.1\|1775780_1778819_+\|tail	phage tail tape measure protein	A0A1B0VMG8	Pseudomonas_phage	1.5e-169	40.0
WP_169391024.1\|1778822_1779161_+\|tail	phage tail protein	A0A1B0VMG7	Pseudomonas_phage	1.7e-50	79.5
WP_169391023.1\|1779172_1779925_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	7.1e-142	93.2
WP_169391022.1\|1779927_1780692_+	C40 family peptidase	A0A1B0VP68	Pseudomonas_phage	3.5e-136	86.0
WP_169391021.1\|1780826_1781078_-	hypothetical protein	NA	NA	NA	NA
WP_169391020.1\|1781159_1781417_-	protein L	NA	NA	NA	NA
WP_169391019.1\|1781415_1782060_+	hypothetical protein	NA	NA	NA	NA
WP_169391018.1\|1782143_1782494_+	hypothetical protein	NA	NA	NA	NA
WP_169391017.1\|1782556_1783168_+\|tail	tail assembly protein	A0A1B0VMI5	Pseudomonas_phage	1.8e-79	76.4
WP_169391016.1\|1787093_1787423_+	hypothetical protein	NA	NA	NA	NA
WP_169391015.1\|1787422_1788079_+	hypothetical protein	A0A2D1GNS6	Pseudomonas_phage	1.3e-75	62.4
WP_169391014.1\|1788143_1788920_+\|tail	phage tail protein	A0A0S2SY45	Pseudomonas_phage	3.2e-36	48.1
WP_169391013.1\|1789206_1789458_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	3.2e-14	54.8
WP_169391012.1\|1789573_1790122_+	hypothetical protein	A0A2H4P763	Pseudomonas_phage	5.7e-16	35.8
WP_169391011.1\|1790118_1790544_+	cell wall hydrolase	A0A2D1GNI1	Pseudomonas_phage	7.2e-75	92.2
WP_169391010.1\|1790591_1790741_-	hypothetical protein	NA	NA	NA	NA
WP_169391255.1\|1790814_1791015_+	hypothetical protein	A0A1B0VMJ0	Pseudomonas_phage	2.1e-24	87.9
WP_169391009.1\|1791120_1791909_-	hypothetical protein	NA	NA	NA	NA
WP_169391008.1\|1792857_1794483_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-70	45.1

DBSCAN-SWA_3

2747965 : 2754981

uncultured_Caudovirales_phage(85.71%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029293588.1\|2747965_2748637_+	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.9e-110	95.5
WP_029293586.1\|2748724_2749117_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.4e-56	84.6
WP_070995989.1\|2749118_2749469_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	6.2e-40	68.3
WP_169390678.1\|2749468_2749762_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	3.5e-28	64.6
WP_154906130.1\|2749758_2750094_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	4.2e-46	80.2
WP_029293577.1\|2750090_2751092_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.5e-166	86.6
WP_070995986.1\|2751180_2752176_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_169390677.1\|2752305_2753700_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_029293570.1\|2753700_2754981_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.4e-97	53.0

DBSCAN-SWA_4

3142656 : 3151284

Pseudomonas_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169390572.1\|3142656_3143799_-	FAD-dependent oxidoreductase	A0A1B1ITR3	uncultured_Mediterranean_phage	1.6e-07	26.6
WP_169390571.1\|3143798_3144824_-	glycosyltransferase	NA	NA	NA	NA
WP_169390570.1\|3145160_3145673_-	DUF2514 domain-containing protein	NA	NA	NA	NA
WP_169390569.1\|3145669_3146179_-	glycoside hydrolase family 104 protein	A0A1Y0T0U4	Pseudomonas_phage	4.2e-53	59.5
WP_169390568.1\|3146291_3148076_-	hypothetical protein	A0A1S5R3Z6	Pseudomonas_phage	5.8e-09	49.2
WP_169390567.1\|3148237_3149662_-	hypothetical protein	A0A0H5ART3	Pseudomonas_phage	1.2e-121	49.0
WP_169391210.1\|3149748_3150288_-	hypothetical protein	A0A0S2SYD9	Pseudomonas_phage	6.9e-06	27.3
WP_169391211.1\|3150174_3151284_+	hypothetical protein	A0A2H4J107	uncultured_Caudovirales_phage	3.1e-61	49.3

DBSCAN-SWA_5

3860398 : 3923132

uncultured_Caudovirales_phage(31.82%)

holin,tRNA,lysis,plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_169390404.1\|3860398_3862114_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_029295348.1\|3862134_3863088_+	hypothetical protein	NA	NA	NA	NA
WP_070994467.1\|3863116_3864175_-	DNA polymerase IV	NA	NA	NA	NA
WP_169390403.1\|3865168_3867811_+	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_169390402.1\|3867810_3869091_+	virulence factor family protein	NA	NA	NA	NA
WP_029295342.1\|3869164_3871066_-	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	4.1e-77	33.9
WP_029295337.1\|3871369_3872710_+	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_169390401.1\|3872813_3873284_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_029295333.1\|3873471_3874182_+	RNA-binding protein S4	NA	NA	NA	NA
WP_029295331.1\|3874248_3874710_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	4.5e-38	51.3
WP_092237912.1\|3874713_3875409_+\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_003172178.1\|3875586_3876366_-	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_029295328.1\|3876491_3877418_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_029295326.1\|3877414_3877777_-	diacylglycerol kinase	NA	NA	NA	NA
WP_029295324.1\|3877851_3878502_-	response regulator transcription factor	NA	NA	NA	NA
WP_070994808.1\|3878663_3879374_-	DTW domain-containing protein	NA	NA	NA	NA
WP_070994807.1\|3879567_3880002_+	hypothetical protein	NA	NA	NA	NA
WP_029295318.1\|3880275_3881388_+	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_092237924.1\|3881556_3882024_-	recombination regulator RecX	NA	NA	NA	NA
WP_029295312.1\|3882032_3883091_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	1.4e-111	62.4
WP_029295310.1\|3883174_3883675_-	CinA family protein	B5TK85	Pseudomonas_phage	3.0e-72	84.9
WP_169390400.1\|3883756_3884263_-\|lysis	lysis protein	A0A2H4IZW4	uncultured_Caudovirales_phage	2.8e-33	52.1
WP_169391199.1\|3884253_3884802_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	3.1e-78	79.0
WP_169390399.1\|3884821_3885832_-	phage late control D family protein	A0A2H4JH05	uncultured_Caudovirales_phage	5.9e-99	54.4
WP_169390398.1\|3885841_3886054_-\|tail	phage tail protein	A0A2H4JGD9	uncultured_Caudovirales_phage	4.8e-19	64.3
WP_029295297.1\|3886046_3886430_-\|tail	phage tail protein	B0ZSH2	Halomonas_phage	5.6e-34	56.7
WP_029295295.1\|3887922_3888489_-\|tail	phage tail assembly protein	B0ZSH0	Halomonas_phage	2.2e-26	36.6
WP_029295294.1\|3888659_3889166_-\|tail	phage tail protein	Q6R4W3	Vibrio_virus	1.0e-22	33.9
WP_029295293.1\|3889165_3890332_-\|tail	tail protein	B0ZSG8	Halomonas_phage	4.2e-125	57.2
WP_029295291.1\|3890334_3890538_-	hypothetical protein	NA	NA	NA	NA
WP_029295289.1\|3890627_3890864_-	hypothetical protein	NA	NA	NA	NA
WP_029295287.1\|3890875_3891628_-	hypothetical protein	NA	NA	NA	NA
WP_029295285.1\|3891661_3892195_-\|tail	phage tail protein	B0ZSG1	Halomonas_phage	5.0e-49	58.7
WP_029295284.1\|3892191_3892830_-\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	4.3e-39	54.5
WP_029295282.1\|3892826_3893822_-\|plate	baseplate J/gp47 family protein	A0A2H4JC04	uncultured_Caudovirales_phage	6.6e-111	62.9
WP_029295280.1\|3893818_3894151_-\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	4.7e-37	69.1
WP_169390397.1\|3894160_3894772_-\|plate	phage baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	8.6e-45	54.8
WP_169390396.1\|3894775_3895288_-	hypothetical protein	NA	NA	NA	NA
WP_029295276.1\|3895309_3895642_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	3.2e-46	85.0
WP_071610020.1\|3896242_3896971_-	helix-turn-helix transcriptional regulator	B5TK58	Pseudomonas_phage	2.8e-119	87.7
WP_169390395.1\|3897881_3898052_+	hypothetical protein	NA	NA	NA	NA
WP_169390394.1\|3898266_3900858_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	5.6e-29	22.4
WP_029295271.1\|3901000_3901324_+	ferredoxin family protein	NA	NA	NA	NA
WP_169390393.1\|3901822_3902917_-	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
WP_169390392.1\|3903088_3905140_+\|tRNA	methionine--tRNA ligase	NA	NA	NA	NA
WP_070994789.1\|3905245_3905797_+	NADH:quinone oxidoreductase	NA	NA	NA	NA
WP_169390391.1\|3905793_3907002_+	electron transport complex subunit RsxB	NA	NA	NA	NA
WP_169390390.1\|3906988_3907954_+	RnfABCDGE type electron transport complex subunit D	NA	NA	NA	NA
WP_169390389.1\|3907950_3908556_+	RnfABCDGE type electron transport complex subunit G	NA	NA	NA	NA
WP_070994785.1\|3908548_3909052_+	hypothetical protein	NA	NA	NA	NA
WP_029295251.1\|3909068_3909707_+	endonuclease III	NA	NA	NA	NA
WP_029295249.1\|3909814_3909997_+	hypothetical protein	NA	NA	NA	NA
WP_029295246.1\|3910058_3910691_-	response regulator transcription factor	NA	NA	NA	NA
WP_029295244.1\|3911314_3912532_-	argininosuccinate synthase	NA	NA	NA	NA
WP_070994784.1\|3912744_3913653_-	OmpA family protein	NA	NA	NA	NA
WP_070994783.1\|3913809_3914856_+	dihydroorotase	NA	NA	NA	NA
WP_029295237.1\|3914852_3915524_+	ribonuclease T	NA	NA	NA	NA
WP_003172097.1\|3915594_3916197_-	peroxiredoxin	NA	NA	NA	NA
WP_038442994.1\|3916432_3916651_+	bacterioferritin-associated ferredoxin	NA	NA	NA	NA
WP_038442996.1\|3916852_3917323_+	bacterioferritin	NA	NA	NA	NA
WP_029295186.1\|3917489_3917828_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_169390388.1\|3917931_3920040_-	molybdopterin oxidoreductase family protein	NA	NA	NA	NA
WP_029295181.1\|3920475_3921396_+	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.5e-19	29.0
WP_029295179.1\|3921392_3922502_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.9e-24	31.9
WP_029295178.1\|3922661_3923132_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA

DBSCAN-SWA_6

5847070 : 5897132

Klosneuvirus(20.0%)

protease,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_070994075.1\|5847070_5848768_-\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	1.7e-50	29.9
WP_029300682.1\|5848900_5850373_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_010207128.1\|5850466_5851060_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_057440249.1\|5851381_5853376_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.5e-18	27.4
WP_029300678.1\|5853560_5854739_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-26	37.6
WP_029300676.1\|5854735_5855581_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_029300674.1\|5855648_5856596_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029300672.1\|5857023_5858400_+	L-serine ammonia-lyase	NA	NA	NA	NA
WP_029300670.1\|5858897_5860001_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_029300669.1\|5860111_5860375_-	hypothetical protein	NA	NA	NA	NA
WP_169389969.1\|5860740_5861214_-	thioesterase	NA	NA	NA	NA
WP_029300666.1\|5861331_5862297_-	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_169389968.1\|5862443_5863331_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_029300664.1\|5863405_5864344_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029300663.1\|5864537_5865473_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_104911054.1\|5866394_5866802_-	DUF3010 family protein	NA	NA	NA	NA
WP_029296999.1\|5866844_5867246_-	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_169389967.1\|5867466_5868444_+	membrane dipeptidase	NA	NA	NA	NA
WP_003194877.1\|5868513_5869044_+	hypothetical protein	NA	NA	NA	NA
WP_029296994.1\|5869059_5871120_+	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_169389966.1\|5871275_5873219_+	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_169389965.1\|5873218_5874439_+	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_092230994.1\|5874454_5875225_+	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_029296987.1\|5876030_5877326_-	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_029296985.1\|5877607_5878708_+	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_169389964.1\|5878711_5879527_-	carbon-nitrogen hydrolase	NA	NA	NA	NA
WP_169389963.1\|5879523_5880969_-	cytosine permease	NA	NA	NA	NA
WP_169389962.1\|5881233_5883048_+	NAD(P)-binding protein	NA	NA	NA	NA
WP_029296975.1\|5883111_5884152_-	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_169389961.1\|5884242_5884971_+	conjugal transfer protein TraX	NA	NA	NA	NA
WP_169389960.1\|5885229_5886483_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.1e-99	52.2
WP_010207084.1\|5886505_5887756_+	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_003194855.1\|5887771_5888074_+	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_092230973.1\|5888070_5891088_+	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_070994478.1\|5891211_5891844_+	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_029296961.1\|5891986_5892844_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_029296959.1\|5893025_5894225_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	2.5e-11	29.7
WP_029296957.1\|5894361_5894820_-	anti-sigma factor	NA	NA	NA	NA
WP_029296955.1\|5895002_5895572_+	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_029296954.1\|5895568_5896456_-	acyltransferase	NA	NA	NA	NA
WP_029296952.1\|5896631_5897132_+\|protease	ATP-dependent zinc protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP052858.1|WP_038442994.1|3916432_3916651_+|bacterioferritin-associated-ferredoxin

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP052858.1|WP_038442994.1|3916432_3916651_+|bacterioferritin-associated-ferredoxin

3916432_3916651_+

72 aa aa

3860398-3923132

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP052858_1	Orphan	1.5\|4583239\|18\|NZ_CP052858\|CRT	4583239-4583256	18	3893457-3893474	1

1. spacer 1.5|4583239|18|NZ_CP052858|CRT matches to NZ_CP052858 position: 3893457-3893474, mismatch: 1

gggtggcggcaccggcgg	CRISPR spacer
ggttggcggcaccggcgg	Protospacer
** ***************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP052858

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information